Condensin complex subunit 2

Overview
NameCondensin complex subunit 2
Smed IDSMED30025395
Length (bp)680
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Condensin complex subunit 2 (SMED30025395) t-SNE clustered cells

Violin plots show distribution of expression levels for Condensin complex subunit 2 (SMED30025395) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Condensin complex subunit 2 (SMED30025395) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Condensin complex subunit 2 (SMED30025395) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025395

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025395h1SMcG0002293 SmedASXL_017787SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30025395h1SMcG0002293 SmedASXL_017788SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30025395h1SMcG0002293 SmedASXL_077057SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025395h1SMcG0002293 SmedASXL_077057SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30025395h1SMcG0002293 dd_Smed_v4_8491_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025395h1SMcG0002293 dd_Smed_v4_8491_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30025395h1SMcG0002293 dd_Smed_v4_8491_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Condensin complex subunit 2 vs. Ensembl Human
Match: NCAPH (non-SMC condensin I complex subunit H [Source:HGNC Symbol;Acc:HGNC:1112])

HSP 1 Score: 68.1662 bits (165), Expect = 1.406e-13
Identity = 46/124 (37.10%), Postives = 68/124 (54.84%), Query Frame = 1
Query:   82 EDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQA----SIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 441
            E  + A  + V +I+I YAKTAK++D+K +K  MWS+L A      DA E    +A K   L   +   + S L   L   L P  +++LS+ +   CLL LANE  L +  T+D +D+L+ QG
Sbjct:   59 ESNLVAEPQKVNKIEIHYAKTAKKMDMKKLKQSMWSLLTALSGKEADA-EANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG 181          
BLAST of Condensin complex subunit 2 vs. Ensembl Human
Match: NCAPH (non-SMC condensin I complex subunit H [Source:HGNC Symbol;Acc:HGNC:1112])

HSP 1 Score: 69.707 bits (169), Expect = 3.747e-13
Identity = 46/124 (37.10%), Postives = 68/124 (54.84%), Query Frame = 1
Query:   82 EDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQA----SIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 441
            E  + A  + V +I+I YAKTAK++D+K +K  MWS+L A      DA E    +A K   L   +   + S L   L   L P  +++LS+ +   CLL LANE  L +  T+D +D+L+ QG
Sbjct:  618 ESNLVAEPQKVNKIEIHYAKTAKKMDMKKLKQSMWSLLTALSGKEADA-EANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG 740          
BLAST of Condensin complex subunit 2 vs. Ensembl Human
Match: NCAPH (non-SMC condensin I complex subunit H [Source:HGNC Symbol;Acc:HGNC:1112])

HSP 1 Score: 69.3218 bits (168), Expect = 4.771e-13
Identity = 46/124 (37.10%), Postives = 68/124 (54.84%), Query Frame = 1
Query:   82 EDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQA----SIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 441
            E  + A  + V +I+I YAKTAK++D+K +K  MWS+L A      DA E    +A K   L   +   + S L   L   L P  +++LS+ +   CLL LANE  L +  T+D +D+L+ QG
Sbjct:  607 ESNLVAEPQKVNKIEIHYAKTAKKMDMKKLKQSMWSLLTALSGKEADA-EANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG 729          
BLAST of Condensin complex subunit 2 vs. Ensembl Human
Match: NCAPH (non-SMC condensin I complex subunit H [Source:HGNC Symbol;Acc:HGNC:1112])

HSP 1 Score: 67.781 bits (164), Expect = 1.483e-12
Identity = 45/121 (37.19%), Postives = 67/121 (55.37%), Query Frame = 1
Query:   91 VTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQA----SIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 441
            + A  + V +I+I YAKTAK++D+K +K  MWS+L A      DA E    +A K   L   +   + S L   L   L P  +++LS+ +   CLL LANE  L +  T+D +D+L+ QG
Sbjct:  485 LVAEPQKVNKIEIHYAKTAKKMDMKKLKQSMWSLLTALSGKEADA-EANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG 604          
BLAST of Condensin complex subunit 2 vs. Ensembl Zebrafish
Match: ncaph (non-SMC condensin I complex, subunit H [Source:ZFIN;Acc:ZDB-GENE-070112-652])

HSP 1 Score: 58.9214 bits (141), Expect = 8.123e-10
Identity = 38/110 (34.55%), Postives = 61/110 (55.45%), Query Frame = 1
Query:  121 IDIDYAKTAKRIDVKNIKAKMWSILQASID--AIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGY 444
            I+I+YA+TAK++D+K +K  MW +L  S +  A ++++    + P      K+  FSQ I  L+  L    + +LSV +    LL LANE  L +   D   D++I QG+
Sbjct:  587 IEINYARTAKKMDMKKLKTTMWGLLTESPEKTAKQVESEDTTEVP----GEKS--FSQSIRNLVQRLPSAMATNLSVPLAFVALLHLANEKNLELHKIDGMTDIIIKQGH 690          
BLAST of Condensin complex subunit 2 vs. Ensembl Zebrafish
Match: ncaph (non-SMC condensin I complex, subunit H [Source:ZFIN;Acc:ZDB-GENE-070112-652])

HSP 1 Score: 58.9214 bits (141), Expect = 8.276e-10
Identity = 38/110 (34.55%), Postives = 61/110 (55.45%), Query Frame = 1
Query:  121 IDIDYAKTAKRIDVKNIKAKMWSILQASID--AIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGY 444
            I+I+YA+TAK++D+K +K  MW +L  S +  A ++++    + P      K+  FSQ I  L+  L    + +LSV +    LL LANE  L +   D   D++I QG+
Sbjct:  587 IEINYARTAKKMDMKKLKTTMWGLLTESPEKTAKQVESEDTTEVP----GEKS--FSQSIRNLVQRLPSAMATNLSVPLAFVALLHLANEKNLELHKIDGMTDIIIKQGH 690          
BLAST of Condensin complex subunit 2 vs. Ensembl Zebrafish
Match: ncaph (non-SMC condensin I complex, subunit H [Source:ZFIN;Acc:ZDB-GENE-070112-652])

HSP 1 Score: 58.9214 bits (141), Expect = 8.276e-10
Identity = 38/110 (34.55%), Postives = 61/110 (55.45%), Query Frame = 1
Query:  121 IDIDYAKTAKRIDVKNIKAKMWSILQASID--AIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGY 444
            I+I+YA+TAK++D+K +K  MW +L  S +  A ++++    + P      K+  FSQ I  L+  L    + +LSV +    LL LANE  L +   D   D++I QG+
Sbjct:  587 IEINYARTAKKMDMKKLKTTMWGLLTESPEKTAKQVESEDTTEVP----GEKS--FSQSIRNLVQRLPSAMATNLSVPLAFVALLHLANEKNLELHKIDGMTDIIIKQGH 690          
BLAST of Condensin complex subunit 2 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:NCBI gene;Acc:493346])

HSP 1 Score: 68.9366 bits (167), Expect = 5.125e-13
Identity = 42/116 (36.21%), Postives = 66/116 (56.90%), Query Frame = 1
Query:   91 VTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQ 438
            + A  + V +I+I YAKTAK++D+K +K+ MWS+L    ++ E      K+  +  L +   +FS +   L   L P  +++LSV +   CLL LANE  L +   DD +D+LI Q
Sbjct:  587 LVAEPQKVNKIEIHYAKTAKKMDMKRLKSNMWSLLANCPESQEEMPSSKKEEIDAALITDERIFSSVTHDLQKRLPPVMAQNLSVPLAFACLLHLANEKNLKLQGMDDLSDVLIMQ 702          
BLAST of Condensin complex subunit 2 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:NCBI gene;Acc:493346])

HSP 1 Score: 65.4698 bits (158), Expect = 7.457e-12
Identity = 42/119 (35.29%), Postives = 67/119 (56.30%), Query Frame = 1
Query:   82 EDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQ 438
            E  + A  + V +I+I YAKTAK++D+K +K+ MWS+L    ++ E   +   +  +  L +   +FS +   L   L P  +++LSV +   CLL LANE  L +   DD +D+LI Q
Sbjct:  569 ESNLVAEPQKVNKIEIHYAKTAKKMDMKRLKSNMWSLLANCPESQE--EVHWTEEIDAALITDERIFSSVTHDLQKRLPPVMAQNLSVPLAFACLLHLANEKNLKLQGMDDLSDVLIMQ 685          
BLAST of Condensin complex subunit 2 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:NCBI gene;Acc:493346])

HSP 1 Score: 65.4698 bits (158), Expect = 8.587e-12
Identity = 42/119 (35.29%), Postives = 67/119 (56.30%), Query Frame = 1
Query:   82 EDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQ 438
            E  + A  + V +I+I YAKTAK++D+K +K+ MWS+L    ++ E   +   +  +  L +   +FS +   L   L P  +++LSV +   CLL LANE  L +   DD +D+LI Q
Sbjct:  569 ESNLVAEPQKVNKIEIHYAKTAKKMDMKRLKSNMWSLLANCPESQE--EVHWTEEIDAALITDERIFSSVTHDLQKRLPPVMAQNLSVPLAFACLLHLANEKNLKLQGMDDLSDVLIMQ 685          
BLAST of Condensin complex subunit 2 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:NCBI gene;Acc:493346])

HSP 1 Score: 60.077 bits (144), Expect = 6.337e-10
Identity = 35/98 (35.71%), Postives = 56/98 (57.14%), Query Frame = 1
Query:   91 VTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANE 384
            + A  + V +I+I YAKTAK++D+K +K+ MWS+L    ++ E      K+  +  L +   +FS +   L   L P  +++LSV +   CLL LANE
Sbjct:  587 LVAEPQKVNKIEIHYAKTAKKMDMKRLKSNMWSLLANCPESQEEMPSSKKEEIDAALITDERIFSSVTHDLQKRLPPVMAQNLSVPLAFACLLHLANE 684          
BLAST of Condensin complex subunit 2 vs. Ensembl Mouse
Match: Ncaph (non-SMC condensin I complex, subunit H [Source:MGI Symbol;Acc:MGI:2444777])

HSP 1 Score: 62.7734 bits (151), Expect = 5.071e-11
Identity = 42/123 (34.15%), Postives = 66/123 (53.66%), Query Frame = 1
Query:   91 VTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSIL------QASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 441
            + A  + V +I+I YAKTAK++D+K +K  MWS+L      +A  +A   ++ Q      +    K    S L   L   L P  +++LS+ +   CLL LANE  L +  T+D +D+L+ QG
Sbjct:  611 LVAEPQKVNKIEIHYAKTAKKMDMKKLKQSMWSLLTKFSRKEADTEANHTESGQEGAPEEVADEKK---LSGLTKDLQTRLPPLMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVMQG 730          
BLAST of Condensin complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q15003|CND2_HUMAN (Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3)

HSP 1 Score: 69.707 bits (169), Expect = 1.800e-12
Identity = 46/124 (37.10%), Postives = 68/124 (54.84%), Query Frame = 1
Query:   82 EDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQA----SIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 441
            E  + A  + V +I+I YAKTAK++D+K +K  MWS+L A      DA E    +A K   L   +   + S L   L   L P  +++LS+ +   CLL LANE  L +  T+D +D+L+ QG
Sbjct:  618 ESNLVAEPQKVNKIEIHYAKTAKKMDMKKLKQSMWSLLTALSGKEADA-EANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG 740          
BLAST of Condensin complex subunit 2 vs. UniProt/SwissProt
Match: sp|O13067|CND2_XENLA (Condensin complex subunit 2 OS=Xenopus laevis OX=8355 GN=ncaph PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 9.673e-12
Identity = 40/111 (36.04%), Postives = 66/111 (59.46%), Query Frame = 1
Query:  106 KHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQ 438
            + V +I+I YAKTAK++D+K +K+ MWS+L    ++ E +   +K+  +  L +   +FS +   L   L P  +++LSV +   CLL LANE  L +   DD +D++I Q
Sbjct:  588 QKVNKIEIQYAKTAKKMDMKRLKSSMWSLLANCPESQE-EMPSSKEEIDAALITDEQVFSSVTHGLQKRLPPVMAQNLSVPLAFACLLHLANEKNLKLQGMDDLSDVMIMQ 697          
BLAST of Condensin complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q8C156|CND2_MOUSE (Condensin complex subunit 2 OS=Mus musculus OX=10090 GN=Ncaph PE=1 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 3.547e-10
Identity = 42/123 (34.15%), Postives = 66/123 (53.66%), Query Frame = 1
Query:   91 VTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSIL------QASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 441
            + A  + V +I+I YAKTAK++D+K +K  MWS+L      +A  +A   ++ Q      +    K    S L   L   L P  +++LS+ +   CLL LANE  L +  T+D +D+L+ QG
Sbjct:  611 LVAEPQKVNKIEIHYAKTAKKMDMKKLKQSMWSLLTKFSRKEADTEANHTESGQEGAPEEVADEKK---LSGLTKDLQTRLPPLMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVMQG 730          
BLAST of Condensin complex subunit 2 vs. UniProt/SwissProt
Match: sp|P38170|CND2_YEAST (Condensin complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRN1 PE=1 SV=3)

HSP 1 Score: 49.6766 bits (117), Expect = 8.118e-6
Identity = 32/112 (28.57%), Postives = 57/112 (50.89%), Query Frame = 1
Query:  112 VEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKT--IQAKKYPNLHL---SSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLI 432
            + +  + Y++ +K++DV+ +K  +W  +   I   + +    Q+      H    S+K   FS +I  +      +  KD+S +    CLL LANE GL IT T++ NDL++
Sbjct:  631 IRENKVTYSRVSKKVDVRRLKKNVWRSINNLIQEHDSRKNREQSSNDSETHTEDESTKELKFSDIIQGISKMYSDDTLKDISTSFCFICLLHLANEHGLQITHTENYNDLIV 742          
BLAST of Condensin complex subunit 2 vs. TrEMBL
Match: A0A3P8XMF4 (Condensin complex subunit 2 OS=Esox lucius OX=8010 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.485e-13
Identity = 49/129 (37.98%), Postives = 73/129 (56.59%), Query Frame = 1
Query:   61 DNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASID--AIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 441
            DN     ED +      V +I+I+YAKTAK++D+K +K  MWS+L  SI+  A E++ IQ+ +       S   +FSQ    L+  L P  +++LSV +    LL LANE  L +   DD +D++I QG
Sbjct:  575 DNVSTYGEDDLVPEPHRVNKIEINYAKTAKKMDMKRLKNTMWSLLTDSIENPAKEVQNIQSSEV------SGEKVFSQTTKTLLQSLPPTMAQNLSVPLAFVALLHLANEKNLELVKVDDMSDIIIKQG 697          
BLAST of Condensin complex subunit 2 vs. TrEMBL
Match: A0A4W5P189 (Condensin complex subunit 2 OS=Hucho hucho OX=62062 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.190e-11
Identity = 47/123 (38.21%), Postives = 72/123 (58.54%), Query Frame = 1
Query:   82 EDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTC---LFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 441
            ED +      V +I+I+YAKTAK++D+K +K  MW++L  S++    KT  AK+  N   +S+ C   +FSQ    L+  L P  +++LSV +    LL LANE  L +   DD +D++I QG
Sbjct:  590 EDDLVPEPHRVNKIEINYAKTAKKMDMKRLKNTMWNLLTDSLE----KT--AKEVENAE-TSEVCGEKVFSQTTKTLLQSLPPTMAQNLSVPLAFVALLHLANEKNLELVKVDDMSDIVIKQG 705          
BLAST of Condensin complex subunit 2 vs. TrEMBL
Match: A0A1S3NNX3 (Condensin complex subunit 2 OS=Salmo salar OX=8030 GN=LOC106580510 PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.550e-11
Identity = 43/120 (35.83%), Postives = 69/120 (57.50%), Query Frame = 1
Query:   82 EDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 441
            ED +      V +I+I+YAKTAK++D+K +K  MW++L    D++E    + +    L +S +  +FSQ    L+  L P  +++LSV +    LL LANE  L +   DD +D++I QG
Sbjct:  587 EDNLVPEPHRVNKIEINYAKTAKKMDMKRLKNTMWNLLT---DSLEKTAKEVENAETLEVSGEK-VFSQTTKTLLQSLPPTMAQNLSVPLAFVVLLHLANEKNLELVKVDDMSDIVIKQG 702          
BLAST of Condensin complex subunit 2 vs. TrEMBL
Match: A0A504YC51 (Condensin complex subunit 2 OS=Fasciola gigantica OX=46835 GN=FGIG_03238 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.727e-11
Identity = 51/188 (27.13%), Postives = 91/188 (48.40%), Query Frame = 1
Query:   67 FEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASID---------------AIEIKTI-------QAKKYPNL----------------HLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSLYNISRKR 516
              GD E  + +  + V +++I YA+TAK I+V+++K  MW  L+ S+                A E  ++       QA  +P+L                H+    C FS+LI +L + +  + +K+LS++I   CLL L+NE  L +  +D+ +D+ I QG  +++ EQ+  +   +   N + KR
Sbjct:   13 MHGDLE--LISQPRKVARVEIGYARTAKMINVRHLKTAMWDFLEDSLPNAAARSPFSAASTSSAPEPASLAGDPLSDQAVDFPDLTNEHVDEHASDGKPGSHIPGARC-FSELIDSLSSRISWQMAKELSISIALNCLLHLSNEKQLYLECSDNLSDIYISQGLPQFEQEQLSAYAPDDPEANGATKR 197          
BLAST of Condensin complex subunit 2 vs. TrEMBL
Match: A0A060W2Q5 (Condensin complex subunit 2 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00064844001 PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 2.609e-11
Identity = 46/122 (37.70%), Postives = 68/122 (55.74%), Query Frame = 1
Query:   82 EDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLS--SKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 441
            ED +      V +I+I+YAKTAK++D+K +K  MW++L  S++        AK+  N+  S  S   LFSQ    L   L P  +++LSV +    LL LANE  L +   DD +D++I QG
Sbjct:  588 EDNLVPEPYRVNKIEINYAKTAKKMDMKRLKNTMWNLLTDSLEK------PAKEVENVETSEVSGEKLFSQTTQTLRQSLPPNMAQNLSVPLAFVALLHLANEKNLELIKVDDMSDIIIKQG 703          
BLAST of Condensin complex subunit 2 vs. Ensembl Cavefish
Match: ncaph (non-SMC condensin I complex subunit H [Source:NCBI gene;Acc:103036217])

HSP 1 Score: 62.7734 bits (151), Expect = 4.392e-11
Identity = 41/123 (33.33%), Postives = 67/123 (54.47%), Query Frame = 1
Query:   82 EDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASID--AIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGY 444
            ED +      V  I+I+YA+TAK++D+K +K  MWS+L  S +  A E+++  + + P      K+  F +    L+  L    + +LSV +    LL LANE  L +   DD +D++I QG+
Sbjct:  574 EDCLVPEPHKVNIIEINYARTAKKMDMKRLKTSMWSLLTDSQEKAAPEVESESSHEVP----GEKS--FRESTKTLLQRLPTTMANNLSVPLAFVALLHLANEKNLELHKVDDMSDIIIKQGH 690          
BLAST of Condensin complex subunit 2 vs. Ensembl Sea Lamprey
Match: ncaph (non-SMC condensin I complex, subunit H [Source:ZFIN;Acc:ZDB-GENE-070112-652])

HSP 1 Score: 65.0846 bits (157), Expect = 1.195e-12
Identity = 46/119 (38.66%), Postives = 65/119 (54.62%), Query Frame = 1
Query:   85 DPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSIL-QASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQ 438
            D + A    V +I +DYAKTAK++DVK +K  +W++L     D   + T    +  +  +S K  LFS++   L A L    SK+LSV +   CLL LANE  L I+  +D  DL I Q
Sbjct:  598 DNLVAEPHKVNKIQLDYAKTAKKMDVKRLKQNIWNMLTMQEGDMGSLPTNNTNENEDAKVS-KEILFSEMYKKLPARLPISMSKNLSVPMAFVCLLHLANEKNLVISGQEDLLDLKINQ 715          
BLAST of Condensin complex subunit 2 vs. Ensembl Yeast
Match: BRN1 (Subunit of the condensin complex; required for chromosome condensation and for clustering of tRNA genes at the nucleolus; may influence multiple aspects of chromosome transmission [Source:SGD;Acc:S000000193])

HSP 1 Score: 49.6766 bits (117), Expect = 1.169e-7
Identity = 32/112 (28.57%), Postives = 57/112 (50.89%), Query Frame = 1
Query:  112 VEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKT--IQAKKYPNLHL---SSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLI 432
            + +  + Y++ +K++DV+ +K  +W  +   I   + +    Q+      H    S+K   FS +I  +      +  KD+S +    CLL LANE GL IT T++ NDL++
Sbjct:  631 IRENKVTYSRVSKKVDVRRLKKNVWRSINNLIQEHDSRKNREQSSNDSETHTEDESTKELKFSDIIQGISKMYSDDTLKDISTSFCFICLLHLANEHGLQITHTENYNDLIV 742          
BLAST of Condensin complex subunit 2 vs. Ensembl Medaka
Match: ncaph (non-SMC condensin I complex subunit H [Source:NCBI gene;Acc:101162454])

HSP 1 Score: 65.0846 bits (157), Expect = 5.691e-12
Identity = 41/120 (34.17%), Postives = 65/120 (54.17%), Query Frame = 1
Query:   82 EDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 441
            ED +      V +I+I+YAKTAK++D+K +K  MW++L  S +    +T++ +         K   FSQ    L+  L    +++LSV +    LL LANE  L +   DD +D++I QG
Sbjct:  577 EDELVPEPHRVNKIEINYAKTAKKMDMKKLKNSMWTLLTDSPEEKVKETVETQDV----CGEKA--FSQTTKMLLQRLPNVMAQNLSVPLAFVALLHLANEKNLELVKVDDMSDIIIRQG 690          
BLAST of Condensin complex subunit 2 vs. Planmine SMEST
Match: SMESG000037465.1 (SMESG000037465.1)

HSP 1 Score: 329.331 bits (843), Expect = 5.720e-109
Identity = 162/167 (97.01%), Postives = 165/167 (98.80%), Query Frame = 1
Query:   61 DNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSLYNISRKRQSLDCSGEGRARCKK 561
            DNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSL+NISRKRQSLDCSG+ R +CKK
Sbjct:  546 DNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSLHNISRKRQSLDCSGD-RVQCKK 711          
BLAST of Condensin complex subunit 2 vs. Planmine SMEST
Match: SMESG000037465.1 (SMESG000037465.1)

HSP 1 Score: 328.946 bits (842), Expect = 7.071e-109
Identity = 162/167 (97.01%), Postives = 165/167 (98.80%), Query Frame = 1
Query:   61 DNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSLYNISRKRQSLDCSGEGRARCKK 561
            DNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSL+NISRKRQSLDCSG+ R +CKK
Sbjct:  545 DNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSLHNISRKRQSLDCSGD-RVQCKK 710          
BLAST of Condensin complex subunit 2 vs. Planmine SMEST
Match: SMESG000037461.1 (SMESG000037461.1)

HSP 1 Score: 300.442 bits (768), Expect = 1.375e-97
Identity = 151/167 (90.42%), Postives = 151/167 (90.42%), Query Frame = 1
Query:   61 DNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSLYNISRKRQSLDCSGEGRARCKK 561
            DNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLF                DCSGEGRARCKK
Sbjct:  597 DNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLF----------------DCSGEGRARCKK 747          
The following BLAST results are available for this feature:
BLAST of Condensin complex subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
NCAPH1.406e-1337.10non-SMC condensin I complex subunit H [Source:HGNC... [more]
NCAPH3.747e-1337.10non-SMC condensin I complex subunit H [Source:HGNC... [more]
NCAPH4.771e-1337.10non-SMC condensin I complex subunit H [Source:HGNC... [more]
NCAPH1.483e-1237.19non-SMC condensin I complex subunit H [Source:HGNC... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ncaph8.123e-1034.55non-SMC condensin I complex, subunit H [Source:ZFI... [more]
ncaph8.276e-1034.55non-SMC condensin I complex, subunit H [Source:ZFI... [more]
ncaph8.276e-1034.55non-SMC condensin I complex, subunit H [Source:ZFI... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ncaph5.125e-1336.21non-SMC condensin I complex subunit H [Source:NCBI... [more]
ncaph7.457e-1235.29non-SMC condensin I complex subunit H [Source:NCBI... [more]
ncaph8.587e-1235.29non-SMC condensin I complex subunit H [Source:NCBI... [more]
ncaph6.337e-1035.71non-SMC condensin I complex subunit H [Source:NCBI... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ncaph5.071e-1134.15non-SMC condensin I complex, subunit H [Source:MGI... [more]
back to top
BLAST of Condensin complex subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q15003|CND2_HUMAN1.800e-1237.10Condensin complex subunit 2 OS=Homo sapiens OX=960... [more]
sp|O13067|CND2_XENLA9.673e-1236.04Condensin complex subunit 2 OS=Xenopus laevis OX=8... [more]
sp|Q8C156|CND2_MOUSE3.547e-1034.15Condensin complex subunit 2 OS=Mus musculus OX=100... [more]
sp|P38170|CND2_YEAST8.118e-628.57Condensin complex subunit 2 OS=Saccharomyces cerev... [more]
back to top
BLAST of Condensin complex subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8XMF41.485e-1337.98Condensin complex subunit 2 OS=Esox lucius OX=8010... [more]
A0A4W5P1891.190e-1138.21Condensin complex subunit 2 OS=Hucho hucho OX=6206... [more]
A0A1S3NNX31.550e-1135.83Condensin complex subunit 2 OS=Salmo salar OX=8030... [more]
A0A504YC511.727e-1127.13Condensin complex subunit 2 OS=Fasciola gigantica ... [more]
A0A060W2Q52.609e-1137.70Condensin complex subunit 2 OS=Oncorhynchus mykiss... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ncaph4.392e-1133.33non-SMC condensin I complex subunit H [Source:NCBI... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ncaph1.195e-1238.66non-SMC condensin I complex, subunit H [Source:ZFI... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BRN11.169e-728.57Subunit of the condensin complex; required for chr... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ncaph5.691e-1234.17non-SMC condensin I complex subunit H [Source:NCBI... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000037465.15.720e-10997.01SMESG000037465.1[more]
SMESG000037465.17.071e-10997.01SMESG000037465.1[more]
SMESG000037461.11.375e-9790.42SMESG000037461.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025395 ID=SMED30025395|Name=Condensin complex subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=680bp
GCCTCATTTCATGTAGGGAATTTTATTAGGGTCTATTGGAGATCACAATT
CGTTACTTAGGATAATTTCGAGGGCGATTTTGAAGACCCAGTCACTGCAA
ATGTCAAGCATGTCGAACAAATAGATATTGATTATGCCAAAACTGCCAAG
CGAATCGACGTGAAGAATATCAAGGCTAAAATGTGGTCCATTTTACAAGC
GTCAATTGACGCAATCGAAATTAAGACTATCCAGGCGAAAAAATACCCGA
ATCTCCATTTATCCTCGAAAACCTGTTTATTTTCTCAGTTAATCATTGCT
CTAATTGCGGAACTGAAACCGGAACAATCTAAAGATCTGAGTGTAGCTAT
ATTGACTACATGTCTTTTGCTGTTGGCAAATGAAACGGGGCTGAATATTA
CAATGACTGATGATAACAATGATCTCCTTATCGGGCAAGGATATTCAGAA
TATGACATTGAGCAGATCAAATTATTTGGTATTGGAAATTCATTATATAA
TATCTCACGTAAACGCCAATCACTAGATTGTTCAGGGGAAGGCAGAGCTC
GGTGTAAAAAGGTCGATGTTTCTTCCGAAGAAGAAAATGAGGATGAATTT
TAAAATTTGTTTGCTTTCTTGTTTGTTTAAATTGTAAAAATAGTAACTTC
CAAATTGTGAGGCAGATTATAAATGTTTAA
back to top

protein sequence of SMED30025395-orf-1

>SMED30025395-orf-1 ID=SMED30025395-orf-1|Name=SMED30025395-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=141bp
MWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQS
KDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFG
IGNSLYNISRKRQSLDCSGEGRARCKKVDVSSEEENEDEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000070mitotic sister chromatid segregation
GO:0007076mitotic chromosome condensation
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0030261chromosome condensation
GO:0051301cell division
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR022816Condensin_barren_su2
Vocabulary: cellular component
TermDefinition
GO:0000796condensin complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022816Condensin complex subunit 2/barrenPFAMPF05786Cnd2coord: 1..85
e-value: 2.0E-8
score: 33.4