Toll-interacting protein

Overview
NameToll-interacting protein
Smed IDSMED30025399
Length (bp)1336
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Toll-interacting protein (SMED30025399) t-SNE clustered cells

Violin plots show distribution of expression levels for Toll-interacting protein (SMED30025399) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Toll-interacting protein (SMED30025399) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Toll-interacting protein (SMED30025399) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025399

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025399h1SMcG0006372 Contig340GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025399h1SMcG0011986 Contig340GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
posterior sideSMED30025399h1SMcG0006372 dd_Smed_v4_1937_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30025399h1SMcG0006372 dd_Smed_v4_1937_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30025399h1SMcG0006372 OX_Smed_1.0.07308ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Toll-interacting protein vs. Ensembl Human
Match: TOLLIP (toll interacting protein [Source:HGNC Symbol;Acc:HGNC:16476])

HSP 1 Score: 176.022 bits (445), Expect = 2.596e-51
Identity = 104/276 (37.68%), Postives = 161/276 (58.33%), Query Frame = 1
Query:   88 SIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLS---IKEVQMIQPQAYPL------------PIRQMIAPGYP--IPVQQHQMRPPVVI------TDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            ++  +R    +GELP+DFLRI  P   Q    +    +Q  +       T  +L IT++QA+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C +P GV++ ++ IFDE+  S D+ IA+  IT P  + +G V D WY L+GRQG+++EG IN+V+S   +    ++ PQ   L            PI  M A   P  +PV      PP  +      ++ D+  + +MFP  D+++++ +LE   GNK++AI++LL + ++
Sbjct:    4 TVSTQRGPVYIGELPQDFLRI-TPTQQQRQVQLDAQAAQ-QLQYGGAVGTVGRLNITVVQAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPV----ALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEE 273          
BLAST of Toll-interacting protein vs. Ensembl Human
Match: TOLLIP (toll interacting protein [Source:HGNC Symbol;Acc:HGNC:16476])

HSP 1 Score: 166.777 bits (421), Expect = 3.064e-48
Identity = 86/216 (39.81%), Postives = 132/216 (61.11%), Query Frame = 1
Query:  268 ARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLS---IKEVQMIQPQAYPL------------PIRQMIAPGYP--IPVQQHQMRPPVVI------TDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            A+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C +P GV++ ++ IFDE+  S D+ IA+  IT P  + +G V D WY L+GRQG+++EG IN+V+S   +    ++ PQ   L            PI  M A   P  +PV      PP  +      ++ D+  + +MFP  D+++++ +LE   GNK++AI++LL + ++
Sbjct:   34 AKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVA----LPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEE 245          
BLAST of Toll-interacting protein vs. Ensembl Human
Match: TOLLIP (toll interacting protein [Source:HGNC Symbol;Acc:HGNC:16476])

HSP 1 Score: 151.754 bits (382), Expect = 6.266e-43
Identity = 79/208 (37.98%), Postives = 124/208 (59.62%), Query Frame = 1
Query:  292 ITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLS---IKEVQMIQPQAYPL------------PIRQMIAPGYP--IPVQQHQMRPPVVI------TDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            +TRMDPYC++R+G+  YET TA NG+KNP WNK   C +P GV++ ++ IFDE+  S D+ IA+  IT P  + +G V D WY L+GRQG+++EG IN+V+S   +    ++ PQ   L            PI  M A   P  +PV      PP  +      ++ D+  + +MFP  D+++++ +LE   GNK++AI++LL + ++
Sbjct:    1 MTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVA----LPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEE 204          
BLAST of Toll-interacting protein vs. Ensembl Human
Match: TOLLIP (toll interacting protein [Source:HGNC Symbol;Acc:HGNC:16476])

HSP 1 Score: 142.51 bits (358), Expect = 8.489e-40
Identity = 60/110 (54.55%), Postives = 83/110 (75.45%), Query Frame = 1
Query:  268 ARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLS 597
            A+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C +P GV++ ++ IFDE+  S D+ IA+  IT P  + +G V D WY L+GRQG+++EG IN+V+S
Sbjct:   12 AKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLRQGKVEDKWYSLSGRQGDDKEGMINLVMS 121          
BLAST of Toll-interacting protein vs. Ensembl Human
Match: TOLLIP (toll interacting protein [Source:HGNC Symbol;Acc:HGNC:16476])

HSP 1 Score: 141.739 bits (356), Expect = 1.753e-39
Identity = 60/110 (54.55%), Postives = 83/110 (75.45%), Query Frame = 1
Query:  268 ARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLS 597
            A+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C +P GV++ ++ IFDE+  S D+ IA+  IT P  + +G V D WY L+GRQG+++EG IN+V+S
Sbjct:   12 AKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLRQGKVEDKWYSLSGRQGDDKEGMINLVMS 121          
BLAST of Toll-interacting protein vs. Ensembl Celegans
Match: tli-1 (ToLlIp homolog [Source:UniProtKB/TrEMBL;Acc:Q93565])

HSP 1 Score: 168.318 bits (425), Expect = 3.356e-49
Identity = 98/252 (38.89%), Postives = 149/252 (59.13%), Query Frame = 1
Query:   85 ESIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEVQMIQPQAYPLPIRQMIAPGYPIPVQQHQMRPPVVITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLS 840
            E++ E+R++ L+GELP  FLR+  P   Q+  P ++ P  V  +P     T  +L +TI++A L KNYG+ RMDPYC+VRVG+  ++T  A N  + P WN+     +P  VE+I+I IFDEK    DE IA+  I  P  IF G+ ID ++ L+G+QGE +EG I++  S   +         LP++Q          +      PV IT+ D  ++ EMFP  DK+++K +LEE  G+KE+A+SA+L ++
Sbjct:    4 ETVAERRRQVLVGELPPHFLRLAVP-IQQTAEPEIVQPRMVSFVPP---NTRGRLSVTILEANLVKNYGLVRMDPYCRVRVGNVEFDTNVAANAGRAPTWNRTLNAYLPMNVESIYIQIFDEKAFGPDEVIAWAHIMLPLAIFNGDNIDEYFQLSGQQGEGKEGMIHLHFSFAPID--------LPLQQAAP------AEPAPAPLPVEITEEDTKEIQEMFPIVDKEVIKCILEERRGDKEAAVSAILEMT 237          
BLAST of Toll-interacting protein vs. Ensembl Zebrafish
Match: tollip (toll interacting protein [Source:NCBI gene;Acc:336876])

HSP 1 Score: 181.8 bits (460), Expect = 1.051e-53
Identity = 105/274 (38.32%), Postives = 161/274 (58.76%), Query Frame = 1
Query:   88 SIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEV---QMIQPQAYPL-PIRQMIAPGY----PIPVQQHQ--------MRPPVV-----ITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            +I  +R +  +GELP+DFLRI      Q          Q+         T  +L IT++QA+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C +P GV++ ++ IFDE+  S D+ IA+  +T P  + +G V+D WY L+GRQG+++EG IN+V+S   +    M+QPQ   L P       GY     +P   +Q          PPV       ++ D+  + +MFP  DK++++ +LE   GNK++AI++LL ++++
Sbjct:    4 TISTQRGQVYIGELPQDFLRIMPTQQQQQVQLDAQAARQLQY--GGSLGTAGRLSITVVQAKLAKNYGMTRMDPYCRIRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIFDERAFSMDDRIAWTHVTIPENLREGTVVDEWYSLSGRQGDDKEGMINLVMSFATIPAGMMMQPQPVVLMPTVYQQGVGYVPIAGVPGMYNQGVVPMGMPAAPPVASQSAPCSEEDLKALQDMFPNLDKEVIRTVLEAQQGNKDAAINSLLQMAEE 275          
BLAST of Toll-interacting protein vs. Ensembl Zebrafish
Match: tollip (toll interacting protein [Source:NCBI gene;Acc:336876])

HSP 1 Score: 173.711 bits (439), Expect = 5.149e-51
Identity = 87/214 (40.65%), Postives = 134/214 (62.62%), Query Frame = 1
Query:  268 ARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEV---QMIQPQAYPL-PIRQMIAPGY----PIPVQQHQ--------MRPPVV-----ITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            A+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C +P GV++ ++ IFDE+  S D+ IA+  +T P  + +G V+D WY L+GRQG+++EG IN+V+S   +    M+QPQ   L P       GY     +P   +Q          PPV       ++ D+  + +MFP  DK++++ +LE   GNK++AI++LL ++++
Sbjct:   38 AKLAKNYGMTRMDPYCRIRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIFDERAFSMDDRIAWTHVTIPENLREGTVVDEWYSLSGRQGDDKEGMINLVMSFATIPAGMMMQPQPVVLMPTVYQQGVGYVPIAGVPGMYNQGVVPMGMPAAPPVASQSAPCSEEDLKALQDMFPNLDKEVIRTVLEAQQGNKDAAINSLLQMAEE 251          
BLAST of Toll-interacting protein vs. Ensembl Xenopus
Match: cdx4 (caudal type homeobox 4 [Source:Xenbase;Acc:XB-GENE-482787])

HSP 1 Score: 179.874 bits (455), Expect = 5.821e-53
Identity = 105/274 (38.32%), Postives = 159/274 (58.03%), Query Frame = 1
Query:   88 SIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEVQMIQPQ--AYPLPIRQMIAPGYPIPVQ-------------------QHQMRPPVVITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            SI  +R +  +GELP+DFLRI  P   Q    +    +Q          T  +L IT++QA+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C IP GV++ ++ IFDE+  S D+ IA+  IT P  + +G  +D W+ L+GRQG+++EG IN+V+S   V  + PQ     +P       GY +P+                    QHQ R      + D+  + +MFPT D ++++ +LE  GGN+++A+++LL + +D
Sbjct:    4 SISTQRGQVFIGELPQDFLRI-TPTQQQQQIQLDAQAAQQLQYSG-VMGTMGRLSITVVQAKLAKNYGMTRMDPYCRIRLGYAVYETPTAHNGAKNPRWNKVIQCTIPPGVDSFYLEIFDERAFSMDDRIAWTHITIPETLKEGKHVDEWFSLSGRQGDDKEGMINLVMSYTSVPAMMPQQPVVLMPTVYQQGVGY-VPIAGPIYNPGMPMAAPPPAVNPQHQTR------EEDIKFIKDMFPTMDPEVIRSVLEAQGGNRDAAVNSLLQMVED 268          
BLAST of Toll-interacting protein vs. Ensembl Xenopus
Match: cdx4 (caudal type homeobox 4 [Source:Xenbase;Acc:XB-GENE-482787])

HSP 1 Score: 176.407 bits (446), Expect = 1.230e-51
Identity = 104/270 (38.52%), Postives = 156/270 (57.78%), Query Frame = 1
Query:  100 KRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEVQMIQPQ--AYPLPIRQMIAPGYPIPVQ-------------------QHQMRPPVVITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            KR    +GELP+DFLRI  P   Q    +    +Q          T  +L IT++QA+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C IP GV++ ++ IFDE+  S D+ IA+  IT P  + +G  +D W+ L+GRQG+++EG IN+V+S   V  + PQ     +P       GY +P+                    QHQ R      + D+  + +MFPT D ++++ +LE  GGN+++A+++LL + +D
Sbjct:   11 KRPSVFIGELPQDFLRI-TPTQQQQQIQLDAQAAQQLQYSG-VMGTMGRLSITVVQAKLAKNYGMTRMDPYCRIRLGYAVYETPTAHNGAKNPRWNKVIQCTIPPGVDSFYLEIFDERAFSMDDRIAWTHITIPETLKEGKHVDEWFSLSGRQGDDKEGMINLVMSYTSVPAMMPQQPVVLMPTVYQQGVGY-VPIAGPIYNPGMPMAAPPPAVNPQHQTR------EEDIKFIKDMFPTMDPEVIRSVLEAQGGNRDAAVNSLLQMVED 271          
BLAST of Toll-interacting protein vs. Ensembl Xenopus
Match: f9 (coagulation factor 9 [Source:Xenbase;Acc:XB-GENE-941626])

HSP 1 Score: 49.6766 bits (117), Expect = 9.910e-6
Identity = 33/110 (30.00%), Postives = 52/110 (47.27%), Query Frame = 1
Query:  304 DPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGN--VIDSWYPLTGRQGENQEGQINVVLSIKEVQMIQPQ 627
            DPYC V+V ++            NP+W ++F   +P G   +   + DE T+  D+ I  G I+   E    +   IDSW  L GR   ++E Q  + L   E+ ++Q Q
Sbjct:   27 DPYCIVKVDNEVVARTATVWRDLNPFWGEEFTLHLPLGFHTLSFYVMDEDTIGHDDVI--GKISLTKEFIASHPRGIDSWVNL-GRVDPDEEVQGEIYL---ELHIMQDQ 130          
BLAST of Toll-interacting protein vs. Ensembl Mouse
Match: Tollip (toll interacting protein [Source:MGI Symbol;Acc:MGI:1891808])

HSP 1 Score: 172.17 bits (435), Expect = 5.241e-50
Identity = 106/275 (38.55%), Postives = 160/275 (58.18%), Query Frame = 1
Query:   88 SIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVL---SIKEVQMIQPQAYPL------------PIRQMIAPGYP--IPVQQHQMRPPVV-----ITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            ++  +R    +GELP+DFLRI  P   Q    +    +Q          T  +L IT++QA+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C +P GV++ ++ IFDE+  S D+ IA+  IT P  + +G V D WY L+GRQG+++EG IN+V+   S+    M+ PQ   L            PI  M A   P  +P+    M PP V       + D+  + +MFP  D+++++ +LE   GNK++AI++LL + ++
Sbjct:    4 TVSTQRGPVYIGELPQDFLRI-TPTQQQQQIQLDAQAAQQLQYGG-TVGTVGRLSITVVQAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLKQGQVEDEWYSLSGRQGDDKEGMINLVMSYTSLPAAMMMPPQPVVLMPTVYQQGVGYVPIAGMPAVCSPGMVPM---AMPPPAVAPQPRCNEEDLKAIQDMFPNMDREVIRSVLEAQRGNKDAAINSLLQMGEE 273          
BLAST of Toll-interacting protein vs. Ensembl Mouse
Match: Tollip (toll interacting protein [Source:MGI Symbol;Acc:MGI:1891808])

HSP 1 Score: 169.474 bits (428), Expect = 4.825e-49
Identity = 105/265 (39.62%), Postives = 156/265 (58.87%), Query Frame = 1
Query:  118 LGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVL---SIKEVQMIQPQAYPL------------PIRQMIAPGYP--IPVQQHQMRPPVV-----ITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            +GELP+DFLRI  P   Q    +    +Q          T  +L IT++QA+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C +P GV++ ++ IFDE+  S D+ IA+  IT P  + +G V D WY L+GRQG+++EG IN+V+   S+    M+ PQ   L            PI  M A   P  +P+    M PP V       + D+  + +MFP  D+++++ +LE   GNK++AI++LL + ++
Sbjct:   10 IGELPQDFLRI-TPTQQQQQIQLDAQAAQQLQYGG-TVGTVGRLSITVVQAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLKQGQVEDEWYSLSGRQGDDKEGMINLVMSYTSLPAAMMMPPQPVVLMPTVYQQGVGYVPIAGMPAVCSPGMVPM---AMPPPAVAPQPRCNEEDLKAIQDMFPNMDREVIRSVLEAQRGNKDAAINSLLQMGEE 269          
BLAST of Toll-interacting protein vs. Ensembl Mouse
Match: Tollip (toll interacting protein [Source:MGI Symbol;Acc:MGI:1891808])

HSP 1 Score: 153.68 bits (387), Expect = 6.555e-44
Identity = 81/207 (39.13%), Postives = 124/207 (59.90%), Query Frame = 1
Query:  292 ITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVL---SIKEVQMIQPQAYPL------------PIRQMIAPGYP--IPVQQHQMRPPVV-----ITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            +TRMDPYC++R+G+  YET TA NG+KNP WNK   C +P GV++ ++ IFDE+  S D+ IA+  IT P  + +G V D WY L+GRQG+++EG IN+V+   S+    M+ PQ   L            PI  M A   P  +P+    M PP V       + D+  + +MFP  D+++++ +LE   GNK++AI++LL + ++
Sbjct:    1 MTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLKQGQVEDEWYSLSGRQGDDKEGMINLVMSYTSLPAAMMMPPQPVVLMPTVYQQGVGYVPIAGMPAVCSPGMVPM---AMPPPAVAPQPRCNEEDLKAIQDMFPNMDREVIRSVLEAQRGNKDAAINSLLQMGEE 204          
BLAST of Toll-interacting protein vs. Ensembl Mouse
Match: Tollip (toll interacting protein [Source:MGI Symbol;Acc:MGI:1891808])

HSP 1 Score: 145.206 bits (365), Expect = 1.568e-40
Identity = 81/183 (44.26%), Postives = 116/183 (63.39%), Query Frame = 1
Query:   88 SIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEV---QMIQPQ 627
            ++  +R    +GELP+DFLRI  P   Q    +    +Q          T  +L IT++QA+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C +P GV++ ++ IFDE+  S D+ IA+  IT P  + +G V D WY L+GRQG+++EG IN+V+S   +    M+ PQ
Sbjct:    4 TVSTQRGPVYIGELPQDFLRI-TPTQQQQQIQLDAQAAQQLQYGG-TVGTVGRLSITVVQAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLKQGQVEDEWYSLSGRQGDDKEGMINLVMSYTSLPAAMMMPPQ 184          
BLAST of Toll-interacting protein vs. UniProt/SwissProt
Match: sp|Q3B8H2|TOIPA_XENLA (Toll-interacting protein A OS=Xenopus laevis OX=8355 GN=tollip-a PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 2.108e-53
Identity = 103/267 (38.58%), Postives = 158/267 (59.18%), Query Frame = 1
Query:   88 SIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEVQMIQPQA----YPLPIRQMIA----------PGYPIPVQQHQMRPPVVITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            SI  +R +  +GELP+DFLRI  P   Q    +    +Q          T  +L IT++QA+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C IP GV++ ++ IFDE+  S D+ IA+  IT P  + +G  +D W+ L+GRQG+++EG IN+V+S   V  + P       P   +Q +           PG P+      + P     ++D+  + +MFPT D ++++ +LE  GGN+++AI++LL + +D
Sbjct:    4 SISTQRGQVFIGELPQDFLRIA-PTQQQQQIQLDAQAAQQLQYSG-VMGTMGRLSITVVQAKLAKNYGMTRMDPYCRIRLGYAVYETPTAHNGAKNPRWNKVIQCTIPPGVDSFYLEIFDERAFSMDDRIAWTHITIPETLKEGKHVDEWFSLSGRQGDDKEGMINLVMSYTSVPAMMPAQPVVLMPTVYQQGVGYVPIAGPVYNPGMPMIASPPAVNPQHQTQEVDIQSIKDMFPTIDPEVIRSVLEAQGGNRDAAINSLLQMVED 268          
BLAST of Toll-interacting protein vs. UniProt/SwissProt
Match: sp|Q6DFR0|TOLIP_XENTR (Toll-interacting protein OS=Xenopus tropicalis OX=8364 GN=tollip PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 3.084e-52
Identity = 105/274 (38.32%), Postives = 159/274 (58.03%), Query Frame = 1
Query:   88 SIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEVQMIQPQ--AYPLPIRQMIAPGYPIPVQ-------------------QHQMRPPVVITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            SI  +R +  +GELP+DFLRI  P   Q    +    +Q          T  +L IT++QA+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C IP GV++ ++ IFDE+  S D+ IA+  IT P  + +G  +D W+ L+GRQG+++EG IN+V+S   V  + PQ     +P       GY +P+                    QHQ R      + D+  + +MFPT D ++++ +LE  GGN+++A+++LL + +D
Sbjct:    4 SISTQRGQVFIGELPQDFLRI-TPTQQQQQIQLDAQAAQQLQYSG-VMGTMGRLSITVVQAKLAKNYGMTRMDPYCRIRLGYAVYETPTAHNGAKNPRWNKVIQCTIPPGVDSFYLEIFDERAFSMDDRIAWTHITIPETLKEGKHVDEWFSLSGRQGDDKEGMINLVMSYTSVPAMMPQQPVVLMPTVYQQGVGY-VPIAGPIYNPGMPMAAPPPAVNPQHQTR------EEDIKFIKDMFPTMDPEVIRSVLEAQGGNRDAAVNSLLQMVED 268          
BLAST of Toll-interacting protein vs. UniProt/SwissProt
Match: sp|Q7ZV43|TOLIP_DANRE (Toll-interacting protein OS=Danio rerio OX=7955 GN=tollip PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 3.215e-52
Identity = 103/274 (37.59%), Postives = 161/274 (58.76%), Query Frame = 1
Query:   88 SIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEV---QMIQPQAYPL-PIRQMIAPGY----PIPVQQHQMRPPVVI-------------TDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            +I  +R +  +GELP+DFLRI      Q          Q+         T  +L IT++QA+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C +P GV++ ++ IFDE+  S D+ IA+  +T P  + +G V+D WY L+GRQG+++EG IN+V+S   +    M+QPQ   L P       GY     +P   +Q   P+ +             ++ D+  + +MFP  DK++++ +LE   GNK++AI++LL ++++
Sbjct:    4 TISTQRGQVYIGELPQDFLRIMPTQQQQQVQLDAQAARQLQY--GGSLGTAGRLSITVVQAKLAKNYGMTRMDPYCRIRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIFDERAFSMDDRIAWTHVTIPENLREGTVVDEWYSLSGRQGDDKEGMINLVMSFATIPAGMMMQPQPVVLMPTVYQQGVGYVPIAGVPGMYNQGVVPMGMPAAAPVASQSAPCSEEDLKALQDMFPNLDKEVIRTVLEAQQGNKDAAINSLLQMAEE 275          
BLAST of Toll-interacting protein vs. UniProt/SwissProt
Match: sp|Q5ZK05|TOLIP_CHICK (Toll-interacting protein OS=Gallus gallus OX=9031 GN=TOLLIP PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 3.484e-52
Identity = 99/272 (36.40%), Postives = 154/272 (56.62%), Query Frame = 1
Query:   88 SIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVL---SIKEVQMIQPQAYPL-PIRQMIAPGY---------------PIPVQQHQMRPPVVITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            ++  +R    +GELP+DFLRI  P   Q    +    +Q      P     +     +  A+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C +P GV++ ++ IFDE+  S D+ IA+  IT P  + +GNV D WY L+GRQG+++EG IN+V+   S+    M+QPQ   L P       GY               P+ +    + P  +  + D+  + +MFP  D+++++ +LE   GNK +AI++LL ++++
Sbjct:    4 TVSTQRGPVYVGELPQDFLRI-TPTQQQQQIQLDAQAAQQLQYGGPMSTVGRLSITVVQ-AKLAKNYGMTRMDPYCRIRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLKQGNVEDEWYSLSGRQGDDKEGMINLVMSYTSLPAAMMMQPQPVVLMPTVYQQGVGYVPIAGMPAVCNPDMVPVAIPPPAVNPQHLCNEEDLKSIQDMFPNMDREVIRSVLEAQRGNKNAAINSLLQMTEE 273          
BLAST of Toll-interacting protein vs. UniProt/SwissProt
Match: sp|Q6INE3|TOIPB_XENLA (Toll-interacting protein B OS=Xenopus laevis OX=8355 GN=tollip-b PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 1.418e-51
Identity = 105/275 (38.18%), Postives = 161/275 (58.55%), Query Frame = 1
Query:   88 SIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEVQMIQPQAYP---LPIRQMIAPGYPIPVQ-------------------QHQMRPPVVITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            SI  +R +  +GELP+DFLRI +P   Q    +    +Q          T  +L IT++QA+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C IP GV++ +I IFDE+  S D+ IA+  IT P  + +G  +D W+ L+G+QG+++EG IN+V+S   V  + P A P   +P       GY +P+                    QH+ R      + D+  + +MFPT D ++++ +LE  GGN+++A+++LL + +D
Sbjct:    4 SISTQRGQVFIGELPQDFLRI-SPTQQQQQIQLDAQAAQQLQYSG-VMATMGRLSITVVQAKLAKNYGMTRMDPYCRIRLGYAVYETPTAHNGAKNPRWNKVIQCTIPPGVDSFYIEIFDERAFSMDDRIAWTHITIPETLKEGKHVDEWFSLSGKQGDDKEGMINLVMSYTSVPAMMP-AQPVVLMPTVYQQGVGY-VPIADPIYNPGMPMAAPPPAVNPQHETR------EEDIQSIKDMFPTMDPEVIRSVLEAQGGNRDAAVNSLLQMVED 268          
BLAST of Toll-interacting protein vs. TrEMBL
Match: E5KCC3 (Tollip (Fragment) OS=Amphimedon queenslandica OX=400682 GN=100616078 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 9.417e-57
Identity = 117/289 (40.48%), Postives = 173/289 (59.86%), Query Frame = 1
Query:   94 EEKRKRCLLGELPEDFLRIPN-PNANQ-SNTPVLMYPSQVPMMPAPXX--------XXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEVQMI----------QPQAYP---LPIR-----QMIAPGY--PIPV-QQHQMRPPVV-------ITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            + KR R  LG+LP+DFLR+   P + Q +++    +P  VPM  +PQ             +L++TI+QA+LAKNYG+TRMDPYC+VR+GH  YET T  NGSKNP WNK F   +P+GV ++++ IF+E+ +S D+ IA+G    P ++F G  ++ W PLTG+QG+ +EG IN + S+  +  +          QP  YP   +P +     Q    GY  P P+  Q Q +P  V       +TD DV Q+ EMFPT D ++VK +LE  GGNK+ A++ LL+++ +
Sbjct:   10 QSKRDRAFLGQLPDDFLRVEEVPRSEQRTSSHQRDHPHLVPMTYSPQQLGYRHGDGSHVGKLKVTILQAKLAKNYGLTRMDPYCRVRIGHAVYETPTDINGSKNPRWNKTFSVNLPRGVTSVYVEIFNERYLSLDDRIAWGYYELPTDVFNGETVEEWIPLTGKQGDEKEGNINFIFSLSPLHQLVSSGGVPYQQQPAQYPPGFMPQQPQTQFQGSPVGYYPPTPLMMQPQQQPTAVQAPSRPPVTDEDVRQMKEMFPTVDNEVVKSVLEATGGNKDQAVTNLLSMTTE 298          
BLAST of Toll-interacting protein vs. TrEMBL
Match: A0A267EKC7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008067g1 PE=4 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 3.169e-56
Identity = 113/266 (42.48%), Postives = 161/266 (60.53%), Query Frame = 1
Query:   73 NSPQESIEEKRKRCLLGELPEDFLRIPNPNANQSNT----------PVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEVQMIQPQAYPLPIRQMIAPGYPIPVQQHQMRPPVVITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLS 840
             SP+   E +R++  LG+L  DFLRI  P                 PV  +  Q      P     + +      A+LAKNYGITRMDPYC++ VGH  +ET TA NGSKNP W+K F   +  GV+AI+I I++E T + D+ IA+ +I  PA +F+G+ +D WYPL+GRQG+++EG I++VL+++ +   QPQ   +P        +P P QQ Q + PV ITD D+  V E+FP  D +++K +LE HGGNK++AISALL +S
Sbjct:   24 GSPEAIREARRRQVFLGDLGPDFLRIAPPAGAPGQRVSMTGGPQYPPVSQFSHQQAFYNVPPNAIGRLIVTVNQ-AKLAKNYGITRMDPYCRLTVGHHVFETPTAVNGSKNPRWSKSFSVFLLDGVDAINIEIYNEMTFAEDDRIAWTLIQLPARVFQGSTVDDWYPLSGRQGDDKEGMISLVLTLENLPP-QPQVQYIPAGGYYPAQHPRPHQQQQQQQPVQITDADIGSVQEVFPDTDTEVIKSVLEAHGGNKDAAISALLQMS 287          
BLAST of Toll-interacting protein vs. TrEMBL
Match: A0A267FCH4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020323g1 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 7.293e-56
Identity = 111/266 (41.73%), Postives = 158/266 (59.40%), Query Frame = 1
Query:   73 NSPQESIEEKRKRCLLGELPEDFLRIPNPNANQSNT----------PVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEVQMIQPQAYPLPIRQMIAPGYPIPVQQHQMRPPVVITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLS 840
             SP+   E +R++  LG+L  DFLRI  P                 PV  +  Q      P     + +      A+LAKNYGITRMDPYC++ VGH  +ET TA NGSKNP W+K F   +  GV+AI+I I++E T + D+ IA+ +I  PA +F+G+ +D WYPL+GRQG+++EG I++VL+++ +   QPQ   +P      P       Q Q + PV ITD D+  V E+FP  D +++K +LE HGGNK++AISALL +S
Sbjct:   24 GSPEAIREARRRQVFLGDLGPDFLRIAPPAGAPGQRVSMTGGPQYPPVSQFSHQQAFYNVPPNAIGRLIVTVNQ-AKLAKNYGITRMDPYCRLTVGHHVFETPTAVNGSKNPRWSKSFSVFLLDGVDAINIEIYNEMTFAEDDRIAWTLIQLPARVFQGSTVDDWYPLSGRQGDDKEGMISLVLTLENLPP-QPQVQYIPAGGYY-PTQHPRPHQQQQQQPVQITDADIGSVQEVFPDTDTEVIKSVLEAHGGNKDAAISALLQMS 286          
BLAST of Toll-interacting protein vs. TrEMBL
Match: V4A7B4 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_154274 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 6.200e-55
Identity = 108/277 (38.99%), Postives = 167/277 (60.29%), Query Frame = 1
Query:   94 EEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQV------------PMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEVQMIQ--------PQAYPLPIRQ-----MIAPGYPI---PVQQHQMRPPVVITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLS 840
            EE+R + ++G+LP DFLR+ N    Q+    +M  +++             M+P+       +L I+++QA+L KNYG+T+MDPYC+VRVGH  +ET TA+NG+KNP WNK     +P GV++++I IFDE++ + D+ IA+  IT P  +  G  +D+W+ L+GRQG+ +EG IN++ S+  V  +Q        P AY  P+        + PG P+    VQ  Q RP  + TD D+ +  +MFP  D  ++K +LE + GNKES I+ALLT++
Sbjct:    7 EERRAQVMIGDLPNDFLRVSNTPEGQNQQ--VMEDARIAQVLQAQQAAGFAMVPS---NVAGRLSISVVQAKLTKNYGLTKMDPYCRVRVGHTVFETPTAYNGAKNPNWNKTIQTYLPNGVDSLYIEIFDERSFTVDDRIAWAHITIPEVVKAGETVDNWFLLSGRQGDEKEGTINLIFSLTPVSELQQTAPAVGVPVAYNTPVMMPMYYPPVQPGVPVQYPAVQPAQQRP--MYTDDDLKEFKDMFPNMDLDVIKSVLEANRGNKESTINALLTMT 276          
BLAST of Toll-interacting protein vs. TrEMBL
Match: B6RQP5 (Tollip-like protein OS=Sitophilus zeamais OX=7047 PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 8.350e-55
Identity = 108/268 (40.30%), Postives = 155/268 (57.84%), Query Frame = 1
Query:   85 ESIEEKRKRCLLGELPEDFLRI-----PNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEV-QMIQPQAYPLPIRQMIAPG-------YPIPVQQHQMRP-PV-VITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSD 843
            + I+E+R R LLG LP+DFLR+         A      + +      +  A    +  +L ITI QA+LAKNYG+TRMDPYC++RVGH  YET T  NG KNP WNK  +C IP+G+  + I IFDE+  + DE IA+  IT P ++ +G   + WYPL+G+QGE  EG IN+VLS       + P  YP+ I      G       Y  P +  +  P PV V+ + D+ Q+ EMFP  + +++K + E + GNK+  I++LL ++D
Sbjct:    7 DKIKERRNRVLLGPLPDDFLRVNISPQEQQEAADRQAAIALQQQYSSVGMAQVQNSAGRLSITIAQAKLAKNYGMTRMDPYCRIRVGHSIYETPTDPNGGKNPRWNKVIYCWIPQGISTMTIEIFDERNFTMDELIAWTQITIPQQVLQGETHEDWYPLSGKQGEGMEGMINLVLSYNATASYVYPPQYPVMIVPRADAGGVKPLKVYRTPTETEESAPEPVPVLNEADLKQIQEMFPNIENEVIKTVFEANRGNKDGTINSLLQMAD 274          
BLAST of Toll-interacting protein vs. Ensembl Cavefish
Match: tollip (toll interacting protein [Source:NCBI gene;Acc:103030622])

HSP 1 Score: 172.94 bits (437), Expect = 2.262e-50
Identity = 100/274 (36.50%), Postives = 160/274 (58.39%), Query Frame = 1
Query:   88 SIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEV----------QMIQPQAYPLPIRQMIAPGYPIPVQQHQ--MRPPVV---------ITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDD 846
            +I  +R +  +GELP+DFLRI  P   Q    +    +Q          T  +L IT++QA+LAKNYG+TRMDPYC++R+G+  YET TA NG+KNP WNK   C +P GV++ ++ IFDE+  S D+ IA+  +T P  + +G+V+D W+ L+GRQG+++EG IN+V+S   +           ++ P  Y   +  +   G P    Q    M  P V          ++ D+  + +MFP  DK++++ +LE   GNK++AI++LL ++++
Sbjct:    4 TISTQRGQVYIGELPQDFLRI-TPTQQQQQVQMDAQAAQQLQYGG-SIGTVGRLSITVVQAKLAKNYGMTRMDPYCRIRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIFDERAFSMDDRIAWTHVTIPESLREGSVVDEWFSLSGRQGDDKEGMINLVMSFASMPAGMMMASQPVVLMPTVYQQGVGYVPIAGVPGVYNQGVVPMGMPAVPAAAPRGAPCSEEDLKALQDMFPNLDKEVIRTVLEAQQGNKDAAINSLLQMAEE 275          
BLAST of Toll-interacting protein vs. Ensembl Cavefish
Match: rasal1b (RAS protein activator like 1b (GAP1 like) [Source:ZFIN;Acc:ZDB-GENE-141212-314])

HSP 1 Score: 51.6026 bits (122), Expect = 5.550e-7
Identity = 34/110 (30.91%), Postives = 56/110 (50.91%), Query Frame = 1
Query:  277 AKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKG-NVIDSWYPLTGRQ-GENQEGQINVVLSI 600
            AK+ G +  DPYC V+V ++   T T +  + NP+W +++   +P G   +   + DE T+  D     G I+   E+    + ID+W  LT     E  +G+I+V L I
Sbjct:   19 AKDSGTS--DPYCIVKVDNEVVATATVWK-NLNPFWGEEYTLHLPMGFHTLTFYVMDEDTIHDD---VIGKISLSKEVIANQSKIDNWLNLTRVDPDEEVQGEIHVALEI 122          
BLAST of Toll-interacting protein vs. Ensembl Sea Lamprey
Match: tollip (toll interacting protein [Source:NCBI gene;Acc:336876])

HSP 1 Score: 166.777 bits (421), Expect = 7.132e-49
Identity = 102/267 (38.20%), Postives = 148/267 (55.43%), Query Frame = 1
Query:  118 LGELPEDFLRIPNPNANQSNTPVLMYPSQV--PMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLS--------IKEVQMIQPQAYPLPIRQMIAPGYPIPVQQHQMRPPVVIT---------------DLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSD 843
            LGELP DFLRI +P A Q        P+++  PM+P        +L IT++QARL KNYG+TRMDPYC++R G+   ET TA NG+KNP WNK   C IP GV+  ++ IFDE+  S D+ IA+  I     + +G   D W+ L+GRQGE++EG IN++L         +++  M+QPQ          + GY        +  P                   D +V  + E+FP  + ++V+ +LE  GGN+E+AI+ALL +S+
Sbjct:   14 LGELPHDFLRI-SPTAEQQAA----RPNELARPMLP------LGRLSITVMQARLVKNYGVTRMDPYCRIRAGYAVCETPTAQNGAKNPRWNKTIHCNIPPGVDFFYLEIFDERAFSTDDRIAWAHIPIAEHVKRGETADEWFLLSGRQGEDKEGTINLLLQYTTSFRSPLRDAWMVQPQPQETLQAYYQSAGYIPVAVGEVVVVPGGDAAAQPPSAPPRTAPAPDTEVQALREVFPGLEPELVRSVLEAQGGNREAAINALLQISN 269          
BLAST of Toll-interacting protein vs. Ensembl Nematostella
Match: EDO29068 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4P5])

HSP 1 Score: 162.54 bits (410), Expect = 2.796e-48
Identity = 75/171 (43.86%), Postives = 108/171 (63.16%), Query Frame = 1
Query:   88 SIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVL-MYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLS 597
            ++   R R L G+LP+DFLR+  P       PV+ M P  +PM   P    +  +      A+LAKNYGITRMDPYC++ VG++ +ET TA NG+ NP WNK     +PKGV  I++ IFDE++ S DE +A+G++    ++  G  ID WY L+G+QGE++EG IN+V +
Sbjct:    1 AVAGSRSRVLTGDLPDDFLRLSAPAQGPGGAPVMYMPPGFMPMQQVPVGRLSITVVQ----AKLAKNYGITRMDPYCRITVGNQVFETPTAHNGANNPRWNKLIASTLPKGVSTIYVEIFDERSFSVDERVAWGLVQIREDVLNGETIDDWYSLSGKQGEDKEGMINLVFA 167          
BLAST of Toll-interacting protein vs. Planmine SMEST
Match: SMESG000056009.1 (SMESG000056009.1)

HSP 1 Score: 526.554 bits (1355), Expect = 0.000e+0
Identity = 269/269 (100.00%), Postives = 269/269 (100.00%), Query Frame = 1
Query:   52 MASLEVVNSPQESIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPXXXXXXXXXXXXXXARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEVQMIQPQAYPLPIRQMIAPGYPIPVQQHQMRPPVVITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDDGKQQ 858
            MASLEVVNSPQESIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPQYITTQQLEITIIQARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEVQMIQPQAYPLPIRQMIAPGYPIPVQQHQMRPPVVITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDDGKQQ
Sbjct:    1 MASLEVVNSPQESIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPSQVPMMPAPQYITTQQLEITIIQARLAKNYGITRMDPYCKVRVGHKTYETVTAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFPAEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEVQMIQPQAYPLPIRQMIAPGYPIPVQQHQMRPPVVITDLDVDQVHEMFPTFDKKIVKEMLEEHGGNKESAISALLTLSDDGKQQ 269          
The following BLAST results are available for this feature:
BLAST of Toll-interacting protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TOLLIP2.596e-5137.68toll interacting protein [Source:HGNC Symbol;Acc:H... [more]
TOLLIP3.064e-4839.81toll interacting protein [Source:HGNC Symbol;Acc:H... [more]
TOLLIP6.266e-4337.98toll interacting protein [Source:HGNC Symbol;Acc:H... [more]
TOLLIP8.489e-4054.55toll interacting protein [Source:HGNC Symbol;Acc:H... [more]
TOLLIP1.753e-3954.55toll interacting protein [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Toll-interacting protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tli-13.356e-4938.89ToLlIp homolog [Source:UniProtKB/TrEMBL;Acc:Q9356... [more]
back to top
BLAST of Toll-interacting protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Toll-interacting protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tollip1.051e-5338.32toll interacting protein [Source:NCBI gene;Acc:336... [more]
tollip5.149e-5140.65toll interacting protein [Source:NCBI gene;Acc:336... [more]
back to top
BLAST of Toll-interacting protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cdx45.821e-5338.32caudal type homeobox 4 [Source:Xenbase;Acc:XB-GENE... [more]
cdx41.230e-5138.52caudal type homeobox 4 [Source:Xenbase;Acc:XB-GENE... [more]
f99.910e-630.00coagulation factor 9 [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of Toll-interacting protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Tollip5.241e-5038.55toll interacting protein [Source:MGI Symbol;Acc:MG... [more]
Tollip4.825e-4939.62toll interacting protein [Source:MGI Symbol;Acc:MG... [more]
Tollip6.555e-4439.13toll interacting protein [Source:MGI Symbol;Acc:MG... [more]
Tollip1.568e-4044.26toll interacting protein [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Toll-interacting protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3B8H2|TOIPA_XENLA2.108e-5338.58Toll-interacting protein A OS=Xenopus laevis OX=83... [more]
sp|Q6DFR0|TOLIP_XENTR3.084e-5238.32Toll-interacting protein OS=Xenopus tropicalis OX=... [more]
sp|Q7ZV43|TOLIP_DANRE3.215e-5237.59Toll-interacting protein OS=Danio rerio OX=7955 GN... [more]
sp|Q5ZK05|TOLIP_CHICK3.484e-5236.40Toll-interacting protein OS=Gallus gallus OX=9031 ... [more]
sp|Q6INE3|TOIPB_XENLA1.418e-5138.18Toll-interacting protein B OS=Xenopus laevis OX=83... [more]
back to top
BLAST of Toll-interacting protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E5KCC39.417e-5740.48Tollip (Fragment) OS=Amphimedon queenslandica OX=4... [more]
A0A267EKC73.169e-5642.48Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FCH47.293e-5641.73Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
V4A7B46.200e-5538.99Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
B6RQP58.350e-5540.30Tollip-like protein OS=Sitophilus zeamais OX=7047 ... [more]
back to top
BLAST of Toll-interacting protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tollip2.262e-5036.50toll interacting protein [Source:NCBI gene;Acc:103... [more]
rasal1b5.550e-730.91RAS protein activator like 1b (GAP1 like) [Source:... [more]
back to top
BLAST of Toll-interacting protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tollip7.132e-4938.20toll interacting protein [Source:NCBI gene;Acc:336... [more]
back to top
BLAST of Toll-interacting protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Toll-interacting protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO290682.796e-4843.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Toll-interacting protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Toll-interacting protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000056009.10.000e+0100.00SMESG000056009.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025399 ID=SMED30025399|Name=Toll-interacting protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1336bp
AATTTGTTTAATTTTTATTCCTATTTATGAACATTATTTAAATTTAAATT
TATGGCATCTTTAGAAGTTGTAAATTCACCTCAGGAATCTATTGAGGAAA
AAAGAAAGCGGTGTTTATTGGGTGAACTACCAGAAGATTTTTTACGAATA
CCAAATCCTAATGCTAACCAAAGCAATACTCCAGTTTTGATGTATCCATC
TCAAGTACCAATGATGCCTGCTCCACAGTACATAACTACTCAACAACTTG
AAATTACTATTATTCAAGCTCGACTTGCTAAAAACTACGGAATAACAAGA
ATGGATCCGTATTGTAAAGTAAGAGTGGGACACAAAACTTATGAAACTGT
TACTGCTTTTAATGGTTCTAAAAATCCATATTGGAATAAGAAATTTTTTT
GTCCGATACCTAAAGGAGTTGAAGCTATTCATATTTCTATCTTTGATGAA
AAGACAATGAGCGCAGACGAAGAAATTGCCTTTGGTGTTATAACTTTTCC
AGCTGAAATTTTCAAAGGCAATGTCATAGATAGCTGGTATCCTTTGACAG
GACGACAAGGGGAAAACCAAGAAGGCCAAATTAATGTAGTTTTATCAATT
AAGGAAGTTCAAATGATTCAACCCCAAGCTTATCCATTACCAATTAGGCA
AATGATTGCTCCCGGATACCCAATTCCTGTCCAACAGCATCAAATGAGAC
CACCGGTTGTTATTACCGATTTAGATGTTGATCAGGTGCATGAAATGTTT
CCAACTTTTGATAAGAAAATTGTCAAAGAAATGTTAGAGGAACATGGTGG
CAATAAGGAATCGGCTATTTCAGCGTTGTTGACTTTATCAGACGATGGCA
AACAGCAGTAATTTATAAGATAAATACTGATTACTGTGATGAATTATTAT
AATAATTTATAATTTGTGATGAATAATTGACATTTATGTTATACTTATTA
CTATTATAGCAAAGCAAGTATTTGATACTTCATGAAAATATTATCATTGA
TCACACAGGGAGACCCTTCAATTTGAAATTAATCGATATGTAGTTATGTT
TTTAATTGCTATTTGTTTTGATTTAGAGAGCTCGGATTTAATTTGTAGTT
GGATATTAGCCCGTCTAAATTAGGTCAAATTCTAAAATTTAGCCACTTAT
TGTGCTAGCATTATTGAAAGTAAATAATTTTAAGTTAATTGCTCTGAGTT
CACGCATTACCCAAAGGTATTTTTGTGTCTTTAATTTTTCATTGATTTTG
CTGTGGTAAGTTTGTGTTGGATTTTATTTTACCGATGTGAACAACCACTA
TGAACAAGTAAGTTCAAGTCTTATTTATGAGATCGG
back to top

protein sequence of SMED30025399-orf-1

>SMED30025399-orf-1 ID=SMED30025399-orf-1|Name=SMED30025399-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=270bp
MASLEVVNSPQESIEEKRKRCLLGELPEDFLRIPNPNANQSNTPVLMYPS
QVPMMPAPQYITTQQLEITIIQARLAKNYGITRMDPYCKVRVGHKTYETV
TAFNGSKNPYWNKKFFCPIPKGVEAIHISIFDEKTMSADEEIAFGVITFP
AEIFKGNVIDSWYPLTGRQGENQEGQINVVLSIKEVQMIQPQAYPLPIRQ
MIAPGYPIPVQQHQMRPPVVITDLDVDQVHEMFPTFDKKIVKEMLEEHGG
NKESAISALLTLSDDGKQQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR000008C2_dom
IPR003892CUE
IPR009060UBA-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0002376immune system process
GO:0006914autophagy
GO:0006954inflammatory response
GO:0016310phosphorylation
GO:0045087innate immune response
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003892Ubiquitin system component CUESMARTSM00546cue_7coord: 221..263
e-value: 1.0E-7
score: 41.6
IPR003892Ubiquitin system component CUEPFAMPF02845CUEcoord: 225..263
e-value: 1.4E-9
score: 37.5
IPR003892Ubiquitin system component CUEPROSITEPS51140CUEcoord: 221..264
score: 15.836
IPR000008C2 domainSMARTSM00239C2_3ccoord: 65..162
e-value: 3.6E-9
score: 46.5
IPR000008C2 domainPFAMPF00168C2coord: 65..165
e-value: 3.9E-15
score: 56.0
IPR000008C2 domainPROSITEPS50004C2coord: 61..148
score: 10.575
NoneNo IPR availableGENE3DG3DSA:1.10.8.10coord: 218..269
e-value: 1.7E-13
score: 51.9
NoneNo IPR availablePANTHERPTHR16461FAMILY NOT NAMEDcoord: 22..266
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 59..186
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 51..187
e-value: 5.7E-19
score: 70.3
IPR009060UBA-like superfamilySUPERFAMILYSSF46934UBA-likecoord: 220..267