Myosin heavy chain

Overview
NameMyosin heavy chain
Smed IDSMED30025388
Uniprot Best hitMyosin heavy chain, striated muscle OS=Argopecten irradians PE=1 SV=1 (E=0)
Length (bp)6089
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Myosin heavy chain (SMED30025388) t-SNE clustered cells

Violin plots show distribution of expression levels for Myosin heavy chain (SMED30025388) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myosin heavy chain (SMED30025388) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myosin heavy chain (SMED30025388) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH7 (myosin, heavy chain 7, cardiac muscle, beta [Source:HGNC Symbol;Acc:HGNC:7577])

HSP 1 Score: 1792.7 bits (4642), Expect = 0.000e+0
Identity = 1054/1915 (55.04%), Postives = 1414/1915 (73.84%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF---APAEDP--NNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            YL    K  ++     FD KK+ ++PD+K+ F+ A I    G   T +T+  +T TVK+D++ Q NPPKF  IEDMA LTFL++ +VL NL+ RY   +IYTYSGLFCVT+NPYK  P+YTP+V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA   + + D   G   KGTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      + LLI+ +P  Y+FI+QGE T+  +DD EE+  TD AFD+LGF++EEK S++K T +I++ G MKFK + REEQAE DGT EA+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQN  QV+Y+ GALAK++Y RMF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+DMTFKAKL+DNHLGKS NF +      G+ EAHF L HYAG V YN+ GWL+KNKDPLNETV+ L   S   L+S+LF   A A+ P     GK KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K PGV+D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++   K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG L R +YKKL ++R +L +IQ NIR ++ ++ WPW KLY K+KPLL  A +E+EM    EE T+LKE  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+LADAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELK+D+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K++L+E+LK+K+ EL   +++IEDE  L +QLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + K EE  R +ND  +   K Q  N EL  +L+E E+ I+QL + K     QLE+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ E EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+G  G+++HE++K RK+LE EK ELQ ALEEAE +LE EE K  R+QLE +QI+ EI+R+LAEK+EE E  + NH R ++S++ SL+AE+R R EA ++KKK+E D+ E+E+ +  ANR+ +E +K  K  Q  +++    ++D     D ++E   + ER+  ++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K++ADL+ +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   15 YLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIYTYSGLFCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPG---KGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFGNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVIYATGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLFDNHLGKSANF-QKPRNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDPLNETVVGLYQKSSLKLLSTLFANYAGADAPIEKGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLARMEYKKLLERRDSLLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKMELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1925          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH6 (myosin, heavy chain 6, cardiac muscle, alpha [Source:HGNC Symbol;Acc:HGNC:7576])

HSP 1 Score: 1791.16 bits (4638), Expect = 0.000e+0
Identity = 1048/1918 (54.64%), Postives = 1412/1918 (73.62%), Query Frame = 3
Query:  108 QYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG-------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            QYL    K  ++     FD +  C++PD+KE F+ A I    G     +T+  +T TVK+D++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA   + + D     K  GTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ERNYHIFYQILSN      + LL++ +P  Y+F++QGE+++  +DD EE+  TD AFD+LGF++EEK  ++K T +I++ G MKFKQ+ REEQAE DGT +A+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV YS+GALAK++Y +MF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+DMTFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+ GWLEKNKDPLNETV+ L   S   L+++LF+      +TG        +KKG + QT+S+ HRE+LNKLM NL++T PHF+RCI+PNE K PGV+D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++ T K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG LMR ++KK+ ++R AL +IQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  ++KE  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+L DAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L  EE+KV +L+K+K KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K +LEE+LK+KE ++   +SKIEDE  L  QLQ+K+KE QARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + KLEEA R +ND      K Q  N EL  +LEE E+ I+QL + K     Q+E+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+GEGG++VHE++K RK+LE+EK ELQ ALEEAE +LE EE K  R+QLE +QI+ EI+R+LAEK+EE E  + NHQR ++S++ SL+AE+R R E  ++KKK+E D+ E+E+ +  ANR+ +E +K  K  Q  +++    ++D     D ++E   + ER+  ++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K+E+DL  +QS++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   14 QYLRKSEKERLEAQTRPFDIRTECFVPDDKEEFVKAKILSREGGKVIAETENGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRGKKDNANANK--GTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLDMLLVTNNPYDYAFVSQGEVSVASIDDSEELMATDSAFDVLGFTSEEKAGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYYSIGALAKAVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNF-QKPRNIKGKQEAHFSLIHYAGTVDYNILGWLEKNKDPLNETVVALYQKSSLKLMATLFSSYATA-DTGDSGKSKGGKKKGSSFQTVSALHRENLNKLMTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPVAIPEGQFIDSRKGTEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRMQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMATMKEEFGRIKETLEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKVRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHQRVVDSLQTSLDAETRSRNEVLRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQSEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELEGELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1927          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH6 (myosin, heavy chain 6, cardiac muscle, alpha [Source:HGNC Symbol;Acc:HGNC:7576])

HSP 1 Score: 1791.16 bits (4638), Expect = 0.000e+0
Identity = 1048/1918 (54.64%), Postives = 1412/1918 (73.62%), Query Frame = 3
Query:  108 QYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG-------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            QYL    K  ++     FD +  C++PD+KE F+ A I    G     +T+  +T TVK+D++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA   + + D     K  GTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ERNYHIFYQILSN      + LL++ +P  Y+F++QGE+++  +DD EE+  TD AFD+LGF++EEK  ++K T +I++ G MKFKQ+ REEQAE DGT +A+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV YS+GALAK++Y +MF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+DMTFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+ GWLEKNKDPLNETV+ L   S   L+++LF+      +TG        +KKG + QT+S+ HRE+LNKLM NL++T PHF+RCI+PNE K PGV+D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++ T K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG LMR ++KK+ ++R AL +IQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  ++KE  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+L DAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L  EE+KV +L+K+K KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K +LEE+LK+KE ++   +SKIEDE  L  QLQ+K+KE QARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + KLEEA R +ND      K Q  N EL  +LEE E+ I+QL + K     Q+E+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+GEGG++VHE++K RK+LE+EK ELQ ALEEAE +LE EE K  R+QLE +QI+ EI+R+LAEK+EE E  + NHQR ++S++ SL+AE+R R E  ++KKK+E D+ E+E+ +  ANR+ +E +K  K  Q  +++    ++D     D ++E   + ER+  ++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K+E+DL  +QS++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   14 QYLRKSEKERLEAQTRPFDIRTECFVPDDKEEFVKAKILSREGGKVIAETENGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRGKKDNANANK--GTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLDMLLVTNNPYDYAFVSQGEVSVASIDDSEELMATDSAFDVLGFTSEEKAGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYYSIGALAKAVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNF-QKPRNIKGKQEAHFSLIHYAGTVDYNILGWLEKNKDPLNETVVALYQKSSLKLMATLFSSYATA-DTGDSGKSKGGKKKGSSFQTVSALHRENLNKLMTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPVAIPEGQFIDSRKGTEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRMQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMATMKEEFGRIKETLEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKVRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHQRVVDSLQTSLDAETRSRNEVLRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQSEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELEGELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1927          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH8 (myosin, heavy chain 8, skeletal muscle, perinatal [Source:HGNC Symbol;Acc:HGNC:7578])

HSP 1 Score: 1766.9 bits (4575), Expect = 0.000e+0
Identity = 1020/1915 (53.26%), Postives = 1406/1915 (73.42%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF-----APAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            YL    K  ++     FD+K + ++ + KE+++ +TI+   G   TVKT+   T TV++D++  MNPPK+  IEDMA +T L++  VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y P+V++ Y+GK+R E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +A   +K++D++G   K +GTLEDQI+ ANP+LEA+GNAKTVRN+NSSRFGKFIRIHFGT+GK+A ADIE YLLEKSRV  Q K ER+YHIFYQI SN      E LLI+ +P  Y+F++QGE+T+  +DD+EE+  TD A DILGF+ EEK+S++K T ++++ G MKFKQ+ REEQAE DGT  A+K A+L  +N+ DL++++  P+VKVGNEYVTKGQ   QV  +VGALAK++Y +MF W+V R+N+ LDTK  RQ+FIGVLDIAGFEIF+FN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDL ACIELIEKP+GI SILEEECMFPKA+D +FK KLYD HLGKS NF +      G+AEAHF L HYAG+V YN+TGWL+KNKDPLN+TV+ L   S    ++SLF     A A+     G +KKG + QT+S+  RE+LNKLM NL+ST PHF+RCI+PNE K PG ++  LVLHQL CNGVLEGIRICRKGFP+R++Y +FKQRY +L  +AIP+G F++ K+ + K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRDEKL+ +I+  QA  RG+LMR +Y+K+  +R AL  IQ N+R ++ ++ WPW KL+ K+KPLL  A  E+EM    EE  K K+E  K +  +KELEE+ V LL+ KNDL LQ+Q+E DSLADAEE+  +L+  K  +E +IKE+ +   EEE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK  QE+  D+E  K++L+E+L++KE E+ N  SKIEDE  +  QLQ+KIKELQARI+EL E++EAER +RAKAEK R  L  ELEE+S+RLEE GGATSAQ++LNKKREAE  KL+RDLEE+ +QH+ ++A  RKK  D + E  EQ+D LQ+VK K+EKEK+E+K + +DL    E+++KAK N +K  + +E Q SEL+ K EE  R IND      + Q    E   +L+E ++ ++QL + KQ    Q+EE +   EEE++AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ E EE  E   +K   LEK K RLQ E+ED+++DV+R+N   + L+KKQ+ FDKV+SEW+QKY E+QAELEASQ+ESR++S E+F++K   EES +QLE+++RENKNL  EI DLTEQI EGG+ +HE++K +K++E EK E+Q ALEEAE +LE EE K  R QLE++Q++ E+DR++AEK+EE +  + NH R +E+M+++L+AE R R +A ++KKK+E D+ E+E+ ++ ANR+ +E  +N +  Q  ++E    ++D    ++ ++EQ  + ER+  ++ AE+EE+  +LE +ER+RK  E E ++ ++R+  L  Q++  + TK+KLE D++ +QS++EE   E+R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK LE   K+LQ +LDE+E  ALKGGKK + KLE RVRELE E++ EQKR+ E+ K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K+YKRQ EEAEE +  NL+K+RK+Q E+E++EERAD AE  + KLR K+R
Sbjct:   18 YLRKSEKERIEAQNKPFDAKTSVFVAEPKESYVKSTIQSKEGGKVTVKTEGGATLTVREDQVFPMNPPKYDKIEDMAMMTHLHEPGVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYKPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKDESG---KMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQITSNKKPDLIEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIDILGFTPEEKVSIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTVQQVYNAVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPLGIFSILEEECMFPKATDTSFKNKLYDQHLGKSANF-QKPKVVKGKAEAHFSLIHYAGTVDYNITGWLDKNKDPLNDTVVGLYQKSAMKTLASLFSTYASAEADSSAKKGAKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVFFKAGLLGLLEEMRDEKLAQIITRTQAVCRGFLMRVEYQKMLQRREALFCIQYNVRAFMNVKHWPWMKLFFKIKPLLKSAETEKEMATMKEEFQKTKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQSEADSLADAEERCEQLIKNKIQLEAKIKEVTERAEEEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLSKEKKALQETHQQTLDDLQAEEDKVNILTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDMENDKQQLDEKLEKKEFEISNLISKIEDEQAVEIQLQKKIKELQARIEELGEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQVELNKKREAEFQKLRRDLEEATLQHEAMVAALRKKHADSMAELGEQIDNLQRVKQKLEKEKSELKMETDDLSSNAEAISKAKGNLEKMCRSLEDQVSELKTKEEEQQRLINDLTAQRARLQTEAGEYSRQLDEKDALVSQLSRSKQASTQQIEELKHQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERSNAACAALDKKQRNFDKVLSEWKQKYEETQAELEASQKESRSLSTELFKVKNVYEESLDQLETLRRENKNLQQEISDLTEQIAEGGKQIHELEKIKKQVEQEKCEIQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHTRVVETMQSTLDAEIRSRNDALRVKKKMEGDLNEMEIQLNHANRLAAESLRNYRNTQGILKETQLHLDDALRGQEDLKEQLAIVERRANLLQAEIEELWATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLENDVSQLQSEVEEVIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELEGEVENEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNVLRLQDLVDKLQAKVKSYKRQAEEAEEQSNANLSKFRKLQHELEEAEERADIAESQVNKLRVKSR 1928          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH2 (myosin, heavy chain 2, skeletal muscle, adult [Source:HGNC Symbol;Acc:HGNC:7572])

HSP 1 Score: 1745.71 bits (4520), Expect = 0.000e+0
Identity = 1014/1902 (53.31%), Postives = 1399/1902 (73.55%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAED--------PNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            FD+K + ++ + KE+F+  TI+   G   TVKT+   T TVK D++  MNPPK+  IEDMA +T L++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y P+V++ Y+GK+R E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +A   +K++++  +G K +GTLEDQI+ ANP+LEA+GNAKTVRN+NSSRFGKFIRIHFGT+GK+A ADIE YLLEKSRV  Q K ER+YHIFYQI SN      E LLI+ +P  Y F++QGE+++  +DD+EE+  TD A DILGF+ EEK+S++K T ++++ G +KFKQ+ REEQAE DGT  A+K A+L  +N+ DL++++  P+VKVGNEYVTKGQ  +QV  +VGALAK++Y +MF W+V R+N+ LDTK  RQ+FIGVLDIAGFEIF+FN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDL ACIELIEKPMGI SILEEECMFPKA+D +FK KLYD HLGKS NF +      G+AEAHF L HYAG V YN+TGWLEKNKDPLNETV+ L   S    ++ LF+ A+             G +KKG + QT+S+  RE+LNKLM NL+ST PHF+RCI+PNE K PG ++  LVLHQL CNGVLEGIRICRKGFP+R++Y++FKQRY +L  +AIP+G F++ K+ + K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRD+KL+ LI+  QA+ RG+L R +Y+++ ++R A+  IQ NIR ++ ++ WPW KL+ K+KPLL  A  E+EM    EE  K+K+E  K +  +KELEE+ V LL+ KNDL LQ+Q E + LADAEE+  +L+  K  +E +IKE+ +   +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK  QE++ D+E  K++L+E+LK+KE E+ N  SKIEDE  L  QLQ+KIKELQARI+ELEE++EAER +RAKAEK R  L  ELEE+S+RLEE GGATSAQ+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+EMK +++DL   +E+++KAK N +K  + +E Q SEL+ K EE  R IND     G+ Q  + E   +L+E E+ ++QL + KQ    Q+EE ++  EEE +AK  L+  +++   D D LRE  EEE E+K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+   EE  E   +K   LEK K RLQ E+ED+++DV+R N   + L+KKQ+ FDK+++EW+QK  E+ AELEASQ+E+R++  E+F++K   EES +QLE++KRENKNL  EI DLTEQI EGG+ +HE++K +K++E EK ELQ ALEEAE +LE EE K  R QLE++Q++ E+DR++AEK+EE +  + NH R +ESM+++L+AE R R +A ++KKK+E D+ E+E+ ++ ANR+ +E  +N +  Q  +++    ++D    ++ ++EQ  M ER+  ++ AE+EE+R +LE +ER+RK  E E ++ ++R+  L  Q++  + TK+KLE D++ MQ ++E+   EAR A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK + KLE RVRELE E++ EQKR+ E+ K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K+YKRQ EEAEE +  NLAK+RK+Q E+E++EERAD AE  + KLR K+R
Sbjct:   32 FDAKTSVFVAEPKESFVKGTIQSREGGKVTVKTEGGATLTVKDDQVFPMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYKPEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKEEITSG-KIQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVVFQLKAERSYHIFYQITSNKKPELIEMLLITTNPYDYPFVSQGEISVASIDDQEELMATDSAIDILGFTNEEKVSIYKLTGAVMHYGNLKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTVEQVSNAVGALAKAVYEKMFLWMVARINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYDQHLGKSANF-QKPKVVKGKAEAHFALIHYAGVVDYNITGWLEKNKDPLNETVVGLYQKSAMKTLAQLFSGAQTAEGEGAGGGAKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVFFKAGLLGLLEEMRDDKLAQLITRTQARCRGFLARVEYQRMVERREAIFCIQYNIRSFMNVKHWPWMKLFFKIKPLLKSAETEKEMATMKEEFQKIKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQAEAEGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKIKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEISNLQSKIEDEQALGIQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNVETVSKAKGNLEKMCRTLEDQLSELKSKEEEQQRLINDLTAQRGRLQTESGEFSRQLDEKEALVSQLSRGKQAFTQQIEELKRQLEEEIKAKNALAHALQSSRHDCDLLREQYEEEQESKAELQRALSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQAAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERTNAACAALDKKQRNFDKILAEWKQKCEETHAELEASQKEARSLGTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKCELQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHIRIVESMQSTLDAEIRSRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQIHLDDALRSQEDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQMQGEMEDILQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQLRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNTNLAKFRKLQHELEEAEERADIAESQVNKLRVKSR 1931          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: myo-5 (MYOsin heavy chain structural genes [Source:RefSeq peptide;Acc:NP_505094])

HSP 1 Score: 1769.21 bits (4581), Expect = 0.000e+0
Identity = 1046/1949 (53.67%), Postives = 1412/1949 (72.45%), Query Frame = 3
Query:   93 SDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTK-VKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASK-EALVSSL---FAPAED---------PNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVE---GKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 5888
            +DP +Q+L    + L+      FDSKKN W+ D +E FIAA I+ + GD   V T K   KT+KKD+ +QMNPPK+   EDMANLTFLNDASVL NLRQRYY  +IYTYSGLFCV INPYKR PIY+  V   Y GKRR EMPPH+F++SD AY NM  DR+NQS+LITGESGAGKTENTKKVI+YFA V A+ +  +  +    K + +LEDQIVQ NPVLEA+GNAKTVRNNNSSRFGKFIRIHF T GK+AGADIE YLLEKSRV  Q  GER+YHIFYQI S+  K   EKL ++     Y+F++Q E+TIDGVDD+EEM ITDEAFDI+ F+A EK  LF  T  I++MGE+KFKQRPREEQAE +   E E    L  V ++  + ++LKP+VKVG E+V KGQN DQV ++VGALAK+L+ RMF+WL+ R NKTLD + + R FFIGVLDIAGFEIF+ N FEQ+ IN+ NE+LQQFFNHHMFVLEQEEYK+E I WEFIDFG+DLQACIELIEKP+GI+S+L+EEC+ PKASD+T  +KL D HLGK PNF KP+PPK  QAEAH  + HYAG+V YNV GWLEKNKDPLN+T + +L A+K   L++ L   +A  ED              K+ K  +  T+S  +RESLNKLM  L  T PHFIRCI+PNE K+ G+IDA+LVL+QL CNGVLEGIRICRKGFPNRM + +FKQRY++LA +A   G      G+++++ +++   L    ++ G TKVFFKAG LA LE++RDE L  +++ FQ   R YL + +YK+  DQ+V L ++QRNIR +  LR+W W+KL+ +VKPL+  +++ EE +   ++   L+EE  + ++ +K++E +N +L   K  L +QL+ E+DS A+ EE+ +KL+ QKAD+E ++  + D L +EE+  A L   KKK++ + E LKK V DLE++++K E EK AKD QI+SLQD++  Q+E ++KL KEKK  +EV +K  E + AEE+KV +LNK KAKLE T+DE+E+ L RE++ R D EK +RK+E ELK  QE +++L R K E E+ +K+K++EL +  S++EDE  LVA+LQR+IKEL ARIQELEE+L+AER +R+KAEK+R++++ ELEEL DRL+E GGAT AQ++LNKKREAEL KL++DLE++ +  +  +A  RKK  D V E S+QLD +QK++ K+E+EKN+ + ++++LQ   +   K + N ++  K++EAQ +++  K +E  R I +      K    N +L  +LE+AE+Q+  L ++KQQ  +QLEE ++  ++E+R +  L S V N   + +  RE+LEEE + K+D+QRQL KA  E+QQ +AKFEG G  R+EEL+E +RK   ++ E++E+ E A  K G LEK K RL  ++ED  VD DRAN++AS LEKKQK FDKV+ EW++K     AE+E SQRE+R  + E FR++ Q+EES EQ E+VKRENK LA E+ D+ +Q+GEGG+SVH++ K R+RLE+EKEELQ AL+EAE ALE EEAK  R+Q+E+SQIR EI++RL EKEEEFE TR NH R +ESM+ SLE ESRGRAE  K KKKLE D+ ELE+A+D +N++  + +K+ KK Q  ++EL   VE+E+    + R+   + ER+  ++  E E++    E SER R+  E E  E+ D +NELS  +S  +ATKRK+E DL  +QS++EEA ++A+ ++E+AKKA+ D+++L DE+R EQEHA  +++ KK LE+Q K+LQ +LDE+E   +KGGK+ L+KL+ R+ ELE EL+GE +RH E+QK  R  +R+ +EL  Q DEDKK+QER+ DL+EKLQ KIKTYKRQ+E+AE +A+ NLAKYR++Q  +ED++ERAD AE ALQKLR K RS+        +A  M+T
Sbjct:    5 ADPGWQFLRQSPEQLLAATTKKFDSKKNVWVADPEEGFIAAEIKSSKGDTVVVVTSKGVEKTIKKDDAQQMNPPKYEKTEDMANLTFLNDASVLHNLRQRYYSMMIYTYSGLFCVVINPYKRLPIYSESVCQMYLGKRRNEMPPHLFAVSDEAYRNMTNDRENQSMLITGESGAGKTENTKKVISYFAMVGASQQSNKKKSKK-DKAQVSLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNTGGKVAGADIEHYLLEKSRVIKQAPGERSYHIFYQIYSDAVKGLREKLFLTRPIKEYTFVSQAEVTIDGVDDKEEMLITDEAFDIMKFTATEKSELFAITAGIMHMGELKFKQRPREEQAELEEGKEGELACKLYCVESEKFINALLKPRVKVGTEWVNKGQNLDQVNWAVGALAKALFARMFSWLIRRCNKTLDAQDLSRDFFIGVLDIAGFEIFDLNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYKREGIQWEFIDFGLDLQACIELIEKPLGIVSMLDEECIVPKASDLTLASKLNDQHLGKHPNFQKPRPPKGKQAEAHLAIVHYAGTVRYNVKGWLEKNKDPLNDTAVTVLKANKGNQLMADLWADYATQEDVAAAAKDGKKAVGKKKGKSASFMTVSMMYRESLNKLMHMLHQTHPHFIRCIIPNELKKAGMIDANLVLNQLTCNGVLEGIRICRKGFPNRMPFLDFKQRYAVLAADAAKAGKDPKDAGEKISAALIKDGSLKQEEFQCGLTKVFFKAGVLAHLEELRDEALGKIMAKFQCACRHYLAQCEYKRKLDQKVGLIVLQRNIRAWCTLRSWSWFKLFGRVKPLIKGSKKNEEFEALEKKFKVLEEEKTQEERKRKDMEAENARLEAEKQALLIQLEQERDSSAEGEERSAKLLAQKADLEKQMANMNDQLCDEEEKNAALTKQKKKIEQDNEGLKKTVSDLETTIKKQESEKQAKDHQIRSLQDEIQSQDEVISKLNKEKKHQEEVNRKLLEDIQAEEDKVNHLNKTKAKLESTLDELEDTLEREKRGRQDCEKQRRKVEGELKIAQELIEELNRHKHEQEQVIKKKDIELSSIQSRLEDEQSLVAKLQRQIKELLARIQELEEELDAERNSRSKAEKARNEMQMELEELGDRLDEAGGATQAQIELNKKREAELAKLRQDLEDAAINSETSMAALRKKHNDAVAELSDQLDTIQKMRGKLEREKNDKQREVDELQQSADVEAKQRQNCERMAKQLEAQLTDMTLKSDEQARLIQELTMGKNKVHNENQDLNRQLEDAEAQLCALNRIKQQQHSQLEELKRTLDQETRERQSLHSQVSNYQLECEQFRESLEEEQDAKTDVQRQLSKANSEIQQWRAKFEGEGVSRAEELEETRRKLTHKVQEMQEQLENANQKIGTLEKNKQRLAHDLEDAQVDADRANSIASSLEKKQKGFDKVLDEWRRKCEALVAEVEQSQRETRAAATETFRLRNQLEESGEQTEAVKRENKALAQELKDIADQLGEGGKSVHDLQKMRRRLEIEKEELQQALDEAECALEAEEAKVMRAQIEVSQIRSEIEKRLQEKEEEFENTRKNHSRTIESMQVSLETESRGRAELLKTKKKLEGDVNELEIALDHSNKLNVDGQKSMKKLQDTIRELQYQVEEEQRSLSESRDHANLAERRSQVLQQEKEDLAIIYEQSERTRRQAELELAEVKDSVNELSNSNSLLLATKRKVEGDLQLLQSEIEEAMSDAKTSDEKAKKAIMDASKLADELRSEQEHASNLNQSKKTLESQVKDLQMRLDEAEAAGIKGGKRQLAKLDMRIHELETELEGENRRHAETQKVLRNKDRKCRELQFQVDEDKKSQERMYDLIEKLQQKIKTYKRQIEDAESLASGNLAKYRQLQHVVEDAQERADAAENALQKLRLKGRSTSGVFGPRGLAHSMST 1952          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 1733.77 bits (4489), Expect = 0.000e+0
Identity = 1040/1939 (53.64%), Postives = 1411/1939 (72.77%), Query Frame = 3
Query:   96 DPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPAL-YSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTK-VKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASK-EALVSSLF-----------APAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGK---QVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARG 5861
            DP +QYL   R+ +++     +DSKKN WIPD +E ++A  I    GD  T+ T +    T+KK+ +++MNPPKF   EDM+NL+FLNDASVL NLR RY   LIYTYSGLFCV INPYKR PIYT      + GKR+TEMPPH+F++SD AY NML D +NQS+LITGESGAGKTENTKKVI YFA V A +++E        K+K TLEDQIVQ NPVLEA+GNAKTVRNNNSSRFGKFIRIHF   G++A  DIE YLLEKSRV  Q  GER YHIFYQI S+  +P  +K L+   P   Y F+ Q EL IDG+DD EE ++TDEAFDIL FSA EK   ++   + ++MG MKFKQRPREEQAE DGT EAEK + + G+  ++ ++++ KP+VKVG E+V+KGQN +QV ++VGA+AK LY+R+F WLV + N TLD K + R +FIGVLDIAGFEIF+FN FEQ+ IN+ NE+LQQFFNHHMFVLEQEEY +E I W FIDFG+DLQACIELIEKP+GI+S+L+EEC+ PKA+D+T  +KL D HLGK PNF KPKPPK  Q EAHF + HYAG+V YN   WLEKNKDPLN+TV++ +  SK   L+  ++              E      K+ K G+  T+S  +RESLN LM  L  T PHFIRCI+PNE KQ G+IDA LVL+QL CNGVLEGIRICRKGFPNR ++ +F QRY+ILA         + K    + SK++    L   ++R+G TKVFFKAG LA LED+RDEKL+++++ FQ+QIR +L  +  K+  +QR  L I+QRN+R +  LRTW W+KLY KVKP+L   ++ EE++K  +++  L++   K +K +KELEE + KL+E K  LF  L++ +  L+DAEE+++KL  Q+ D   ++ EL D L + ED  A ++  KKK++ E+E LKK + DLE SL+KAE EK +KD QI+SLQD+M +Q+E + KL KEKK  +E+ +K  E L +EE+K  + NK KAKLEQT+D++E++L RE++ RAD++K KRK+E ELK  QE +D+  R + +LE  LK+KE EL + SS++EDE  LV++LQR+IK+ Q+RI ELEE+LE ERQ+R+KA++++  L+ ELEEL ++L+EQGGAT+AQ+++NKKREAEL KL+RDLEE+NM H+  +   RKK  D V E ++QLDQL K KAKVEK+K +   D  DL  QL+     K N++K  K+ E Q +ELQ K +E +R + D  +  G+    N +L  +LE+AESQ+NQL ++K Q+ +QLEEAR+ A+EE+R +  +++  +N   + + L+E+LEEE E K++I RQL KA  ++QQ KA+FEG G ++++EL++AKR+   +I+EL+E  + A SK   LEK K+RL G+++D  VDV+RAN +AS LEKKQK FDK++ EW++K  +  AEL+ +QR+ R  S ++F+ K   EE  E +E ++RENK+L+ EI DLT+Q+GEGGRSVHE+ K  +RLE+EKEELQHAL+EAE ALE EE+K  R+Q+E+SQIR EI++R+ EKEEEFE TR NH RA+ESM+ASLE E++G+AE  ++KKKLE DI ELE+A+D AN+  ++ +KN K++Q+QV+EL   VE+E+      REQ    E++ T++ +E EE+  + E +ER RK  E E  +  D+ NE + Q S   + KRKLE ++ A+ +DL+E   E + A E++KKA+AD+ RL +E+RQEQEH+Q +D+++K LE Q KE+Q +LDE+E  ALKGGKK ++KLEQRVRELE+ELDGEQ+R  ++ KN  + +RR++EL  Q DEDKKN ERLQDL++KLQ K+KT K+QVEEAEE+A +NL KY+++  ++ED+EERADQAE +L K+R+K+R+S S A G
Sbjct:    6 DPGWQYLRRTREQVLEDQSKPYDSKKNVWIPDPEEGYLAGEITATKGDQVTIVTARGNEVTLKKELVQEMNPPKFEKTEDMSNLSFLNDASVLHNLRSRYAAMLIYTYSGLFCVVINPYKRLPIYTDSCARMFMGKRKTEMPPHLFAVSDEAYRNMLQDHENQSMLITGESGAGKTENTKKVICYFAAVGA-SQQEGGAEVDPNKKKVTLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNKHGRLASCDIEHYLLEKSRVIRQAPGERCYHIFYQIYSD-FRPELKKELLLDLPIKDYWFVAQAELIIDGIDDVEEFQLTDEAFDILNFSAVEKQDCYRLMSAHMHMGNMKFKQRPREEQAEPDGTDEAEKASNMYGIGCEEFLKALTKPRVKVGTEWVSKGQNCEQVNWAVGAMAKGLYSRVFNWLVKKCNLTLDQKGIDRDYFIGVLDIAGFEIFDFNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYAREGIQWVFIDFGLDLQACIELIEKPLGIISMLDEECIVPKATDLTLASKLVDQHLGKHPNFEKPKPPKGKQGEAHFAMRHYAGTVRYNCLNWLEKNKDPLNDTVVSAMKQSKGNDLLVEIWQDYTTQEEAAAKAKEGGGGGKKKGKSGSFMTVSMLYRESLNNLMTMLNKTHPHFIRCIIPNEKKQSGMIDAALVLNQLTCNGVLEGIRICRKGFPNRTLHPDFVQRYAILAAKEAKSDDDKKKCAEAIMSKLVNDGSLSEEMFRIGLTKVFFKAGVLAHLEDIRDEKLATILTGFQSQIRWHLGLKDRKRRMEQRAGLLIVQRNVRSWCTLRTWEWFKLYGKVKPMLKAGKEAEELEKINDKVKALEDSLAKEEKLRKELEESSAKLVEEKTSLFTNLESTKTQLSDAEERLAKLEAQQKDASKQLSELNDQLADNEDRTADVQRAKKKIEAEVEALKKQIQDLEMSLRKAESEKQSKDHQIRSLQDEMQQQDEAIAKLNKEKKHQEEINRKLMEDLQSEEDKGNHQNKVKAKLEQTLDDLEDSLEREKRARADLDKQKRKVEGELKIAQENIDESGRQRHDLENNLKKKESELHSVSSRLEDEQALVSKLQRQIKDGQSRISELEEELENERQSRSKADRAKSDLQRELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAVAELTDQLDQLNKAKAKVEKDKAQAVRDAEDLAAQLDQETSGKLNNEKLAKQFELQLTELQSKADEQSRQLQDFTSLKGRLHSENGDLVRQLEDAESQVNQLTRLKSQLTSQLEEARRTADEEARERQTVAAQAKNYQHEAEQLQESLEEEIEGKNEILRQLSKANADIQQWKARFEGEGLLKADELEDAKRRQAQKINELQEALDAANSKNASLEKTKSRLVGDLDDAQVDVERANGVASALEKKQKGFDKIIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGLRRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHARALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNGADTREQFFNAEKRATLLQSEKEELLVANEAAERARKQAEYEAADARDQANEANAQVSSLTSAKRKLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQHVDRLRKGLEQQLKEIQVRLDEAEAAALKGGKKVIAKLEQRVRELESELDGEQRRFQDANKNLGRADRRVRELQFQVDEDKKNFERLQDLIDKLQQKLKTQKKQVEEAEELANLNLQKYKQLTHQLEDAEERADQAENSLSKMRSKSRASASVAPG 1942          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 1733.77 bits (4489), Expect = 0.000e+0
Identity = 1040/1939 (53.64%), Postives = 1411/1939 (72.77%), Query Frame = 3
Query:   96 DPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPAL-YSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTK-VKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASK-EALVSSLF-----------APAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGK---QVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARG 5861
            DP +QYL   R+ +++     +DSKKN WIPD +E ++A  I    GD  T+ T +    T+KK+ +++MNPPKF   EDM+NL+FLNDASVL NLR RY   LIYTYSGLFCV INPYKR PIYT      + GKR+TEMPPH+F++SD AY NML D +NQS+LITGESGAGKTENTKKVI YFA V A +++E        K+K TLEDQIVQ NPVLEA+GNAKTVRNNNSSRFGKFIRIHF   G++A  DIE YLLEKSRV  Q  GER YHIFYQI S+  +P  +K L+   P   Y F+ Q EL IDG+DD EE ++TDEAFDIL FSA EK   ++   + ++MG MKFKQRPREEQAE DGT EAEK + + G+  ++ ++++ KP+VKVG E+V+KGQN +QV ++VGA+AK LY+R+F WLV + N TLD K + R +FIGVLDIAGFEIF+FN FEQ+ IN+ NE+LQQFFNHHMFVLEQEEY +E I W FIDFG+DLQACIELIEKP+GI+S+L+EEC+ PKA+D+T  +KL D HLGK PNF KPKPPK  Q EAHF + HYAG+V YN   WLEKNKDPLN+TV++ +  SK   L+  ++              E      K+ K G+  T+S  +RESLN LM  L  T PHFIRCI+PNE KQ G+IDA LVL+QL CNGVLEGIRICRKGFPNR ++ +F QRY+ILA         + K    + SK++    L   ++R+G TKVFFKAG LA LED+RDEKL+++++ FQ+QIR +L  +  K+  +QR  L I+QRN+R +  LRTW W+KLY KVKP+L   ++ EE++K  +++  L++   K +K +KELEE + KL+E K  LF  L++ +  L+DAEE+++KL  Q+ D   ++ EL D L + ED  A ++  KKK++ E+E LKK + DLE SL+KAE EK +KD QI+SLQD+M +Q+E + KL KEKK  +E+ +K  E L +EE+K  + NK KAKLEQT+D++E++L RE++ RAD++K KRK+E ELK  QE +D+  R + +LE  LK+KE EL + SS++EDE  LV++LQR+IK+ Q+RI ELEE+LE ERQ+R+KA++++  L+ ELEEL ++L+EQGGAT+AQ+++NKKREAEL KL+RDLEE+NM H+  +   RKK  D V E ++QLDQL K KAKVEK+K +   D  DL  QL+     K N++K  K+ E Q +ELQ K +E +R + D  +  G+    N +L  +LE+AESQ+NQL ++K Q+ +QLEEAR+ A+EE+R +  +++  +N   + + L+E+LEEE E K++I RQL KA  ++QQ KA+FEG G ++++EL++AKR+   +I+EL+E  + A SK   LEK K+RL G+++D  VDV+RAN +AS LEKKQK FDK++ EW++K  +  AEL+ +QR+ R  S ++F+ K   EE  E +E ++RENK+L+ EI DLT+Q+GEGGRSVHE+ K  +RLE+EKEELQHAL+EAE ALE EE+K  R+Q+E+SQIR EI++R+ EKEEEFE TR NH RA+ESM+ASLE E++G+AE  ++KKKLE DI ELE+A+D AN+  ++ +KN K++Q+QV+EL   VE+E+      REQ    E++ T++ +E EE+  + E +ER RK  E E  +  D+ NE + Q S   + KRKLE ++ A+ +DL+E   E + A E++KKA+AD+ RL +E+RQEQEH+Q +D+++K LE Q KE+Q +LDE+E  ALKGGKK ++KLEQRVRELE+ELDGEQ+R  ++ KN  + +RR++EL  Q DEDKKN ERLQDL++KLQ K+KT K+QVEEAEE+A +NL KY+++  ++ED+EERADQAE +L K+R+K+R+S S A G
Sbjct:    6 DPGWQYLRRTREQVLEDQSKPYDSKKNVWIPDPEEGYLAGEITATKGDQVTIVTARGNEVTLKKELVQEMNPPKFEKTEDMSNLSFLNDASVLHNLRSRYAAMLIYTYSGLFCVVINPYKRLPIYTDSCARMFMGKRKTEMPPHLFAVSDEAYRNMLQDHENQSMLITGESGAGKTENTKKVICYFAAVGA-SQQEGGAEVDPNKKKVTLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNKHGRLASCDIEHYLLEKSRVIRQAPGERCYHIFYQIYSD-FRPELKKELLLDLPIKDYWFVAQAELIIDGIDDVEEFQLTDEAFDILNFSAVEKQDCYRLMSAHMHMGNMKFKQRPREEQAEPDGTDEAEKASNMYGIGCEEFLKALTKPRVKVGTEWVSKGQNCEQVNWAVGAMAKGLYSRVFNWLVKKCNLTLDQKGIDRDYFIGVLDIAGFEIFDFNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYAREGIQWVFIDFGLDLQACIELIEKPLGIISMLDEECIVPKATDLTLASKLVDQHLGKHPNFEKPKPPKGKQGEAHFAMRHYAGTVRYNCLNWLEKNKDPLNDTVVSAMKQSKGNDLLVEIWQDYTTQEEAAAKAKEGGGGGKKKGKSGSFMTVSMLYRESLNNLMTMLNKTHPHFIRCIIPNEKKQSGMIDAALVLNQLTCNGVLEGIRICRKGFPNRTLHPDFVQRYAILAAKEAKSDDDKKKCAEAIMSKLVNDGSLSEEMFRIGLTKVFFKAGVLAHLEDIRDEKLATILTGFQSQIRWHLGLKDRKRRMEQRAGLLIVQRNVRSWCTLRTWEWFKLYGKVKPMLKAGKEAEELEKINDKVKALEDSLAKEEKLRKELEESSAKLVEEKTSLFTNLESTKTQLSDAEERLAKLEAQQKDASKQLSELNDQLADNEDRTADVQRAKKKIEAEVEALKKQIQDLEMSLRKAESEKQSKDHQIRSLQDEMQQQDEAIAKLNKEKKHQEEINRKLMEDLQSEEDKGNHQNKVKAKLEQTLDDLEDSLEREKRARADLDKQKRKVEGELKIAQENIDESGRQRHDLENNLKKKESELHSVSSRLEDEQALVSKLQRQIKDGQSRISELEEELENERQSRSKADRAKSDLQRELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAVAELTDQLDQLNKAKAKVEKDKAQAVRDAEDLAAQLDQETSGKLNNEKLAKQFELQLTELQSKADEQSRQLQDFTSLKGRLHSENGDLVRQLEDAESQVNQLTRLKSQLTSQLEEARRTADEEARERQTVAAQAKNYQHEAEQLQESLEEEIEGKNEILRQLSKANADIQQWKARFEGEGLLKADELEDAKRRQAQKINELQEALDAANSKNASLEKTKSRLVGDLDDAQVDVERANGVASALEKKQKGFDKIIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGLRRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHARALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNGADTREQFFNAEKRATLLQSEKEELLVANEAAERARKQAEYEAADARDQANEANAQVSSLTSAKRKLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQHVDRLRKGLEQQLKEIQVRLDEAEAAALKGGKKVIAKLEQRVRELESELDGEQRRFQDANKNLGRADRRVRELQFQVDEDKKNFERLQDLIDKLQQKLKTQKKQVEEAEELANLNLQKYKQLTHQLEDAEERADQAENSLSKMRSKSRASASVAPG 1942          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 1733.77 bits (4489), Expect = 0.000e+0
Identity = 1040/1939 (53.64%), Postives = 1411/1939 (72.77%), Query Frame = 3
Query:   96 DPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPAL-YSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTK-VKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASK-EALVSSLF-----------APAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGK---QVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARG 5861
            DP +QYL   R+ +++     +DSKKN WIPD +E ++A  I    GD  T+ T +    T+KK+ +++MNPPKF   EDM+NL+FLNDASVL NLR RY   LIYTYSGLFCV INPYKR PIYT      + GKR+TEMPPH+F++SD AY NML D +NQS+LITGESGAGKTENTKKVI YFA V A +++E        K+K TLEDQIVQ NPVLEA+GNAKTVRNNNSSRFGKFIRIHF   G++A  DIE YLLEKSRV  Q  GER YHIFYQI S+  +P  +K L+   P   Y F+ Q EL IDG+DD EE ++TDEAFDIL FSA EK   ++   + ++MG MKFKQRPREEQAE DGT EAEK + + G+  ++ ++++ KP+VKVG E+V+KGQN +QV ++VGA+AK LY+R+F WLV + N TLD K + R +FIGVLDIAGFEIF+FN FEQ+ IN+ NE+LQQFFNHHMFVLEQEEY +E I W FIDFG+DLQACIELIEKP+GI+S+L+EEC+ PKA+D+T  +KL D HLGK PNF KPKPPK  Q EAHF + HYAG+V YN   WLEKNKDPLN+TV++ +  SK   L+  ++              E      K+ K G+  T+S  +RESLN LM  L  T PHFIRCI+PNE KQ G+IDA LVL+QL CNGVLEGIRICRKGFPNR ++ +F QRY+ILA         + K    + SK++    L   ++R+G TKVFFKAG LA LED+RDEKL+++++ FQ+QIR +L  +  K+  +QR  L I+QRN+R +  LRTW W+KLY KVKP+L   ++ EE++K  +++  L++   K +K +KELEE + KL+E K  LF  L++ +  L+DAEE+++KL  Q+ D   ++ EL D L + ED  A ++  KKK++ E+E LKK + DLE SL+KAE EK +KD QI+SLQD+M +Q+E + KL KEKK  +E+ +K  E L +EE+K  + NK KAKLEQT+D++E++L RE++ RAD++K KRK+E ELK  QE +D+  R + +LE  LK+KE EL + SS++EDE  LV++LQR+IK+ Q+RI ELEE+LE ERQ+R+KA++++  L+ ELEEL ++L+EQGGAT+AQ+++NKKREAEL KL+RDLEE+NM H+  +   RKK  D V E ++QLDQL K KAKVEK+K +   D  DL  QL+     K N++K  K+ E Q +ELQ K +E +R + D  +  G+    N +L  +LE+AESQ+NQL ++K Q+ +QLEEAR+ A+EE+R +  +++  +N   + + L+E+LEEE E K++I RQL KA  ++QQ KA+FEG G ++++EL++AKR+   +I+EL+E  + A SK   LEK K+RL G+++D  VDV+RAN +AS LEKKQK FDK++ EW++K  +  AEL+ +QR+ R  S ++F+ K   EE  E +E ++RENK+L+ EI DLT+Q+GEGGRSVHE+ K  +RLE+EKEELQHAL+EAE ALE EE+K  R+Q+E+SQIR EI++R+ EKEEEFE TR NH RA+ESM+ASLE E++G+AE  ++KKKLE DI ELE+A+D AN+  ++ +KN K++Q+QV+EL   VE+E+      REQ    E++ T++ +E EE+  + E +ER RK  E E  +  D+ NE + Q S   + KRKLE ++ A+ +DL+E   E + A E++KKA+AD+ RL +E+RQEQEH+Q +D+++K LE Q KE+Q +LDE+E  ALKGGKK ++KLEQRVRELE+ELDGEQ+R  ++ KN  + +RR++EL  Q DEDKKN ERLQDL++KLQ K+KT K+QVEEAEE+A +NL KY+++  ++ED+EERADQAE +L K+R+K+R+S S A G
Sbjct:    6 DPGWQYLRRTREQVLEDQSKPYDSKKNVWIPDPEEGYLAGEITATKGDQVTIVTARGNEVTLKKELVQEMNPPKFEKTEDMSNLSFLNDASVLHNLRSRYAAMLIYTYSGLFCVVINPYKRLPIYTDSCARMFMGKRKTEMPPHLFAVSDEAYRNMLQDHENQSMLITGESGAGKTENTKKVICYFAAVGA-SQQEGGAEVDPNKKKVTLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNKHGRLASCDIEHYLLEKSRVIRQAPGERCYHIFYQIYSD-FRPELKKELLLDLPIKDYWFVAQAELIIDGIDDVEEFQLTDEAFDILNFSAVEKQDCYRLMSAHMHMGNMKFKQRPREEQAEPDGTDEAEKASNMYGIGCEEFLKALTKPRVKVGTEWVSKGQNCEQVNWAVGAMAKGLYSRVFNWLVKKCNLTLDQKGIDRDYFIGVLDIAGFEIFDFNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYAREGIQWVFIDFGLDLQACIELIEKPLGIISMLDEECIVPKATDLTLASKLVDQHLGKHPNFEKPKPPKGKQGEAHFAMRHYAGTVRYNCLNWLEKNKDPLNDTVVSAMKQSKGNDLLVEIWQDYTTQEEAAAKAKEGGGGGKKKGKSGSFMTVSMLYRESLNNLMTMLNKTHPHFIRCIIPNEKKQSGMIDAALVLNQLTCNGVLEGIRICRKGFPNRTLHPDFVQRYAILAAKEAKSDDDKKKCAEAIMSKLVNDGSLSEEMFRIGLTKVFFKAGVLAHLEDIRDEKLATILTGFQSQIRWHLGLKDRKRRMEQRAGLLIVQRNVRSWCTLRTWEWFKLYGKVKPMLKAGKEAEELEKINDKVKALEDSLAKEEKLRKELEESSAKLVEEKTSLFTNLESTKTQLSDAEERLAKLEAQQKDASKQLSELNDQLADNEDRTADVQRAKKKIEAEVEALKKQIQDLEMSLRKAESEKQSKDHQIRSLQDEMQQQDEAIAKLNKEKKHQEEINRKLMEDLQSEEDKGNHQNKVKAKLEQTLDDLEDSLEREKRARADLDKQKRKVEGELKIAQENIDESGRQRHDLENNLKKKESELHSVSSRLEDEQALVSKLQRQIKDGQSRISELEEELENERQSRSKADRAKSDLQRELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAVAELTDQLDQLNKAKAKVEKDKAQAVRDAEDLAAQLDQETSGKLNNEKLAKQFELQLTELQSKADEQSRQLQDFTSLKGRLHSENGDLVRQLEDAESQVNQLTRLKSQLTSQLEEARRTADEEARERQTVAAQAKNYQHEAEQLQESLEEEIEGKNEILRQLSKANADIQQWKARFEGEGLLKADELEDAKRRQAQKINELQEALDAANSKNASLEKTKSRLVGDLDDAQVDVERANGVASALEKKQKGFDKIIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGLRRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHARALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNGADTREQFFNAEKRATLLQSEKEELLVANEAAERARKQAEYEAADARDQANEANAQVSSLTSAKRKLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQHVDRLRKGLEQQLKEIQVRLDEAEAAALKGGKKVIAKLEQRVRELESELDGEQRRFQDANKNLGRADRRVRELQFQVDEDKKNFERLQDLIDKLQQKLKTQKKQVEEAEELANLNLQKYKQLTHQLEDAEERADQAENSLSKMRSKSRASASVAPG 1942          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: myo-3 (Myosin-3 [Source:UniProtKB/Swiss-Prot;Acc:P12844])

HSP 1 Score: 1670.21 bits (4324), Expect = 0.000e+0
Identity = 1009/1960 (51.48%), Postives = 1397/1960 (71.28%), Query Frame = 3
Query:   87 NP----SDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAA---ATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTK-VKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKE-ALVSSLFAPAEDPNNT-----------GKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNL----YRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTAR--GGSMAPGMTT 5888
            NP    +DP F +LG+ R+A        FDSKKNCWIPD ++ F+AA I+  +G+  TV T K    TVKKD+ ++MNPPKF   EDMANLTFLN+ASVL NL+ RY   +IYTYSGLFCV INPYKR PIY+  VI  + GKRR EMPPH+F++SD AY NM+ D++NQS+LITGESGAGKTENTKKVI+YFA V A   A+ KE  D   G    GTLE+QIVQ NPVLEA+GNAKTVRNNNSSRFGKFIR HF  SGK+AG DIE YLLEKSRV  Q  GER YHIFYQI+S        KL +S D   Y F +Q ELTI+G+DD+EEM++T EAFDI+GF   E M L++ T  I++MGEMKFKQRPREEQAE DG  +A   A +LG+ A++ ++++ KP+V+VG E+V KGQN +QV ++V  LAK++Y RMF W++ R NKTLD K ++R+ FIGVLDIAGFEIF+ N FEQ+ IN+ NERLQQFFNHHMFVLEQEEYK+E I W FIDFG+DLQACIELIEKP+GI+SIL+EEC+ PKA+DMT+  KL D HLGK PNF KPKPPK  Q +AHF + HYAG+V YN T +LEKNKDPLN+T + LL  S + +L+  ++   +                GKR K  +  T+S  +RESLN LM  L  T PHFIRCI+PNE K  GVID+ LVL+QL CNGVLEGIRICRKGFPNRM+Y +FK RY+ILA +A  +   + K+ +  IL+ + +D NL    +++G TK+FFKAG LA LED+RDE LS ++++FQ++IR YL + + ++  +Q+  L ++QRN+R +  LRTW W+KL+ KVKP+L   +++E M + A ++ KL+E  ++ +  + +LE Q   L+E KN LFL L+TE+ +LADAEE+  KL   KA +E ++ ++   L + ++    L   KKK   E+ + KK V DLE SL+KAEQEK ++D  I+SLQD+MA Q+E + KL KEKK  +E  +K  E L +EE+KV +L K + KLEQ +DE+EEN+ RE++ R D+EK KRK+E +LK  QE +D++ + K ++E  LKRKE +L + ++K+ + + ++A+LQR IKEL AR  ELEE+LEAER +R K+++SR + E ELEEL++RLE+QGGAT+AQ++ NKKREAE+ KL+R+ EE ++ H+  I+  RK+  D V E +EQL+ LQK+KAK E EK++++ DL + Q   +S  +++ + +K +K IE Q SELQ K +E +R + D      +    N++L   LEE ++Q+N L ++K  +Q+QL+E R+  +EESR +  L++  +NL  +   LRE L+EE E+K+D+ RQ+ K   E+QQ KA+F+  G  + EE++ AK+    ++ EL +  E   +K    EKV+ +L  +++D   DV++A    +  EK ++ F+ +++EW++K  +  +EL+A+QR++R +S ++F+ K   +E  E L+S +RENK+LA E+ DLT+Q+GEGGRSV E+ K  ++LE+EKEELQ AL+EAE ALE EEAK  R+Q+E+SQIR EI++R+ EKEEEFE TR NHQRA+ESM+A+LEAE++ + EA ++KKKLE DI +LE+A+D ANR  ++ +K  KK+ + VQEL   +E+E+ QKD+IREQ   +E++  ++ +E +E+    E +ER R+N E E +E+ ++ N+L+   S     +RKLE +L A  ++LEE A E + A EQ +KA AD+ARL +E+RQEQEH+  I++I+K LE Q KE+Q +LD++EN ALKGGKK +++LE R+R +E ELDGEQ+RH +++KN RK ERR+KE+  Q  E+KKN+ERL +LV+KLQ K+K +KRQVEEAEE+AA NL KY+ +  + E +EERAD AE AL K+R K R+S S A   G  M P  ++
Sbjct:    4 NPDAFENDPGFPFLGISREARAATAARPFDSKKNCWIPDPEDGFVAAEIQSTTGEQVTVVTVKGNQITVKKDQCQEMNPPKFDKTEDMANLTFLNEASVLGNLKDRYKDLMIYTYSGLFCVVINPYKRLPIYSESVIKHFMGKRRNEMPPHLFAVSDEAYRNMVQDKENQSMLITGESGAGKTENTKKVISYFAIVGATQAASGKEAKDGKKG----GTLEEQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRTHFSGSGKLAGGDIEHYLLEKSRVVRQAPGERCYHIFYQIMSGNDPSLRGKLKLSNDITYYHFCSQAELTIEGMDDKEEMRLTQEAFDIMGFEDNETMDLYRSTAGIMHMGEMKFKQRPREEQAEPDGEEDALNAAAMLGIQAEEFLKALTKPRVRVGTEWVNKGQNLEQVNWAVSGLAKAIYARMFKWIITRCNKTLDAKEIERKHFIGVLDIAGFEIFDLNSFEQLWINFVNERLQQFFNHHMFVLEQEEYKREGIAWTFIDFGLDLQACIELIEKPLGIISILDEECIVPKATDMTYAQKLLDQHLGKHPNFQKPKPPKGKQGDAHFAIVHYAGTVRYNATNFLEKNKDPLNDTAVALLKHSTDNSLMLDIWQDYQTQEEAAEAAKAGQTAGGKRGKSSSFATVSMIYRESLNNLMNMLYQTHPHFIRCIIPNEKKASGVIDSALVLNQLTCNGVLEGIRICRKGFPNRMLYPDFKHRYAILAADAAKES--DPKKASVGILDKISVDGNLTDEEFKVGETKIFFKAGVLAKLEDLRDEILSRIVTMFQSRIRSYLAKAEVRRRYEQQTGLLVVQRNVRAWCTLRTWEWFKLFGKVKPMLKAGKEQEAMGELAVKIQKLEEAVQRGEIARSQLESQVADLVEEKNALFLSLETEKANLADAEERNEKLNQLKATLESKLSDITGQLEDMQERNEDLARQKKKTDQELSDTKKHVQDLELSLRKAEQEKQSRDHNIRSLQDEMANQDEAVAKLNKEKKHQEESNRKLNEDLQSEEDKVNHLEKIRNKLEQQMDELEENIDREKRSRGDIEKAKRKVEGDLKVAQENIDEITKQKHDVETTLKRKEEDLHHTNAKLAENNSIIAKLQRLIKELTARNAELEEELEAERNSRQKSDRSRSEAERELEELTERLEQQGGATAAQLEANKKREAEIAKLRREKEEDSLNHETAISSLRKRHGDSVAELTEQLETLQKLKAKSEAEKSKLQRDLEESQHATDSEVRSRQDLEKALKTIEVQYSELQTKADEQSRQLQDFAALKNRLNNENSDLNRSLEEMDNQLNSLHRLKSTLQSQLDETRRNYDEESRERQALAATAKNLEHENTILREHLDEEAESKADLTRQISKLNAEIQQWKARFDSEGLNKLEEIEAAKKALQLKVQELTDTNEGLFAKIASQEKVRFKLMQDLDDAQSDVEKAAAQVAFYEKHRRQFESIIAEWKKKTDDLSSELDAAQRDNRQLSTDLFKAKTANDELAEYLDSTRRENKSLAQEVKDLTDQLGEGGRSVAELQKIVRKLEVEKEELQKALDEAEAALEAEEAKVLRAQIEVSQIRSEIEKRIQEKEEEFENTRRNHQRALESMQATLEAETKQKEEALRIKKKLESDINDLEIALDHANRAYADAQKTIKKYMETVQELQFQIEEEQRQKDEIREQFLASEKRNAILQSEKDELAQQAEAAERARRNAEAECIELREQNNDLNAHVSALTGQRRKLEGELLAAHAELEEIANELKNAVEQGQKASADAARLAEELRQEQEHSMHIERIRKGLELQIKEMQIRLDDAENAALKGGKKIIAQLEARIRAIEQELDGEQRRHQDTEKNWRKAERRVKEVEFQVVEEKKNEERLTELVDKLQCKLKIFKRQVEEAEEVAASNLNKYKVLTAQFEQAEERADIAENALSKMRNKIRASASMAPPDGFPMVPSASS 1957          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: Mhc (Myosin heavy chain [Source:FlyBase gene name;Acc:FBgn0264695])

HSP 1 Score: 1877.83 bits (4863), Expect = 0.000e+0
Identity = 1116/1912 (58.37%), Postives = 1446/1912 (75.63%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKR------KKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAP 5876
            +DSKK+CWIPDEKE ++   I+   GD+ +V     ET+ +KKD ++Q+NPPK+   EDM+NLT+LNDASVL NLRQRYY  LIYTYSGLFCV INPYKR+P+YT +    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K +E       K KG+LEDQ+VQ NPVLEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RV SQQ  ER+YHIFYQI+S       +  L++ +   Y  ++QG++T+  +DD EE  +TD+AFDILGF+ +EK  +++ T ++++MG MKFKQR REEQAE DG  E  +V+ L G +  +L +++LKP++KVGNE+VT+G+N  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF +NGFEQ+CIN+TNE+LQQFFNHHMFVLEQEEYK+E IDW FIDFGMDL ACI+LIEKPMGILSILEEE MFPKA+D TF  KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YN+TGWLEKNKDPLN+TV++    S+  L+  +FA     +  G++      KKGG   T+SS ++E LN LM  L+ST PHF+RCI+PNE KQPGV+DAHLV+HQL CNGVLEGIRICRKGFPNRM+Y +FK RY IL P  I +G  + K+ T  ++E+ +L+ + YRLGNTKVFF+AG L  +E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTWPW+KL+ KVKPLLN++R E+E+ +  E+  K +E      K +KELE  N KLL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L +EED    L   KKK   EI  LKKD+ DLE ++QKAEQ+K  KD QI++L D++A Q+E +NKL KEKK   E  +KT E L A E+K+ +LNK KAKLEQT+DE+E++L RE+K+R DVEK KRK+E +LK TQE V DLER K+ELE+ ++RK+ EL + ++K+EDE  +V + QR+IKELQARI+ELEE++EAERQARAKAEK R  L  ELEEL +RLEE GGATSAQ++LNKKREAEL KL+RDLEE+N+QH+  +A  RKK  D V E +EQ+DQL K+KAK EKEKNE    LNDL+  ++ +   KA  +K  K+++   +E+Q KL+E NR +ND + +  K    N++L  +LEEAESQ++QL K+K  + TQLE+ +++A+EESR +A L    RNL  DLDNLRE +EEE E K+D+QRQL KA  E Q  ++K+E  G  RSEEL+EAKRK   R+ E EE  E+   K   LEK K RL  E+ED+ ++VDRAN +A+  EKKQK FDK++ EW+ K  +  AEL+ASQ+E R  S E+FR+K   EE QEQLE+V+RENKNLADE+ DL +QIGEGGR++HEI+KARKRLE EK+ELQ ALEEAE ALEQEE K  R+QLE+SQ+RQEIDRR+ EKEEEFE TR NHQRA++SM+ASLEAE++G+AEA +MKKKLE DI ELE+A+D AN+  +E +KN K++QQQ++++ + +E+E+  +D  REQ  ++ER+   +  ELEE R  LE ++R R+  E E  +  ++LNE+S Q++   A KRKLE++L  + SDL+E   EA+ + E+AKKA+ D+ARL DE+R EQ+HAQ  +K++K LE Q KELQ +LDE+E NALKGGKKA+ KLEQRVRELE ELDGEQ+RH ++QKN RK ERR+KEL  Q++ED+KN ER+QDLV+KLQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K R K R+  S  RG S AP
Sbjct:   32 YDSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGETRDLKKDLLQQVNPPKYEKAEDMSNLTYLNDASVLHNLRQRYYNKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDE-----AAKSKGSLEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHHMFVLEQEEYKREGIDWAFIDFGMDLLACIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYQILNPKGI-KGIEDPKKCTKVLIESTELNDDQYRLGNTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEKEKNEYYGQLNDLRAGVDHITNEKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAG-SVGRGASPAP 1936          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: Mhc (Myosin heavy chain [Source:FlyBase gene name;Acc:FBgn0264695])

HSP 1 Score: 1877.45 bits (4862), Expect = 0.000e+0
Identity = 1117/1916 (58.30%), Postives = 1448/1916 (75.57%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKR------KKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 5888
            +DSKK+CWIPDEKE ++   I+   GD+ +V     ET+ +KKD ++Q+NPPK+   EDM+NLT+LNDASVL NLRQRYY  LIYTYSGLFCV INPYKR+P+YT +    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K +E       K KG+LEDQ+VQ NPVLEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RV SQQ  ER+YHIFYQI+S       +  L++ +   Y  ++QG++T+  +DD EE  +TD+AFDILGF+ +EK  +++ T ++++MG MKFKQR REEQAE DG  E  +V+ L G +  +L +++LKP++KVGNE+VT+G+N  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF +NGFEQ+CIN+TNE+LQQFFNHHMFVLEQEEYK+E IDW FIDFGMDL ACI+LIEKPMGILSILEEE MFPKA+D TF  KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YN+TGWLEKNKDPLN+TV++    S+  L+  +FA     +  G++      KKGG   T+SS ++E LN LM  L+ST PHF+RCI+PNE KQPGV+DAHLV+HQL CNGVLEGIRICRKGFPNRM+Y +FK RY IL P  I +G  + K+ T  ++E+ +L+ + YRLGNTKVFF+AG L  +E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTWPW+KL+ KVKPLLN++R E+E+ +  E+  K +E      K +KELE  N KLL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L +EED    L   KKK   EI  LKKD+ DLE ++QKAEQ+K  KD QI++L D++A Q+E +NKL KEKK   E  +KT E L A E+K+ +LNK KAKLEQT+DE+E++L RE+K+R DVEK KRK+E +LK TQE V DLER K+ELE+ ++RK+ EL + ++K+EDE  +V + QR+IKELQARI+ELEE++EAERQARAKAEK R  L  ELEEL +RLEE GGATSAQ++LNKKREAEL KL+RDLEE+N+QH+  +A  RKK  D V E +EQ+DQL K+KAK EKEKNE    LNDL+  ++ +   KA  +K  K+++   +E+Q KL+E NR +ND + +  K    N++L  +LEEAESQ++QL K+K  + TQLE+ +++A+EESR +A L    RNL  DLDNLRE +EEE E K+D+QRQL KA  E Q  ++K+E  G  RSEEL+EAKRK   R+ E EE  E+   K   LEK K RL  E+ED+ ++VDRAN +A+  EKKQK FDK++ EW+ K  +  AEL+ASQ+E R  S E+FR+K   EE QEQLE+V+RENKNLADE+ DL +QIGEGGR++HEI+KARKRLE EK+ELQ ALEEAE ALEQEE K  R+QLE+SQ+RQEIDRR+ EKEEEFE TR NHQRA++SM+ASLEAE++G+AEA +MKKKLE DI ELE+A+D AN+  +E +KN K++QQQ++++ + +E+E+  +D  REQ  ++ER+   +  ELEE R  LE ++R R+  E E  +  ++LNE+S Q++   A KRKLE++L  + SDL+E   EA+ + E+AKKA+ D+ARL DE+R EQ+HAQ  +K++K LE Q KELQ +LDE+E NALKGGKKA+ KLEQRVRELE ELDGEQ+RH ++QKN RK ERR+KEL  Q++ED+KN ER+QDLV+KLQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K R K R+  S  RG S AP  T+
Sbjct:   32 YDSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGETRDLKKDLLQQVNPPKYEKAEDMSNLTYLNDASVLHNLRQRYYNKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDE-----AAKSKGSLEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHHMFVLEQEEYKREGIDWAFIDFGMDLLACIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYQILNPKGI-KGIEDPKKCTKVLIESTELNDDQYRLGNTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEKEKNEYYGQLNDLRAGVDHITNEKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAG-SVGRGASPAPRATS 1940          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: Mhc (Myosin heavy chain [Source:FlyBase gene name;Acc:FBgn0264695])

HSP 1 Score: 1875.52 bits (4857), Expect = 0.000e+0
Identity = 1115/1912 (58.32%), Postives = 1444/1912 (75.52%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKR------KKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAP 5876
            +DSKK+CWIPDEKE ++   I+   GD+ +V     ET+ +KKD ++Q+NPPK+   EDM+NLT+LNDASVL NLRQRYY  LIYTYSGLFCV INPYKR+P+YT +    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K +E       K KG+LEDQ+VQ NPVLEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RV SQQ  ER+YHIFYQI+S       +  L++ +   Y  ++QG++T+  +DD EE  +TD+AFDILGF+ +EK  +++ T ++++MG MKFKQR REEQAE DG  E  +V+ L G +  +L +++LKP++KVGNE+VT+G+N  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF +NGFEQ+CIN+TNE+LQQFFNHHMFVLEQEEYK+E IDW FIDFGMDL ACI+LIEKPMGILSILEEE MFPKA+D TF  KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YN+TGWLEKNKDPLN+TV++    S+  L+  +FA     +  G++      KKGG   T+SS ++E LN LM  L+ST PHF+RCI+PNE KQPGV+DAHLV+HQL CNGVLEGIRICRKGFPNRM+Y +FK RY I+ P  + QG  + K+ T  I++ + L  + YRLGNTKVFF+AG L  +E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTWPW+KL+ KVKPLLN++R E+E+ +  E+  K +E      K +KELE  N KLL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L +EED    L   KKK   EI  LKKD+ DLE ++QKAEQ+K  KD QI++L D++A Q+E +NKL KEKK   E  +KT E L A E+K+ +LNK KAKLEQT+DE+E++L RE+K+R DVEK KRK+E +LK TQE V DLER K+ELE+ ++RK+ EL + ++K+EDE  +V + QR+IKELQARI+ELEE++EAERQARAKAEK R  L  ELEEL +RLEE GGATSAQ++LNKKREAEL KL+RDLEE+N+QH+  +A  RKK  D V E +EQ+DQL K+KAK EKEKNE    LNDL+  ++ +   KA  +K  K+++   +E+Q KL+E NR +ND + +  K    N++L  +LEEAESQ++QL K+K  + TQLE+ +++A+EESR +A L    RNL  DLDNLRE +EEE E K+D+QRQL KA  E Q  ++K+E  G  RSEEL+EAKRK   R+ E EE  E+   K   LEK K RL  E+ED+ ++VDRAN +A+  EKKQK FDK++ EW+ K  +  AEL+ASQ+E R  S E+FR+K   EE QEQLE+V+RENKNLADE+ DL +QIGEGGR++HEI+KARKRLE EK+ELQ ALEEAE ALEQEE K  R+QLE+SQ+RQEIDRR+ EKEEEFE TR NHQRA++SM+ASLEAE++G+AEA +MKKKLE DI ELE+A+D AN+  +E +KN K++QQQ++++ + +E+E+  +D  REQ  ++ER+   +  ELEE R  LE ++R R+  E E  +  ++LNE+S Q++   A KRKLE++L  + SDL+E   EA+ + E+AKKA+ D+ARL DE+R EQ+HAQ  +K++K LE Q KELQ +LDE+E NALKGGKKA+ KLEQRVRELE ELDGEQ+RH ++QKN RK ERR+KEL  Q++ED+KN ER+QDLV+KLQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K R K R+  S  RG S AP
Sbjct:   32 YDSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGETRDLKKDLLQQVNPPKYEKAEDMSNLTYLNDASVLHNLRQRYYNKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDE-----AAKSKGSLEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHHMFVLEQEEYKREGIDWAFIDFGMDLLACIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYKIMCPKLL-QGVEKDKKATEIIIKFIDLPEDQYRLGNTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEKEKNEYYGQLNDLRAGVDHITNEKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAG-SVGRGASPAP 1936          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: Mhc (Myosin heavy chain [Source:FlyBase gene name;Acc:FBgn0264695])

HSP 1 Score: 1874.37 bits (4854), Expect = 0.000e+0
Identity = 1115/1916 (58.19%), Postives = 1448/1916 (75.57%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKR------KKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 5888
            +DSKK+CWIPDEKE ++   I+   GD+ +V     ET+ +KKD ++Q+NPPK+   EDM+NLT+LNDASVL NLRQRYY  LIYTYSGLFCV INPYKR+P+YT +    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K +E       K KG+LEDQ+VQ NPVLEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RV SQQ  ER+YHIFYQI+S       +  L++ +   Y  ++QG++T+  +DD EE  +TD+AFDILGF+ +EK  +++ T ++++MG MKFKQR REEQAE DG  E  +V+ L G +  +L +++LKP++KVGNE+VT+G+N  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF +NGFEQ+CIN+TNE+LQQFFNHHMFVLEQEEY++E I+W FIDFGMDLQ CI+LIEKPMGILSILEEE MFPKA+D TF  KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YN+TGWLEKNKDPLN+TV++    S+  L+  +FA     +  G++      KKGG   T+SS ++E LN LM  L+ST PHF+RCI+PNE KQPGV+DAHLV+HQL CNGVLEGIRICRKGFPNRM+Y +FK RY IL P  I +G  + K+ T  ++E+ +L+ + YRLGNTKVFF+AG L  +E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTWPW+KL+ KVKPLLN++R E+E+ +  E+  K +E      K +KELE  N KLL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L +EED    L   KKK   EI  LKKD+ DLE ++QKAEQ+K  KD QI++L D++A Q+E +NKL KEKK   E  +KT E L A E+K+ +LNK KAKLEQT+DE+E++L RE+K+R DVEK KRK+E +LK TQE V DLER K+ELE+ ++RK+ EL + ++K+EDE  +V + QR+IKELQARI+ELEE++EAERQARAKAEK R  L  ELEEL +RLEE GGATSAQ++LNKKREAEL KL+RDLEE+N+QH+  +A  RKK  D V E +EQ+DQL K+KAK EKEKNE    LNDL+  ++ +   KA  +K  K+++   +E+Q KL+E NR +ND + +  K    N++L  +LEEAESQ++QL K+K  + TQLE+ +++A+EESR +A L    RNL  DLDNLRE +EEE E K+D+QRQL KA  E Q  ++K+E  G  RSEEL+EAKRK   R+ E EE  E+   K   LEK K RL  E+ED+ ++VDRAN +A+  EKKQK FDK++ EW+ K  +  AEL+ASQ+E R  S E+FR+K   EE QEQLE+V+RENKNLADE+ DL +QIGEGGR++HEI+KARKRLE EK+ELQ ALEEAE ALEQEE K  R+QLE+SQ+RQEIDRR+ EKEEEFE TR NHQRA++SM+ASLEAE++G+AEA +MKKKLE DI ELE+A+D AN+  +E +KN K++QQQ++++ + +E+E+  +D  REQ  ++ER+   +  ELEE R  LE ++R R+  E E  +  ++LNE+S Q++   A KRKLE++L  + SDL+E   EA+ + E+AKKA+ D+ARL DE+R EQ+HAQ  +K++K LE Q KELQ +LDE+E NALKGGKKA+ KLEQRVRELE ELDGEQ+RH ++QKN RK ERR+KEL  Q++ED+KN ER+QDLV+KLQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K R K R+  S  RG S AP  T+
Sbjct:   32 YDSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGETRDLKKDLLQQVNPPKYEKAEDMSNLTYLNDASVLHNLRQRYYNKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDE-----AAKSKGSLEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHHMFVLEQEEYQREGIEWTFIDFGMDLQLCIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYQILNPKGI-KGIEDPKKCTKVLIESTELNDDQYRLGNTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEKEKNEYYGQLNDLRAGVDHITNEKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAG-SVGRGASPAPRATS 1940          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: Mhc (Myosin heavy chain [Source:FlyBase gene name;Acc:FBgn0264695])

HSP 1 Score: 1874.37 bits (4854), Expect = 0.000e+0
Identity = 1122/1916 (58.56%), Postives = 1443/1916 (75.31%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKR------KKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 5888
            +DSKK+CWIPDEKE ++   I+   GD+ +V     ET+ +KKD ++Q+NPPK+   EDM+NLT+LNDASVL NLRQRYY  LIYTYSGLFCV INPYKR+P+YT +    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K +E       K KG+LEDQ+VQ NPVLEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RV SQQ  ER+YHIFYQI+S       E  L+S +   Y  ++QG+ TI  V+D EE    D+AFDILGF+ +EK  +++ T ++++MG MKFKQR REEQAE DG  E  +V+ L G +  +L +++LKP++KVGNE+VT+G+N  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF +NGFEQ+CIN+TNE+LQQFFNHHMFVLEQEEYK+E IDW FIDFGMDL ACI+LIEKPMGILSILEEE MFPKA+D TF  KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YN+TGWLEKNKDPLN+TV++    S+  L+  +FA     +  G++      KKGG   T+SS ++E LN LM  L+ST PHF+RCI+PNE KQPGV+DAHLV+HQL CNGVLEGIRICRKGFPNRM+Y +FK RY ILAP AI       K    K LEAV LD ++YR+G+TKVFF+AG L  +E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTWPW+KL+ KVKPLLN++R E+E+ +  E+  K +E      K +KELE  N KLL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L +EED    L   KKK   EI  LKKD+ DLE ++QKAEQ+K  KD QI++L D++A Q+E +NKL KEKK   E  +KT E L A E+K+ +LNK KAKLEQT+DE+E++L RE+K+R DVEK KRK+E +LK TQE V DLER K+ELE+ ++RK+ EL + ++K+EDE  +V + QR+IKELQARI+ELEE++EAERQARAKAEK R  L  ELEEL +RLEE GGATSAQ++LNKKREAEL KL+RDLEE+N+QH+  +A  RKK  D V E +EQ+DQL K+KAK EKEKNE    LNDL+  ++ +   KA  +K  K+++   +E+Q KL+E NR +ND + +  K    N++L  +LEEAESQ++QL K+K  + TQLE+ +++A+EESR +A L    RNL  DLDNLRE +EEE E K+D+QRQL KA  E Q  ++K+E  G  RSEEL+EAKRK   R+ E EE  E+   K   LEK K RL  E+ED+ ++VDRAN +A+  EKKQK FDK++ EW+ K  +  AEL+ASQ+E R  S E+FR+K   EE QEQLE+V+RENKNLADE+ DL +QIGEGGR++HEI+KARKRLE EK+ELQ ALEEAE ALEQEE K  R+QLE+SQ+RQEIDRR+ EKEEEFE TR NHQRA++SM+ASLEAE++G+AEA +MKKKLE DI ELE+A+D AN+  +E +KN K++QQQ++++ + +E+E+  +D  REQ  ++ER+   +  ELEE R  LE ++R R+  E E  +  ++LNE+S Q++   A KRKLE++L  + SDL+E   EA+ + E+AKKA+ D+ARL DE+R EQ+HAQ  +K++K LE Q KELQ +LDE+E NALKGGKKA+ KLEQRVRELE ELDGEQ+RH ++QKN RK ERR+KEL  Q++ED+KN ER+QDLV+KLQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K R K R+  S  RG S AP  T+
Sbjct:   32 YDSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGETRDLKKDLLQQVNPPKYEKAEDMSNLTYLNDASVLHNLRQRYYNKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDE-----AAKSKGSLEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKEYCLLSNNIYDYRIVSQGKTTIPSVNDGEEWVAVDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHHMFVLEQEEYKREGIDWAFIDFGMDLLACIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYMILAP-AIMAAEKVAKNAAGKCLEAVGLDPDMYRIGHTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEKEKNEYYGQLNDLRAGVDHITNEKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAG-SVGRGASPAPRATS 1940          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: vmhcl (ventricular myosin heavy chain-like [Source:ZFIN;Acc:ZDB-GENE-061027-393])

HSP 1 Score: 1791.55 bits (4639), Expect = 0.000e+0
Identity = 1037/1917 (54.09%), Postives = 1407/1917 (73.40%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG-------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            YL    K  ++    +FD KK C++PD  E F+ AT+    GD  TV+T   +T TVK+ ++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V+  Y+GK+RTE PPHI+SISDNAY  MLADR+NQS+LITGESGAGKT NTK+VI YFA +AA+  K++ D     K KGTLEDQI+QANP LEA+GNAKT+RN+NSSRFGKFIRIHF T GK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      E LL++ +P  Y+FI+QGE T+  +DD +E+  TD AFDILGF+ EEK S++K T +I++ G MKFKQ+ REEQAEADGT +A+K A+L+G+N+ DL++ +  P+VKVGNE+VTKGQN  QV Y++GAL+K++Y +MF W+V+R+N++L+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+  WL KNKDPLNETV+ L   S   L+S+LFA     ++         K+KKG + QT+S+ HRE+LNKLM NL+ST PHF+RC++PNE K PG ++  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P AIP+G F++ K+   K+L ++ +D   YR G+TKVFFKAG L  LE+MRDE+LS +I+  QA+ RG L R +Y K+ ++R AL +IQ N+R ++ ++ WPW KL+ K+KPLL  A  E+EM    EE  KLKE + K +  +KELEE+ V LL+ KNDL LQ+Q EQD+L DAEE+   L+  K  ME + KEL + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  ++ + KL KEKKA  E  ++T + L +EE+KV  L KAK KLEQ +D++E +L +E+KIR D+E+ KRK+E +LK TQE++ DLE  K++LEE+LK+K+ E+   +SKI+DE  ++ QLQ+K+KELQAR++ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEE+ +QH+   A  RKKQ D V E  EQ+D LQ+VK K+EKEK+E++ +L+D+   +E + K+K N +K  + +E Q +E + K EE  R +ND      K Q  N E   +LEE ES ++QL + K     QLE+ ++  +EE +AK  L+  +++   D D LRE  EEE E K+++QR + KA  E+ Q + K+E     R+EEL+EAK+K   R+ E EE  E   +K   LEK K RLQ EIED++VDV+R+NT A+ L+KKQ+ FDK++SEW+QKY ESQ ELE+SQ+E+R++S E+F++K   EES + LE++KRENK L +EI DLTEQ+GEGG+++HE++K RK+LE EK E+Q ALEEAE +LE EE K  R+QLE +QI+ +I+R+L+EK+EE E  + N QR +++++++LE+E+R R EA ++KKK+E D+ E+E+ +  ANR  +E +K  K  Q  +++    ++D     D ++E T + ER+  ++ AELEE+R  LE +ER RK  E E +++T+R+  L  Q++  +  K+KLE DL+  Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE RVRELE E++ EQKR  ES K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKR  EE+EE A V+L K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   15 YLRKSEKERLEAQTKAFDLKKECFVPDAIEEFVKATVVSREGDKVTVETQGGKTVTVKEADVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVIAYRGKKRTEAPPHIYSISDNAYQYMLADRENQSILITGESGAGKTVNTKRVIQYFASIAASGGKKDQD-----KNKGTLEDQIIQANPALEAFGNAKTIRNDNSSRFGKFIRIHFDTRGKLASADIETYLLEKSRVTFQLKAERDYHIFYQILSNKKPEILEMLLVTSNPYDYAFISQGETTVPSIDDSDELMATDSAFDILGFTQEEKNSVYKLTGAIMHYGNMKFKQKQREEQAEADGTEDADKSAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVQQVNYAIGALSKAVYEKMFLWMVVRINQSLETKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKSNNF-QKPRLVKGKPEAHFALVHYAGTVDYNINNWLVKNKDPLNETVVGLYQKSSLKLLSNLFANYAGADSATGDGGKKEKKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCLIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPAAIPEGQFIDSKKGAEKLLGSLDIDHQQYRFGHTKVFFKAGLLGQLEEMRDERLSKIITGIQAKSRGLLSRAEYIKMVERRDALLVIQWNVRAFMAVKNWPWMKLFFKIKPLLRSAEAEKEMANMKEEFLKLKEAYAKSEARRKELEEKMVTLLQEKNDLQLQVQAEQDNLCDAEERCEGLIKNKIQMEAKAKELTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLTQESIMDLENDKQQLEEKLKKKDFEISQLNSKIDDEQSIIIQLQKKLKELQARVEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATAATLRKKQADSVAELGEQIDNLQRVKQKLEKEKSELRLELDDVASSMEHIVKSKTNMEKVNRTLEDQMNEYRNKCEEYQRSLNDFTTQKAKLQAENDEFSRQLEEKESLVSQLTRGKNSFSQQLEDLKRQLDEEIKAKNALAHALQSARHDTDLLREQYEEEQEAKAELQRSMSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNTAAASLDKKQRHFDKIISEWKQKYEESQCELESSQKEARSLSTELFKLKNSYEESMDHLETMKRENKILQEEISDLTEQLGEGGKTIHELEKVRKQLEQEKAEIQAALEEAEGSLEHEEGKILRTQLEFNQIKADIERKLSEKDEEMEQVKRNQQRTIDTLQSALESETRSRNEALRIKKKMEGDLNEMEIQLSQANRQAAEAQKQLKSVQAHLKDSQLQLDDSLRSNDDLKENTAIVERRNALLQAELEELRAVLEQTERGRKLAEQELLDVTERVQLLHSQNTSLINQKKKLETDLSQFQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELECEVEAEQKRSSESVKGIRKYERRIKELTYQTEEDRKNIARLQDLVDKLQLKVKAYKRAAEESEEQANVHLGKFRKLQHELDEAEERADIAESQVNKLRAKSR 1925          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: smyhc2 (slow myosin heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-070822-12])

HSP 1 Score: 1787.31 bits (4628), Expect = 0.000e+0
Identity = 1035/1907 (54.27%), Postives = 1410/1907 (73.94%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG---------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVS 5849
            FD KK C++PD +  ++ A++    GD  TV+T+  +T TVK+ +    NPPKF  IEDMA  TFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V+  Y+GK+RTE PPHIFSISDNAY  ML+DR+NQSVLITGESGAGKT NTK+VI YFA +AAA   ++D +   Q++KGTLEDQI+Q NP LEA+GNAKT+RN+NSSRFGKFIRIHFG SGK++ ADIE YLLEKSRV  Q K ER+YHIFYQILS       E LLI+ +P  YS+I+QGE  +  +DD +E+  TDEAFD+LGF+ EEK S++K T +I++ G MKFKQ+ REEQAEADGT +A+KVA+L+G+N+ DL++ +  P+VKVGNE+VTKGQN  QV YS+GALAKS+Y +MF W+V+R+N++LDTK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACIELIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGK+PNF +      G+ EAHF L HYAG+V YN++ WL KNKDPLNETV+ L   S   L+ +LFA   +   T           +KKG + QT+S+ HRE+LNKLM NL+ST PHF+RC++PNE K PG ++  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P+AIP+G F++ K+   K+L ++ +D N Y+LG+TKVFFKAG L  LE+MRD++L+ +I+  QA+ RG L R +++K+ ++R +L +IQ N+R ++ ++ WPW KLY K+KPLL  A  E+EM    EE TKLKE + K +  KKELEE+ V LL+ KNDL L +Q+EQD+LADAEE+   L+  K   E ++KEL + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L +EE+KV  L KAKAKLEQ +D++E +L +E+KIR D+E+ KRK+E +LK TQE + DLE  K+++EE+LK+K+ E+   +SKIEDE  L AQLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEE+ +QH+   +  RKK  D V++  EQ+D LQ+VK K+EKEK+E++ +L+D+   +E + KAKAN +K  + +E Q SE + K EE  R IND      K Q  N EL  +LEE +S ++QL + KQ    Q+E+ ++  EEE +AK  L+  V++   D + LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDKV++EW+QKY ESQ ELE++Q+ESR++S E+F++K   EES + LES+KRENKNL +EI DLTEQ+GE G+++HE++K RK+LE EK+E+Q ALEEAE +LE EE K  R+QLE +Q++ +I+R+L+EK+EE E  + N QR ++++++SLE+E+R R EA ++KKK+E D+ E+E+ +  ANR  SE +K  K     +++    ++D     D ++E   + ER+  ++ AEL+E+R  +E +ER RK  E E M++++R+  L  Q++  +  K+KLE D   +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE RVRELE+E++ EQ++  +S K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K+YKR  EEAEE A  NL K+RK+Q E++++EERAD AE  + KLR K+R S S
Sbjct:   31 FDMKKECFVPDPEVEYVKASVTSRDGDKVTVETEFGKTVTVKEVDCHPQNPPKFDKIEDMAMFTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVVAYRGKKRTEAPPHIFSISDNAYQYMLSDRENQSVLITGESGAGKTVNTKRVIQYFASIAAAPGGKKDPS---QEKKGTLEDQIIQCNPALEAFGNAKTIRNDNSSRFGKFIRIHFGVSGKLSSADIETYLLEKSRVTYQLKAERDYHIFYQILSQRKPELLEMLLITNNPYDYSYISQGETQVASIDDRDELIATDEAFDVLGFTQEEKNSIYKLTGAIMHYGNMKFKQKQREEQAEADGTEDADKVAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVQQVYYSIGALAKSVYEKMFLWMVVRINQSLDTKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKNPNF-QKPRIVKGRPEAHFALVHYAGTVDYNISNWLVKNKDPLNETVVGLFQKSTLKLLGTLFANYAEKYFTADSGGKGKGGAKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCLIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPSAIPEGQFIDNKKGAEKLLGSLDIDHNQYKLGHTKVFFKAGLLGTLEEMRDDRLALIITGIQARARGILSRIEFQKIVERRDSLLVIQWNVRAFMGVKNWPWMKLYFKIKPLLKTAETEKEMANMKEEFTKLKEAYAKSEARKKELEEKMVSLLQEKNDLQLAVQSEQDNLADAEERCEGLIKSKIQFEAKVKELTERLEDEEEMNAELVAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDEIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLTQENLMDLENDKQQMEERLKKKDFEISQLNSKIEDEQALEAQLQKKLKELQARIEELEEELEAERAARAKVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATASTLRKKHADSVSDLGEQIDNLQRVKQKLEKEKSELRLELDDVVSNMEQIVKAKANLEKMCRTLEDQMSEYRTKAEEGQRTINDFTMQKAKLQTENGELSRQLEEKDSLVSQLTRGKQSYTQQIEDLKRQLEEEVKAKNALAHAVQSARHDAELLREQYEEEQEAKAELQRSLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKVLAEWKQKYEESQTELESAQKESRSLSTELFKLKNSYEESLDHLESMKRENKNLQEEISDLTEQLGESGKNIHELEKVRKQLEQEKQEIQTALEEAEGSLEHEEGKILRAQLEFNQVKADIERKLSEKDEEMEQAKRNQQRVVDTLQSSLESETRSRNEALRLKKKMEGDLNEMEIQLSQANRQASEAQKQLKGLHGHLKDAQLQLDDALRGNDDLKENIAIVERRNNLLQAELDELRSLVEQTERGRKLAEQELMDVSERVQLLHSQNTSLLNQKKKLEGDNTQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLESRVRELESEVEMEQRKASDSVKGVRKYERRIKELTYQTEEDRKNLARLQDLVDKLQLKVKSYKRTAEEAEEQANSNLGKFRKLQHELDEAEERADIAESQVNKLRAKSRDSGS 1933          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: FO904953.1 (pep:known chromosome:GRCz10:19:890369:910641:1 gene:ENSDARG00000099115.1 transcript:ENSDART00000164612.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:FO904953.1)

HSP 1 Score: 1786.54 bits (4626), Expect = 0.000e+0
Identity = 1035/1907 (54.27%), Postives = 1410/1907 (73.94%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG---------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVS 5849
            FD KK C++PD +  ++ A++    GD  TV+T+  +T TVK+ +    NPPKF  IEDMA  TFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V+  Y+GK+RTE PPHIFSISDNAY  ML+DR+NQSVLITGESGAGKT NTK+VI YFA +AAA   ++D +   Q++KGTLEDQI+Q NP LEA+GNAKT+RN+NSSRFGKFIRIHFG SGK++ ADIE YLLEKSRV  Q K ER+YHIFYQILS       E LLI+ +P  YS+I+QGE  +  +DD +E+  TDEAFD+LGF+ EEK S++K T +I++ G MKFKQ+ REEQAEADGT +A+KVA+L+G+N+ DL++ +  P+VKVGNE+VTKGQN  QV YS+GALAKS+Y +MF W+V+R+N++LDTK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACIELIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGK+PNF +      G+ EAHF L HYAG+V YN++ WL KNKDPLNETV+ L   S   L+ +LFA   +   T           +KKG + QT+S+ HRE+LNKLM NL+ST PHF+RC++PNE K PG ++  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P+AIP+G F++ K+   K+L ++ +D N Y+LG+TKVFFKAG L  LE+MRD++L+ +I+  QA+ RG L R +++K+ ++R +L +IQ N+R ++ ++ WPW KLY K+KPLL  A  E+EM    EE TKLKE + K +  KKELEE+ V LL+ KNDL L +Q+EQD+LADAEE+   L+  K   E ++KEL + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L +EE+KV  L KAKAKLEQ +D++E +L +E+KIR D+E+ KRK+E +LK TQE + DLE  K+++EE+LK+K+ E+   +SKIEDE  L AQLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEE+ +QH+   +  RKK  D V++  EQ+D LQ+VK K+EKEK+E++ +L+D+   +E + KAKAN +K  + +E Q SE + K EE  R IND      K Q  N EL  +LEE +S ++QL + KQ    Q+E+ ++  EEE +AK  L+  V++   D + LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDKV++EW+QKY ESQ ELE++Q+ESR++S E+F++K   EES + LES+KRENKNL +EI DLTEQ+GE G+++HE++K RK+LE EK+E+Q ALEEAE +LE EE K  R+QLE +Q++ +I+R+L+EK+EE E  + N QR ++++++SLE+E+R R EA ++KKK+E D+ E+E+ +  ANR  SE +K  K     +++    ++D     D ++E   + ER+  ++ AEL+E+R  +E +ER RK  E E M++++R+  L  Q++  +  K+KLE D   +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE RVRELE+E++ EQ++  +S K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K+YKR  EEAEE A  NL K+RK+Q E++++EERAD AE  + KLR K+R S S
Sbjct:   31 FDMKKECFVPDPEVEYVKASVTSRDGDKVTVETEFGKTVTVKEVDCHPQNPPKFDKIEDMAMFTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVVAYRGKKRTEAPPHIFSISDNAYQYMLSDRENQSVLITGESGAGKTVNTKRVIQYFASIAAAPGGKKDPS---QEKKGTLEDQIIQCNPALEAFGNAKTIRNDNSSRFGKFIRIHFGVSGKLSSADIETYLLEKSRVTYQLKAERDYHIFYQILSQRKPELLEMLLITNNPYDYSYISQGETQVASIDDRDELIATDEAFDVLGFTQEEKNSIYKLTGAIMHYGNMKFKQKQREEQAEADGTEDADKVAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVQQVYYSIGALAKSVYEKMFLWMVVRINQSLDTKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKNPNF-QKPRIVKGRPEAHFALVHYAGTVDYNISNWLVKNKDPLNETVVGLFQKSTLKLLGTLFANYAEKYFTADSGGKGKGGAKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCLIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPSAIPEGQFIDNKKGAEKLLGSLDIDHNQYKLGHTKVFFKAGLLGTLEEMRDDRLALIITGIQARARGILSRIEFQKIVERRDSLLVIQWNVRAFMGVKNWPWMKLYFKIKPLLKTAETEKEMANMKEEFTKLKEAYAKSEARKKELEEKMVSLLQEKNDLQLAVQSEQDNLADAEERCEGLIKSKIQFEAKVKELTERLEDEEEMNAELVAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDEIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLTQENLMDLENDKQQMEERLKKKDFEISQLNSKIEDEQALEAQLQKKLKELQARIEELEEELEAERAARAKVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATASTLRKKHADSVSDLGEQIDNLQRVKQKLEKEKSELRLELDDVVSNMEQIVKAKANLEKMCRTLEDQMSEYRTKSEEGQRTINDFTMQKAKLQTENGELSRQLEEKDSLVSQLTRGKQSYTQQIEDLKRQLEEEVKAKNALAHAVQSARHDAELLREQYEEEQEAKAELQRSLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKVLAEWKQKYEESQTELESAQKESRSLSTELFKLKNSYEESLDHLESMKRENKNLQEEISDLTEQLGESGKNIHELEKVRKQLEQEKQEIQTALEEAEGSLEHEEGKILRAQLEFNQVKADIERKLSEKDEEMEQAKRNQQRVVDTLQSSLESETRSRNEALRLKKKMEGDLNEMEIQLSQANRQASEAQKQLKGLHGHLKDAQLQLDDALRGNDDLKENIAIVERRNNLLQAELDELRSLVEQTERGRKLAEQELMDVSERVQLLHSQNTSLLNQKKKLEGDNTQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLESRVRELESEVEMEQRKASDSVKGVRKYERRIKELTYQTEEDRKNLARLQDLVDKLQLKVKSYKRTAEEAEEQANSNLGKFRKLQHELDEAEERADIAESQVNKLRAKSRDSGS 1933          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: smyhc2 (slow myosin heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-070822-12])

HSP 1 Score: 1785.77 bits (4624), Expect = 0.000e+0
Identity = 1037/1906 (54.41%), Postives = 1412/1906 (74.08%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF---APAEDPN-----NTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVS 5849
            FD KK C++PD +  ++ A++    GD  TV+T+  +T TVK+ +    NPPKF  IEDMA  TFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V+  Y+GK+RTE PPHIFSISDNAY  ML+DR+NQSVLITGESGAGKT NTK+VI YFA +AAA   ++D +   Q++KGTLEDQI+Q NP LEA+GNAKT+RN+NSSRFGKFIRIHFG SGK++ ADIE YLLEKSRV  Q K ER+YHIFYQILS       E LLI+ +P  YS+I+QGE  +  +DD +E+  TDEAFD+LGF+ EEK S++K T +I++ G MKFKQ+ REEQAEADGT +A+KVA+L+G+N+ DL++ +  P+VKVGNE+VTKGQN  QV YS+GALAKS+Y +MF W+V+R+N++LDTK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACIELIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGK+PNF +      G+ EAHF L HYAG+V YN++ WL KNKDPLNETV+ L   S   L+ +LF   A AE  +       G +KKG + QT+S+ HRE+LNKLM NL+ST PHF+RC++PNE K PG ++  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P+AIP+G F++ K+   K+L ++ +D N Y+LG+TKVFFKAG L  LE+MRD++L+ +I+  QA+ RG L R +++K+ ++R +L +IQ N+R ++ ++ WPW KLY K+KPLL  A  E+EM    EE TKLKE + K +  KKELEE+ V LL+ KNDL L +Q+EQD+LADAEE+   L+  K   E ++KEL + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L +EE+KV  L KAKAKLEQ +D++E +L +E+KIR D+E+ KRK+E +LK TQE + DLE  K+++EE+LK+K+ E+   +SKIEDE  L AQLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEE+ +QH+   +  RKK  D V++  EQ+D LQ+VK K+EKEK+E++ +L+D+   +E + KAKAN +K  + +E Q SE + K EE  R IND      K Q  N EL  +LEE +S ++QL + KQ    Q+E+ ++  EEE +AK  L+  V++   D + LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDKV++EW+QKY ESQ ELE++Q+ESR++S E+F++K   EES + LES+KRENKNL +EI DLTEQ+GE G+++HE++K RK+LE EK+E+Q ALEEAE +LE EE K  R+QLE +Q++ +I+R+L+EK+EE E  + N QR ++++++SLE+E+R R EA ++KKK+E D+ E+E+ +  ANR  SE +K  K     +++    ++D     D ++E   + ER+  ++ AEL+E+R  +E +ER RK  E E M++++R+  L  Q++  +  K+KLE D   +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE RVRELE+E++ EQ++  +S K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K+YKR  EEAEE A  NL K+RK+Q E++++EERAD AE  + KLR K+R S S
Sbjct:   31 FDMKKECFVPDPEVEYVKASVTSRDGDKVTVETEFGKTVTVKEVDCHPQNPPKFDKIEDMAMFTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVVAYRGKKRTEAPPHIFSISDNAYQYMLSDRENQSVLITGESGAGKTVNTKRVIQYFASIAAAPGGKKDPS---QEKKGTLEDQIIQCNPALEAFGNAKTIRNDNSSRFGKFIRIHFGVSGKLSSADIETYLLEKSRVTYQLKAERDYHIFYQILSQRKPELLEMLLITNNPYDYSYISQGETQVASIDDRDELIATDEAFDVLGFTQEEKNSIYKLTGAIMHYGNMKFKQKQREEQAEADGTEDADKVAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVQQVYYSIGALAKSVYEKMFLWMVVRINQSLDTKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKNPNF-QKPRIVKGRPEAHFALVHYAGTVDYNISNWLVKNKDPLNETVVGLFQKSTLKLLGTLFANYAGAESADSGGKGKGGAKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCLIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPSAIPEGQFIDNKKGAEKLLGSLDIDHNQYKLGHTKVFFKAGLLGTLEEMRDDRLALIITGIQARARGILSRIEFQKIVERRDSLLVIQWNVRAFMGVKNWPWMKLYFKIKPLLKTAETEKEMANMKEEFTKLKEAYAKSEARKKELEEKMVSLLQEKNDLQLAVQSEQDNLADAEERCEGLIKSKIQFEAKVKELTERLEDEEEMNAELVAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDEIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLTQENLMDLENDKQQMEERLKKKDFEISQLNSKIEDEQALEAQLQKKLKELQARIEELEEELEAERAARAKVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATASTLRKKHADSVSDLGEQIDNLQRVKQKLEKEKSELRLELDDVVSNMEQIVKAKANLEKMCRTLEDQMSEYRTKAEEGQRTINDFTMQKAKLQTENGELSRQLEEKDSLVSQLTRGKQSYTQQIEDLKRQLEEEVKAKNALAHAVQSARHDAELLREQYEEEQEAKAELQRSLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKVLAEWKQKYEESQTELESAQKESRSLSTELFKLKNSYEESLDHLESMKRENKNLQEEISDLTEQLGESGKNIHELEKVRKQLEQEKQEIQTALEEAEGSLEHEEGKILRAQLEFNQVKADIERKLSEKDEEMEQAKRNQQRVVDTLQSSLESETRSRNEALRLKKKMEGDLNEMEIQLSQANRQASEAQKQLKGLHGHLKDAQLQLDDALRGNDDLKENIAIVERRNNLLQAELDELRSLVEQTERGRKLAEQELMDVSERVQLLHSQNTSLLNQKKKLEGDNTQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLESRVRELESEVEMEQRKASDSVKGVRKYERRIKELTYQTEEDRKNLARLQDLVDKLQLKVKSYKRTAEEAEEQANSNLGKFRKLQHELDEAEERADIAESQVNKLRAKSRDSGS 1932          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: vmhc (ventricular myosin heavy chain [Source:ZFIN;Acc:ZDB-GENE-991123-5])

HSP 1 Score: 1776.91 bits (4601), Expect = 0.000e+0
Identity = 1037/1912 (54.24%), Postives = 1412/1912 (73.85%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAA--ATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFA--PAEDPNN------TGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARG 5861
            FD KK C++PD  E ++ A+I    GD  TV+T+K +T TVK+ +I   NPPKF  IEDMA  TFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V+  Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA  + KKE      G ++KGTLEDQI+QANP LEA+GNAKT+RN+NSSRFGKFIRIHFG SGK+A ADIE YLLEKSRV  Q K ER+YHIFYQILS       E LLI+ +P  Y++I+QGE T+  ++D EE+  TDEAFD+LGF+ EEK  ++K   +I++ G MKFKQ+ REEQAEADGT + +KVA+L+G+N+ DL++ +  P+VKVGNE+VTKGQN  QV Y++GALAKS+Y +MF W+V+R+N++LDTK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGKS NF +      G+ E+HF L HYAG+V YN+  WL KNKDPLNETV+ L   S   L+S LFA     + +N       G +KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K PG ++  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P AIP+G F++ ++   K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRD++LS +IS  QA+ RG L R +++K+ ++R AL +IQ N+R ++ ++ WPW KL+ K+KPLL  A  E+EM    +E  KLKE + K +  +KELEE+ V LL+ KNDL LQ+Q EQD+L DAEE+  +L+  K  +E + KEL + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  ++ + KL KEKKA  E  ++T + L +EE+KV  L KAKAKLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K++LEE+LK+K+ E+   + KIEDE  +  QLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEE+ +QH+   A  RKKQ D V E  EQ+D LQ+VK K+EKEK+E++ +L+D+   +E + K KAN +K  + +E Q +E + K EE  R IND      K Q  N EL  +LEE +S ++QL + K     Q+E+ ++  EEE++AK+ L+  V++   D D LRE  EEE E K+++QR + KA  E+ Q + K+E     R+EEL+EAK+K   R+ E EE  E   +K   LEK K RLQ EIED++VD++R+N  A+ L+KKQ+ FDKV+SEW+QK+ ESQAELE+SQ+E+R +S E+F++K   EE+ + LE++KRENKNL +EI DLTEQ+GEGG+S+HE++K RK+LE EK E+Q ALEEAE +LE EE K  R+QLE SQI+ +I+R+LAEK+EE E ++ N QR ++++++SLE+E+R R EA ++KKK+E D+ E+E+ +  ANR  +E +K  K     +++    ++D     + ++E T + ER+  ++ AELEE+R +LE +ER RK  E E ++ ++R+  L  Q++  +  K+KLE D++ +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE RVRELE+E++ EQK+  E+ K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKR  EEAEE A  NL+K+RKIQ E++++EERAD AE  + KLR K+R  VS+ +G
Sbjct:   31 FDMKKECFVPDPDEEYVKASIVSREGDKVTVQTEKRKTVTVKEADIHPQNPPKFDKIEDMAMFTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVVAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAGGSAKKE------GAEKKGTLEDQIIQANPALEAFGNAKTIRNDNSSRFGKFIRIHFGASGKLASADIETYLLEKSRVTFQLKAERDYHIFYQILSQRKPELLEMLLITNNPYDYAYISQGETTVASINDGEELLATDEAFDVLGFTQEEKNGIYKLIGAIMHFGNMKFKQKQREEQAEADGTEDGDKVAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVQQVYYAIGALAKSVYEKMFLWMVVRINQSLDTKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDSTFKAKLYDNHLGKSNNF-QKPRAIKGKPESHFSLVHYAGTVDYNINNWLVKNKDPLNETVVGLFQKSTVKLLSMLFANYAGTESDNGKGGKGGGSKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGQLEEMRDDRLSLIISGIQARSRGLLARVEFQKIVERRDALLVIQWNVRAFMGVKNWPWMKLFFKIKPLLKSAEAEKEMANMKDEFAKLKEAYAKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLCDAEERCDQLIKNKIQLEAKAKELTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLTQESLMDLENDKQQLEERLKKKDFEISQLNGKIEDEQTICIQLQKKLKELQARIEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATAATLRKKQADSVAELGEQIDNLQRVKQKLEKEKSELRLELDDVVSNMEHVVKTKANLEKMTRSLEDQMNEYKTKYEEGQRCINDFTMQKSKLQSENGELSRQLEEKDSLVSQLTRSKMSYTQQIEDLKRQLEEETKAKSALAHAVQSARHDTDLLREQYEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQETEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDLERSNAAAAALDKKQRNFDKVLSEWKQKFEESQAELESSQKEARCLSTELFKLKNSYEEALDHLETMKRENKNLQEEISDLTEQLGEGGKSIHELEKMRKQLEQEKSEIQSALEEAEASLEHEEGKILRAQLEFSQIKADIERKLAEKDEEMEQSKRNLQRTIDTLQSSLESETRSRNEALRIKKKMEGDLNEMEIQLSQANRQAAEAQKQLKSVHAHMKDAQLQLDDSLRTNEDLKENTAIVERRNNLLQAELEELRAALEQTERGRKLAEQELLDTSERVQLLHSQNTSLLNQKKKLETDISQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELESEVESEQKKSSEAVKGIRKYERRIKELTYQTEEDRKNLARLQDLVDKLQLKVKAYKRAAEEAEEQANTNLSKFRKIQHELDEAEERADIAESQVNKLRAKSR-DVSSKKG 1934          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: myh4 (myosin, heavy chain 4, skeletal muscle [Source:Xenbase;Acc:XB-GENE-989283])

HSP 1 Score: 1783.07 bits (4617), Expect = 0.000e+0
Identity = 1039/1918 (54.17%), Postives = 1411/1918 (73.57%), Query Frame = 3
Query:   99 PDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF----APAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            P   +L    K  ++     FD++ + ++ D KE+++  T++   G   TVKT+  +T TVK D+I  MNPPKF  IEDMA +T LN+ SVL NL++RY   +IYTYSGLFCVT+NPYK  P+Y P+V++ Y+GK+R E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AAA  K++++     K KGTLEDQI+QANP+LEA+GNAKTVRN+NSSRFGKFIRIHFGT+GK+A ADIE YLLEKSRV  Q K ER+YHIFYQI+SN      E LLI+ +P  + F++QGE+++  +DD EE+  TD A DILGF+A+EK+S++K T ++++ G M+FKQ+ REEQAE DGT  A+K A+L+ +N+ DL++++  P+VKVGNEYVTKGQ   QV  SVGAL K++Y +MF W+V R+N+ LDTK  RQ+FIGVLDIAGFEIF+FN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDL ACIELIEKPMGI SILEEECMFPKA+D +FK KLYD HLGKS NF +   P  G+AEAHF L HYAG+V YN++GWLEKNKDPLN+TVI L   S    ++ LF    A   +    G +KKG + QT+S+  RE+LNKLM NL++T PHF+RCI+PNE K PG ++  LVLHQL CNGVLEGIRICRKGFP+R++Y +FKQRY IL  +AIP+G F++ K+ + K+L ++ +D   YR G+TKVFFKAG L  LE+MRD++L+ +I+  QA  RGYLMR ++KK+ ++R A+  IQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM+   EE  K KE   K +  +KELEE+ VK+L+ KNDL LQ+Q+E ++L DAEE+  +L+  K  +E ++KEL + L +EE++ A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L AEE+KV  L KAKAKLEQ +D++E +L +E+K+R D+E+ KRK+E +LK  QET+ DLE  +++L+E+LK+KE E+   +SKIEDE  L AQLQ+KIKELQARI+ELEE++EAER ARAKAEK R  L  ELEE+S+RLEE GGATSAQ+++NKKREAE  K++RDLEE+ +QH+   A  RKKQ D V E  EQ+D LQ+VK K+EKEK+E+K +++DL   +E+L+KAKAN +K  + +E Q SEL+ K EE  R IND      + Q  N E   +LEE +S I+QL + KQ    Q+EE ++  EEE +AK  L+  +++   D D LRE  EEE E K ++QR L KA GE+ Q + K+E     R+EEL++AK+K   R+ E EE  E   SK   LEK K RLQ E+ED++VDV+R+N+  + L+KKQK FDK+++EW+QK+ ESQAELEASQ+ESR++S E+F+MK   EES + LE+ KRENKNL  EI DLTEQ+ E  +++HE++KA+K +E EK E+Q ALEEAE +LE EE K  R QLE++Q++ EIDR++AEK+EE +  + NH R +ESM+++L+AE R R +A ++KKK+E D+ E+E+ +  ANR  SE +K  +  Q  ++++   ++D    ++ ++EQ  M ER+  ++ AE+EE+R +LE +ER+RK  E E ++ ++R+  L  Q++  + TK+K+E D+  +Q+++EEA  EAR A E+AKKA+ D+A + +E+++EQ+ +  ++++KK L+   K+LQ +LDE+E  A+KGGKK + KLE RVRELE E+D EQKR  E+ K  RK ERR+KEL  Q++EDKKN  RLQDLV+KLQ K+K YKRQ EE EE + +NL KYRKIQ E+E++EERAD AE  + KLR K R
Sbjct:   12 PAAHFLRKSEKERIEAQNKPFDARTSMFVVDTKESYVKGTLQSKEGGKATVKTEAGQTVTVKDDQIFPMNPPKFDKIEDMAMMTHLNEPSVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVNAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAAAPDKKKEEVA---KTKGTLEDQIIQANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKKPELIEMLLITTNPYDFPFVSQGEISVASIDDTEELMATDSAIDILGFNADEKVSIYKLTGAVMHYGNMRFKQKQREEQAEPDGTEVADKAAYLMCLNSADLLKALCYPRVKVGNEYVTKGQTVQQVYNSVGALGKAVYEKMFLWMVTRINEMLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYDQHLGKSNNF-QKPKPAKGKAEAHFSLVHYAGTVDYNISGWLEKNKDPLNDTVIGLFQKSSMKTLAYLFSSYAASEAEGAKKGGKKKGSSFQTVSALFRENLNKLMSNLRTTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYKILNASAIPEGQFIDSKKASEKLLGSIDVDHTQYRFGHTKVFFKAGLLGTLEEMRDDRLAHVITRTQAMCRGYLMRVEFKKMMERREAVFTIQYNIRSFMNVKHWPWMKLYFKIKPLLKSAESEKEMQNMKEEFEKTKELLAKSEAKRKELEEKMVKVLQEKNDLQLQVQSESENLTDAEERCDQLIKSKIQLEAKMKELNERLEDEEESNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAVLDETIVKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKLRMDLERSKRKLEGDLKLAQETIMDLENDRQQLDEKLKKKEFEMSQYASKIEDEQALGAQLQKKIKELQARIEELEEEIEAERAARAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMENLSKAKANFEKICRTLEDQLSELKTKDEEHQRQINDLTAQRARLQTENGEYARQLEERDSLISQLSRGKQAFTQQIEELKRQLEEEIKAKNALAHGLQSARHDCDLLREQYEEEQEAKGELQRSLSKANGEVAQWRTKYETDAIQRTEELEDAKKKLAQRLQEAEEHIEAVNSKCASLEKTKQRLQNEVEDLMVDVERSNSACAALDKKQKNFDKILAEWKQKFEESQAELEASQKESRSLSTELFKMKNAYEESLDHLETTKRENKNLQQEISDLTEQVSEVSKTLHEVEKAKKIIEQEKTEIQSALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHVRVVESMQSTLDAEIRSRNDALRLKKKMEGDLNEMEIQLSHANRQASESQKQLRNVQGLLKDVQIHLDDSLRAQEDLKEQLAMVERRANLMQAEIEEMRAALEQTERSRKVAEQELLDASERVQLLHSQNTSLINTKKKMETDITQLQTEVEEAIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLDQTVKDLQHRLDEAEQLAMKGGKKQIQKLEARVRELENEVDVEQKRSTEAIKGVRKYERRVKELSYQSEEDKKNILRLQDLVDKLQMKVKAYKRQTEEIEEQSNINLTKYRKIQHELEEAEERADIAESQVNKLRAKTR 1925          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: myh2 (myosin, heavy chain 2, skeletal muscle, adult [Source:Xenbase;Acc:XB-GENE-5760121])

HSP 1 Score: 1771.52 bits (4587), Expect = 0.000e+0
Identity = 1022/1914 (53.40%), Postives = 1395/1914 (72.88%), Query Frame = 3
Query:  156 SFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAA---ATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGS 5867
            +FD+K  C++ D+KE ++   I    G   TVKT+ +   TVK+ ++   NPPKF  IEDMA +T LN+ASVL NL++RY   +IYTYSGLFCVT+NPYK  P+Y P+V++ Y+GK+R E PPHIFSISDNAY  ML DR+NQSVLITGESGAGKT NTK+VI YFA +AA   + KK+E         +GTLEDQI+QANP+LEA+GNAKTVRN+NSSRFGKFIRIHFGT+GK+A ADIE YLLEKSRV  Q   ER+YHIFYQIL+N      E LL++ +P  Y+FI+QGE+ +  +DDEEE+  TD A DILGF+AEEKM ++K T S+++ G MKFKQ+ REEQAE DGT  A+K+ +L+G+N+ DL++++  P+VKVGNE+VTKGQ   QV  S+GAL+KS++ ++F W+V R+N+ LDTK+ RQ+FIGVLDIAGFEIF+ N  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE IDWEFIDFGMDL ACIELIEKPMGILSILEEECMFPKA+D +FK KLYD HLGK  NF +   P  G+AEAHF L HYAG+V YN+ GWL+KNKDPLNETV+ L   S   L+S L++     +  G      K+KKG + QT+S+  RE+LNKLM NL+ST PHF+RC++PNE K PG+++ HL++HQL CNGVLEGIRICRKGFP+R++Y +FKQRY IL  +AIP G F++ K+   K+L ++ +D   YR G+TKVFFKAG L  LE+MRD+KL+ LI+  QA  RG+LMR ++KK+ ++R A+ +IQ N+R ++ ++ WPW KLY K+KPLL  A  E+EM    EE  K KE   K D  +KELEE+ V LL+ KNDL LQ Q+E +SLADAEE+   L+  K ++E +IKEL + L +EE++ A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E ++K+ KEKKA  E  ++T + L AEE+KV +L+KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK  QET+ DLE  K++ EE+LK+K+ EL     KIEDE  +  QLQ+KIKELQARI+E+EE++EAER ARAK EK R  L  ELEE+S+RLEE GGATSAQ+++NKKREAE  KL+RDLEES +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E+K +++DL   LE+++K+KAN +K  + +E Q SE++ + +E  R IND      + Q  N EL  +LEE ES ++QL + KQ    Q EE ++  EEE++AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ E EE+ E   SK   LEK K RLQ E+ED++VDV+RAN+ A+ L+KKQ+ FDKV+ EW+QKY ESQAELEASQ+ESR++S E+F+MK   EE+ E LE++KRENKNL  EI DL+EQIGE  ++  E++KA+K++  ++     A  E  +A       + R  LE++Q++ E+DR++AEK+EE E  + N QR +++M+++L++E R R +A ++KKK+E D+ ELE+ +  ANR   E +K  +  Q Q+++    ++D    ++ ++EQ  + +R+ T+  AE+EE+R +LE +ER+RK  E E ++ ++R+  L  Q++  + TK+KLE D   +Q+++EEA  EAR A E+AKKA+ D+A + +E+++EQ+ +  ++++KK LE   K+LQ +LDE+E  A+KGGKK L KLE RVRELE ELD EQKR VE+ K  RK ERR+KEL  Q++ED+KN  RLQDLV+KLQ K+K YKRQ EE+EE A  +LA++RK+Q E+E+SEERAD AE  + KLR K+R  + + +G S
Sbjct:   30 AFDAKNTCFVEDDKELYVKGLITAREGGKVTVKTEDARNVTVKESQVYPQNPPKFDKIEDMAMMTHLNEASVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVAGYRGKKRQEAPPHIFSISDNAYQFMLQDRENQSVLITGESGAGKTVNTKRVIQYFATIAAIGDSNKKKE----MSNSMQGTLEDQIIQANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLSAERSYHIFYQILTNKKPEIVEMLLLTTNPYDYAFISQGEIAVKSIDDEEELMATDSAIDILGFTAEEKMGIYKMTGSVMHKGNMKFKQKQREEQAEPDGTEVADKIGYLMGLNSADLLKALCYPRVKVGNEFVTKGQTVQQVYNSIGALSKSVFEKLFLWMVTRINQQLDTKLPRQYFIGVLDIAGFEIFDLNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIDWEFIDFGMDLAACIELIEKPMGILSILEEECMFPKATDTSFKNKLYDQHLGKCKNF-EKPKPAKGKAEAHFSLVHYAGTVDYNICGWLDKNKDPLNETVVGLYQKSSLKLLSFLYSSYAGTDGAGDGAKSGKKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCLIPNESKTPGIMENHLIIHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYKILNASAIPDGQFIDSKKACEKLLGSIDIDHTQYRFGHTKVFFKAGLLGTLEEMRDDKLAQLITRTQALCRGFLMRVEFKKMIERRDAIFVIQYNVRSFMNVKHWPWMKLYFKIKPLLKSAETEKEMANMKEEFEKTKEALTKSDARRKELEEKMVALLQEKNDLMLQCQSENESLADAEERCEGLIKNKINLEAKIKELTERLEDEEESNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETISKISKEKKALQEAHQQTLDDLQAEEDKVSSLSKAKTKLEQQVDDLEGSLEQEKKLRLDLERAKRKLEGDLKLAQETIMDLENDKQQTEEKLKKKDFELSQLQGKIEDEQSVGCQLQKKIKELQARIEEVEEEIEAERAARAKVEKQRADLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKLRRDLEESTLQHEATSAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLASNLENVSKSKANLEKLSRVLEDQLSEIKSRDDEHQRIINDLTAQKARLQTENGELSRQLEEKESLVSQLTRGKQGFTQQTEELKRQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEAKAELQRSLSKANTEVSQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEQVEAVNSKCASLEKTKQRLQAEVEDLMVDVERANSAAAALDKKQRNFDKVLVEWKQKYEESQAELEASQKESRSLSTEIFKMKNAYEEALEHLETMKRENKNLQQEISDLSEQIGESAKTTMELEKAKKQV-EQERGDLQAALEEAEARLASATNALRWSLELNQVKSEVDRKIAEKDEEIEQLKRNSQRVIDTMQSTLDSEIRSRNDALRLKKKMEGDLNELEIQLGHANRQAGEAQKQLRNVQAQLKDTQIHLDDSVRAQEDLKEQLAVVDRRTTLQQAEIEEMRVALEQTERSRKMAEQELLDASERVQLLHSQNTSLINTKKKLETDAGTLQNEMEEAVQEARNAEEKAKKAITDAALMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLAMKGGKKQLQKLESRVRELENELDNEQKRSVEAVKGVRKYERRVKELTYQSEEDRKNVLRLQDLVDKLQLKVKAYKRQAEESEEQANAHLARFRKVQHELEESEERADIAESQVNKLRAKSR-DIGSKKGDS 1936          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: myh4 (myosin, heavy chain 4, skeletal muscle [Source:RefSeq peptide;Acc:NP_001001244])

HSP 1 Score: 1756.11 bits (4547), Expect = 0.000e+0
Identity = 1033/1916 (53.91%), Postives = 1402/1916 (73.17%), Query Frame = 3
Query:  108 QYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFA--PAEDPN---NTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            Q+L    K  ++     FD+K   ++ D KE ++   +        TVKTD   T TVK+++I   NPPKF  IEDMA +T LN+ASVL NL++RY   +IYTYSGLFC T+NPYK  P+Y P+V++ Y+GK+R E PPHIFS+SDNAY  ML DR+NQSVLITGESGAGKT NTK+VI YFA +AA   K+++ + + Q   G LEDQI+QANP+LEA+GNAKTVRN+NSSRFGKFIRIHFGT+GK++ ADIE YLLEKSRV  Q   ER+YHIFYQIL+N      E LL++ +P  Y  I+QGEL +  ++DEEE+  TD A D+LGF+ EEKM ++K T ++++ G +KFKQ+ REEQAE D T  A+K+A+LLG+N+ DL++ +  P+VKVGNE+VTKGQ   QV  SVGAL KS++ ++F W+V R+N+ LDTK  RQFFIGVLDIAGFEIF+FN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE IDWEFIDFGMDL ACIELIEKP+GI SILEEECMFPKA+D +FK KLY+ HLGK  NF +   P  G+AEAHF L HYAG+V YN++GWLEKNKDPLNE+V+ L   S   L+S L++   A D +     GK+KKG + QT+S   RE+LNKLM NL+ST PHF+RC++PNE K PG++D HL++HQL CNGVLEGIRICRKGFP+R++Y +FKQRY +L  +AIP+G F++ K+   K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRDEKL+ LI+  QA  RGYLMR ++ K+ ++R A+ +IQ N+R ++ ++ WPW KLY K+KPLL  A  E+EM    EE  K KE   K +  KKELEE+ V +L+ KNDL LQ+Q+E ++LAD+EE+   L+  K  +E +IKEL + L +EE++ A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E ++KL KEKKA  E  ++T + L AEE+KV +L+KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQETV DLE  K++ EE+LK+K+ E+     KIEDE  L  QLQ+KIKELQARI+E+EE++EAER ARAK EK R  L  ELEE+S+RLEE GGATSAQ+++NKKREAE  KL+RDLEE+ +QH+      RKK  D V E  EQ+D LQ+VK K+EKEK+E+K +++DL   LE+++K+KAN +K  + IE Q SE++ K +E  R +ND +    + Q    EL  +LEE ES I+QL + KQ    Q+EE ++  EEE++AK  L+  +++   D D LRE  EEE E K+++QR L KA GE+ Q + K+E     R+EEL+EAK+K   R+ + EE+ E   SK   LEK K RLQ E+ED++VDV+RAN+ A+ L+KKQ+ FDKV+ EW+QKY E QAELEA+ +ESR++S E+F+MK   EE+ E +E++KRENKNL  EI DLTEQIGE G+SV E++KA+K++E EK +LQ ALEEAE +LE EEAK  R QLE++Q++ E+DR++AEK+EE E  + N QR++++M+++L++E R R +A ++KKK+E D+ ELE+ +  ANR  SE +K  +  Q Q +E    +++    ++ ++EQ  +TER+  +  AE+EE R  LE +ER+RK  E E ++ ++RL  L  Q++  + +K+KLE+D+  +Q++ EEA  EAR A E+AKKA+ D+A + +E+++EQ+ +  ++++KK LE   K+LQ +LDE+E  A+KGGKK L KLE RVRELE ELD EQK  VE+ K  RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE A  +L ++RK+Q E+E++EERAD AE  + KLRTK+R
Sbjct:   14 QFLRKSEKERLEAQSKPFDAKNTVFVDDVKELYVKGMVTAREDGKITVKTDDGRTVTVKENQIYPQNPPKFDKIEDMAMMTHLNEASVLYNLKERYAAWMIYTYSGLFCATVNPYKWLPVYNPEVVAGYRGKKRMEAPPHIFSLSDNAYQAMLTDRENQSVLITGESGAGKTVNTKRVIQYFATIAALGDKKKESSNSLQ---GNLEDQIIQANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLSSADIETYLLEKSRVTFQLSAERSYHIFYQILTNKKPEIVEMLLLTTNPYDYPSISQGELVVKSINDEEELMATDSAIDVLGFNQEEKMGIYKMTGAVMHHGNLKFKQKQREEQAEPDSTEVADKIAYLLGLNSADLLKGLCYPRVKVGNEFVTKGQTVPQVYNSVGALCKSVFEKLFLWMVTRINQQLDTKQPRQFFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIDWEFIDFGMDLAACIELIEKPLGIFSILEEECMFPKATDTSFKNKLYEQHLGKCKNF-EKPKPGKGKAEAHFSLVHYAGTVDYNISGWLEKNKDPLNESVVQLYQKSSVKLLSLLYSSYAATDGDAGGKGGKKKKGSSFQTVSGLFRENLNKLMTNLRSTHPHFVRCLIPNETKTPGIMDNHLLIHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYKVLNASAIPEGQFIDSKKACEKLLGSIDVDHTQYKFGHTKVFFKAGLLGTLEEMRDEKLAQLITRTQALCRGYLMRLEFTKMMERREAIYVIQYNLRSFMNVKHWPWMKLYFKIKPLLKSAETEKEMANMKEEFEKTKEALVKAEARKKELEEKMVAMLQEKNDLVLQVQSESETLADSEERCEGLIKVKIQLESKIKELTERLEDEEESNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAVLDENISKLSKEKKALQEAHQQTLDDLQAEEDKVSSLSKAKTKLEQQVDDLEGSLEQEKKLRLDLERAKRKLEGDLKLTQETVMDLENDKQQTEEKLKKKDFEISQLQGKIEDEQSLGTQLQKKIKELQARIEEVEEEIEAERAARAKVEKQRADLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKLRRDLEEATLQHEATAGALRKKHADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLASNLENVSKSKANLEKVNRVIEDQLSEVKAKDDEHQRLLNDLSTQKARLQTETGELSRQLEERESLISQLSRGKQGFTQQVEELKRQLEEETKAKNALAHALQSARHDCDLLREQFEEEQEAKAELQRSLSKANGEVSQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEQVEAVNSKCASLEKTKQRLQSEVEDLMVDVERANSAAAALDKKQRNFDKVLVEWKQKYEEGQAELEAALKESRSLSTEIFKMKNAYEEALEHVETLKRENKNLQQEISDLTEQIGESGKSVVELEKAKKQVEQEKNDLQAALEEAEGSLEHEEAKILRIQLELNQVKSEVDRKIAEKDEEIEQLKRNSQRSIDTMQSTLDSEIRSRNDALRLKKKMEGDLNELEIQLGHANRQASEAQKQLRNVQGQFKETQLQLDEAIRAQEDLKEQVAVTERRNNLFQAEIEENRAGLEQTERSRKIAEQELLDASERLQLLHSQNTSLINSKKKLESDICQLQNEAEEAVQEARNAEEKAKKAITDAALMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLAMKGGKKQLQKLESRVRELENELDNEQKHGVEAVKGVRKYERRVKELTYQTEEDKKNILRLQDLVDKLQSKVKAYKRQAEEAEEQANTHLGRFRKVQHELEEAEERADIAESQVNKLRTKSR 1925          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: myh13 (myosin, heavy chain 13, skeletal muscle [Source:Xenbase;Acc:XB-GENE-5993071])

HSP 1 Score: 1735.31 bits (4493), Expect = 0.000e+0
Identity = 1020/1924 (53.01%), Postives = 1398/1924 (72.66%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAP-----AEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            M    P  Q+L    K  ++     FD+K + ++ D K+ ++   ++   G   TVK +   T TVK DEI  MNPPK+  IEDMA +T LN+ SVL NL++RY   +IYTYSGLFC T+NPYK  P+Y P+V++ Y+GK+R E PPHIFSISDNAY  ML DR+NQSVLIT +  +G       +I Y + + +A  K++          GTLEDQI+QANP+LEA+GNAKTVRN+NSSRFGKFIRIHFGT+GK++ ADIE YLLEKSRV  Q   ER+YHIFYQI+SN      + LLI+ +P  + +++QGE+T+  +DD+EE+  TD A DILGF+ +EK  ++K T ++++ G MKFKQ+ REEQAE DGT  A+K A+L+G+N+ DL++++  P+VKVGNE+VTKGQ   QV  SVGAL KS+Y +MF W+V+R+N+ LDTK  RQ FIGVLDIAGFEIF+FN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE IDWEFIDFGMDL ACIELIEKPMGI SILEEECMFPKA+D +FK KLYD HLGKS NF +   P  G+AEAHF L HYAG+V YN++GWL+KNKDPLNETVI L   S   L+S L++      A+     G +KKG + QT+S+  RE+LNKLM NL+ST PHF+RC++PNE K PG +D +LV+HQL CNGVLEGIRICRKGFP+R++Y +FKQRY IL  +AIP+G F++ K+ + K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRDE+L+ LI+  QA  RGYLMR +++++ ++R ++  IQ N+R ++ ++ WPW KLY K+KPLL  A  E+EM+   EE  K KE   K +  +KELEE+ V +L+ KNDL LQ+ +E +SLADAEE+   L+  K  +E +IKE  + L +EE++ A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK  QE+  DLE  +++L+E++K+KE E+    SKIEDE  L AQLQ+KIKELQARI+ELEE++EAER ARAKAEK R  L  ELEE+S+RLEE GGATSAQ+++NKKREAE  K++RDLEE+ +QH+   +  RKKQ D V E  EQ+D LQ+VK K+EKEK+E+K +++DL   +ES++KAK+N +K  + +E Q SE++ K EE  R IND N    +    N E   +LEE ES I+QL + KQ    Q EE ++  EEE++AK  L+  +++   D D LRE  EEE E K ++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ E EE+ E   SK   LEK K RLQ E+ED++VDV+R+N+  + L+KKQK FDKV+++W+QK+ ESQAELEASQ+ESR++S EVF+MK   EE+ +QLE++KRENKNL  EI DLTEQI E G+++HEI+KA+K++E EK +LQ ALEEAE +LE EEAK  R QLE++Q++ E+DR++AEK+EE E  + N QRA+ESM+++L+AE R R +A ++KKK+E D+ E+E+ +  ANR  +E +K  +  Q  +++    ++D +   D ++EQ  + ER+  ++ AE+EE+R +LE +ER RK  E E +++T+R+  L  Q++  + TK+K+E+D++ +QS++EEA  EAR A+E+AKKA+ D+A + +E+++EQ+ +  ++++KK LE   K+LQ +LDE+E  A+KGGKK L KLE RVRELE ELD EQKR  ++ K  RK ERR+KEL  Q++EDKKN  RLQDLV+KLQ K+KTYKRQ E+ EE A V+L+++RK Q E+E++EERAD AE  + KLR K+R
Sbjct:    6 MAAYGPAAQFLRKSEKERIEAQNRPFDAKTSVFVIDPKQMYVKGIVQSKEGGKATVKKEDMSTVTVKDDEIFPMNPPKYDKIEDMAMMTHLNEPSVLYNLKERYAAWMIYTYSGLFCATVNPYKWLPVYNPEVVNAYRGKKRQEAPPHIFSISDNAYQYMLTDRENQSVLITTDCVSGTFWRPDSMIPY-SVIESAIHKQKPRGLHNPIWNGTLEDQIIQANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLSSADIETYLLEKSRVTFQLSAERSYHIFYQIMSNKRPELIDMLLITTNPYDFPYVSQGEITVASIDDQEELMATDSAIDILGFNNDEKNGIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLMGLNSADLLKALCYPRVKVGNEFVTKGQTVQQVYNSVGALGKSVYEKMFLWMVIRINQQLDTKQPRQHFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIDWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYDQHLGKSNNF-QKPKPGKGKAEAHFSLVHYAGTVDYNISGWLDKNKDPLNETVIGLYQKSSVKLLSFLYSAYSGTDADTGGKKGGKKKGSSFQTVSALFRENLNKLMANLRSTHPHFVRCLIPNETKTPGAMDHYLVMHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYKILNASAIPEGQFIDSKKASEKLLGSIDVDHTQYKFGHTKVFFKAGLLGTLEEMRDERLAQLITRTQAMCRGYLMRVEFRQMMERRESIFCIQYNVRSFMNVKHWPWMKLYFKIKPLLKSAESEKEMQNMKEEFEKTKEALAKSEAKRKELEEKMVAILQEKNDLHLQVTSESESLADAEERCEGLIKAKIQLEAKIKEFNERLEDEEESNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAILDETIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDMERAKRKLEGDLKLAQESTMDLENDRQQLDEKVKKKEFEISQLQSKIEDEQALAAQLQKKIKELQARIEELEEEIEAERAARAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATASALRKKQADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMESVSKAKSNLEKMCRTLEDQFSEVKTKEEEHLRVINDINAQRARLHTENGEFSRQLEEKESMISQLSRAKQAFTQQTEELKRQLEEETKAKNALAHGLQSARHDCDLLREQYEEEQEAKGELQRSLSKANSEVSQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEQIEAVNSKCASLEKTKQRLQNEVEDLMVDVERSNSACAALDKKQKNFDKVLADWKQKFEESQAELEASQKESRSLSTEVFKMKNSYEEALDQLETLKRENKNLQQEISDLTEQIAESGKTIHEIEKAKKQIEQEKSDLQSALEEAEGSLEHEEAKVLRIQLELNQVKGEVDRKIAEKDEEIEQLKRNSQRALESMQSTLDAEIRSRNDALRLKKKMEGDLNEMEIQLSHANRQAAESQKQLRNVQGLLKDTQLHLDDAQRGNDDLKEQLAIVERRNNLMTAEIEEMRSALEQTERGRKVAEQELIDVTERVQLLHSQNTSLINTKKKIESDVSQLQSEVEEAVQEARNADEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLAMKGGKKQLQKLEARVRELENELDAEQKRGSDAIKGVRKFERRVKELSYQSEEDKKNVFRLQDLVDKLQLKVKTYKRQTEDIEEQANVHLSRFRKAQHELEEAEERADIAESQVNKLRAKSR 1927          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: myh15 (myosin, heavy chain 15 [Source:Xenbase;Acc:XB-GENE-999078])

HSP 1 Score: 1459.89 bits (3778), Expect = 0.000e+0
Identity = 937/1932 (48.50%), Postives = 1314/1932 (68.01%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAA-----ATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF----------APAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKG-FPNRMIYSE--FKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLE-MSQIRQEIDRRLAEK-EEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKM-KKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQV-QELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            +L    K LM Q   +FD KK CWIPD+KEA++ A I++  G   TV+    +T  VK+ +++QMNPPKF +++ MA     N  S+      +  ++++YTYSGLFCVT+NPYK  P+Y  +V++ YKGKRR+E PPHIFSI+DNAY +ML +R+NQS+LITGESGAGKT NTK+VI YFA VAA     + K ++  T TG    GTLEDQI+QANP LEA+GNAKT+RN+NSSRFGKFIRIHFGT+GK++ ADIE YLLEKSRV  QQ GER+YHIFYQILS       + LL+S +P  + F +QG +T+D +DD EE+  TD+AFDILGF  +EK   +K T +I++ G MKFKQ+ REEQAEADGT   +K A+L+G+++ DL++ +L P+VKVGNEYVTKGQ   QV+Y+VGALAK +Y+RMF WLV+R+NKTLDTK+ RQFFIGVLDIAGFEIF+ N     C+      L QF   H+ ++   +YK   I   +   G +    I+ I +P+GI+SILEEECMFPKA+DMTFK+KLYDNHLGKSPNF KP+  K  + EAHFEL HYAG VPYN+ GWLEKNKDPLNETV+ L   S   L+  LF          + A D     KRKKG + QT+SS H+E+LNKLM NL+STSPHF+RCI+PNE K PG +   ++      N     IR+ ++  F  + IY+      RY IL P+AIP+  FV+ ++ + K+L  +++D   YR G+TKVFFKAG L +LE+MRDE+LS +++L QA+ RG LMR +++K+   R AL +IQ NIR ++ ++ WPW KL+ K+KPLL  A  E+EM    EE  KLKE  EK +  +KELEE+ V L++ KNDL LQLQ EQD  ADAEE+   L+  K  ME +IK+L + + +EE+  + L   K+K++ E  ELKKD+ DLE +L KAE+EK A + ++K+L ++MA  ++ +NKL KEKKA  E  ++T + L AEE+KV +L K K KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ D E  K+++EE+LK+KE E+   SSKIEDE  +V QLQ+KIKELQARI+ELEE+LEAER ARAK EK R  L  ELEELS+RLEE GGA++AQ+++NKKRE E +K++RDLEE+ + H+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E+K + +DL   +E L KAK      +  +     EL          ++ ++        T  E     EE ES I+QL + K     Q+E+ R+  EEE++AK  L+  +++   D D LRE  +EE E K+++QR L K   E+   + K+E     R+EEL+EAK+K   R+ E EE  E A +K   LEK K RLQ E+EDM++D++R+N  A+ ++KKQ+ FDK++++W+QKY E+QAELE SQ+++R +S E+F++K   EE  + LE+VKRENKNL +EI DLT+QI EG +S+HEI+K +K++E EK E+Q ALEEAE      ++K    Q+  ++   +  D++  +K  +     R N QR +ES++ ++  +  G      + KK+ E D   LE      +  +  Q+++   +  Q  Q+L    +D  H  + ++EQ  + ER+ T++ +EL+E+R +L+ +ER RK +E E +E T+R+N L  Q++  +  K+KLE D++ MQ+++EE+  E R A ++AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE RVRELE EL+ EQ+R+ ES K  RK ERR+KEL  Q +EDKKN  R+QDL++KLQ K+K+YK Q EEA E +   L+KY+K+Q E++D++ERAD AE  + KLR+K R
Sbjct:   13 FLRKSEKELMIQQTVAFDGKKKCWIPDDKEAYLEAEIKETGGGKVTVEVGDGKTVVVKEGDVQQMNPPKFDILQSMALKGHYNQGSIY----HKIPRSILYTYSGLFCVTVNPYKWLPVYKTEVVAAYKGKRRSEAPPHIFSIADNAYHDMLRNRENQSMLITGESGAGKTVNTKRVIQYFATVAAIGDPMSKKNQQPATKTG----GTLEDQIIQANPALEAFGNAKTLRNDNSSRFGKFIRIHFGTTGKLSSADIEIYLLEKSRVIFQQPGERSYHIFYQILSGKMSELQDMLLVSTNPYDFHFSSQGVVTVDNLDDSEELIATDQAFDILGFIPDEKYGSYKLTGAIMHFGNMKFKQKQREEQAEADGTENTDKAAYLMGISSSDLVKGLLHPRVKVGNEYVTKGQTVAQVVYAVGALAKGIYDRMFKWLVVRINKTLDTKLPRQFFIGVLDIAGFEIFDRNIIFSSCLLLNKRSLCQFL--HVVLVIVSKYKTPNIIVVYT--GNNKPPTIKSILEPLGIMSILEEECMFPKATDMTFKSKLYDNHLGKSPNFQKPRLDKKRKYEAHFELMHYAGVVPYNIMGWLEKNKDPLNETVVGLFQKSSNKLLGCLFENYVSSDSVISFAADQGGEKKRKKGASFQTVSSLHKENLNKLMTNLRSTSPHFVRCIIPNETKTPGTLMKFIIYFYKRMN-----IRLNKQQLFLEQQIYAPTLISDRYRILNPSAIPEDKFVDSRKASEKLLGTLEIDHTQYRFGHTKVFFKAGLLGNLEEMRDERLSKILTLIQARARGKLMRIEFQKILGLRDALLVIQWNIRAFMTVKNWPWMKLFFKIKPLLKSAETEKEMANMKEEFLKLKEALEKSEARRKELEEKQVTLVQEKNDLTLQLQAEQDMFADAEERCDLLIKSKIQMESKIKDLTERIEDEEEMNSELTSKKRKLEDECSELKKDIDDLEITLAKAEKEKHATENKVKNLTEEMASLDDTINKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKIKTKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESLMDAENDKQQMEEKLKKKEFEISQMSSKIEDEQAIVMQLQKKIKELQARIEELEEELEAERAARAKVEKQRSDLARELEELSERLEEAGGASAAQIEMNKKRETEYLKMRRDLEEATLHHEATAASLRKKHADTVAELGEQIDNLQRVKQKLEKEKSELKLEADDLSSSMEQLVKAKTALHFALCPVLC--IELIWMCVCWLNLLDSSSFLKSGLLLTFGEYTTFKEEKESLISQLSRGKSSFTQQIEDLRKQLEEETKAKNALAHALQSARHDCDLLREQFDEEQEAKAELQRSLSKGNAEVATWRNKYETDAIQRTEELEEAKKKLAARLQEAEEAVEAANAKCASLEKTKHRLQNELEDMMIDLERSNAAAAAMDKKQRNFDKLIADWKQKYEETQAELETSQKDARGLSTELFKLKNAYEEVLDNLETVKRENKNLQEEISDLTDQISEGNKSLHEIEKVKKQVEQEKSEVQVALEEAENERTLLKSKETGVQVTFLNDSNKRADQKSPKKGMDNCVILRRNLQRIIESLQCTIYCDLNGLFTVDFLSKKRCEKDTSTLESTGYIISHEQLSQKQSTSMYSLQFYQDLQVQYDDYIHLSEDLKEQAAVIERRNTLLQSELDELRAALDQTERARKLSEQELLESTERVNLLHSQNTSLINQKKKLETDISHMQNEVEESIQECRNAEDKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQKRLDEAEQIAMKGGKKQIQKLESRVRELENELESEQRRNSESLKGFRKFERRIKELTYQGEEDKKNLIRMQDLIDKLQLKVKSYKHQAEEASEQSNQYLSKYKKLQHELDDAQERADIAESQVNKLRSKTR 1925          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh6 (myosin, heavy polypeptide 6, cardiac muscle, alpha [Source:MGI Symbol;Acc:MGI:97255])

HSP 1 Score: 1793.09 bits (4643), Expect = 0.000e+0
Identity = 1052/1921 (54.76%), Postives = 1415/1921 (73.66%), Query Frame = 3
Query:  108 QYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAA---TKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG-------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            QYL    K  ++     FD +  C++PD+KE ++ A +    G   T +T+  +T T+K+D++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA    +KKE  +       KGTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ERNYHIFYQILSN      + LL++ +P  Y+F++QGE+++  +DD EE+  TD AFD+L F+AEEK  ++K T +I++ G MKFKQ+ REEQAE DGT +A+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV YS+GALAKS+Y +MF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASDMTFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+ GWLEKNKDPLNETV+ L   S   L+++LF+      +TG        +KKG + QT+S+ HRE+LNKLM NL++T PHF+RCI+PNE K PGV+D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++   K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG LMR ++KK+ ++R AL +IQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  ++K+  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+L DAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L AEE+KV  L K+K KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K +LEE+LK+KE ++   +SKIEDE  L  QLQ+K+KE QARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + KLEEA R +ND      K Q  N EL  +LEE E+ I+QL + K     Q+E+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+GEGG++VHE++K RK+LE+EK ELQ ALEEAE +LE EE K  R+QLE +QI+ EI+R+LAEK+EE E  + NH R ++S++ SL+AE+R R EA ++KKK+E D+ E+E+ +  ANRI SE +K+ K  Q  +++    ++D  H  D ++E   + ER+  ++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K+E+DL  +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   14 QYLRKSEKERLEAQTRPFDIRTECFVPDDKEEYVKAKVVSREGGKVTAETENGKTVTIKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRSKKENPNAN-----KGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLDMLLVTNNPYDYAFVSQGEVSVASIDDSEELLATDSAFDVLSFTAEEKAGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYYSIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDMTFKAKLYDNHLGKSNNF-QKPRNVKGKQEAHFSLVHYAGTVDYNIMGWLEKNKDPLNETVVGLYQKSSLKLMATLFSTYASA-DTGDSGKGKGGKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMANMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDISQQNSKIEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSSRHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKIRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSQANRIASEAQKHLKNSQAHLKDTQLQLDDAVHANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLMRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1927          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh7 (myosin, heavy polypeptide 7, cardiac muscle, beta [Source:MGI Symbol;Acc:MGI:2155600])

HSP 1 Score: 1787.7 bits (4629), Expect = 0.000e+0
Identity = 1049/1899 (55.24%), Postives = 1408/1899 (74.14%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF---APAEDPNN--TGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            FD KK+ ++PD+KE F+ A I    G   T +T+  +T TVK+D++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA   + + D   G   KGTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      + LLI+ +P  Y+FI+QGE T+  +DD EE+  TD AFD+LGF+ EEK S++K T +I++ G MKFKQ+ REEQAE DGT EA+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQN  QV Y++GALAKS+Y +MF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+DMTFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+ GWL+KNKDPLNETV+ L   S   L+S+LF   A A+ P +   GK KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K PGV+D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++   K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG L R ++KKL ++R +L IIQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  ++K+  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+LADAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELK+D+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K++L+E+LK+K+ EL   +++IEDE  L +QLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + K EE  R +ND  +   K Q  N EL  +L+E E+ I+QL + K     QLE+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+G  G+S+HE++K RK+LE EK ELQ ALEEAE +LE EE K  R+QLE +QI+ EI+R+LAEK+EE E  + NH R ++S++ SL+AE+R R EA ++KKK+E D+ E+E+ +  ANR+ +E +K  K  Q  +++    ++D     D ++E   + ER+  ++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K++ADL+ +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   31 FDLKKDVFVPDDKEEFVKAKIVSREGGKVTAETENGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQTPG---KGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDSEELMATDSAFDVLGFTPEEKNSIYKLTGAIMHFGNMKFKQKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVSYAIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNF-QKPRNVKGKQEAHFSLVHYAGTVDYNILGWLQKNKDPLNETVVGLYQKSSLKLLSNLFANYAGADAPADKGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMATMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIVKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSTGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1925          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh7 (myosin, heavy polypeptide 7, cardiac muscle, beta [Source:MGI Symbol;Acc:MGI:2155600])

HSP 1 Score: 1787.7 bits (4629), Expect = 0.000e+0
Identity = 1049/1899 (55.24%), Postives = 1408/1899 (74.14%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF---APAEDPNN--TGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            FD KK+ ++PD+KE F+ A I    G   T +T+  +T TVK+D++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA   + + D   G   KGTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      + LLI+ +P  Y+FI+QGE T+  +DD EE+  TD AFD+LGF+ EEK S++K T +I++ G MKFKQ+ REEQAE DGT EA+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQN  QV Y++GALAKS+Y +MF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+DMTFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+ GWL+KNKDPLNETV+ L   S   L+S+LF   A A+ P +   GK KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K PGV+D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++   K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG L R ++KKL ++R +L IIQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  ++K+  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+LADAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELK+D+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K++L+E+LK+K+ EL   +++IEDE  L +QLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + K EE  R +ND  +   K Q  N EL  +L+E E+ I+QL + K     QLE+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+G  G+S+HE++K RK+LE EK ELQ ALEEAE +LE EE K  R+QLE +QI+ EI+R+LAEK+EE E  + NH R ++S++ SL+AE+R R EA ++KKK+E D+ E+E+ +  ANR+ +E +K  K  Q  +++    ++D     D ++E   + ER+  ++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K++ADL+ +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   31 FDLKKDVFVPDDKEEFVKAKIVSREGGKVTAETENGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQTPG---KGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDSEELMATDSAFDVLGFTPEEKNSIYKLTGAIMHFGNMKFKQKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVSYAIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNF-QKPRNVKGKQEAHFSLVHYAGTVDYNILGWLQKNKDPLNETVVGLYQKSSLKLLSNLFANYAGADAPADKGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMATMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIVKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSTGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1925          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh4 (myosin, heavy polypeptide 4, skeletal muscle [Source:MGI Symbol;Acc:MGI:1339713])

HSP 1 Score: 1765.74 bits (4572), Expect = 0.000e+0
Identity = 1019/1916 (53.18%), Postives = 1407/1916 (73.43%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDP------NNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            YL    K  ++     FD+K + ++ D KE+++ AT++   G   T KT+   T TVK D++  MNPPK+  IEDMA +T L++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y P+V++ Y+GK+R E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +A    K++++  +G K +GTLEDQI+ ANP+LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ER+YHIFYQI+SN      E LLI+ +P  +++++QGE+T+  +DD+EE+  TD A DILGFSA+EK++++K T ++++ G MKFKQ+ REEQAE DGT  A+K A+L  +N+ DL++++  P+VKVGNEYVTKGQ   QV  SVGALAKS+Y +MF W+V R+N+ LDTK  RQ+FIGVLDIAGFEIF+FN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE IDWEFIDFGMDL ACIELIEKPMGI SILEEECMFPKA+D +FK KLY+ HLGKS NF +   P  G+AEAHF L HYAG+V YN+ GWL+KNKDPLNETV+ L   S    ++ LF+  +           G +KKG + QT+S+  RE+LNKLM NL+ST PHF+RC++PNE K PG ++  LVLHQL CNGVLEGIRICRKGFP+R++Y++FKQRY +L  +AIP+G F++ K+ + K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRDEKL+ LI+  QA  RGYLMR ++KK+ ++R ++  IQ N+R ++ ++ WPW KLY K+KPLL  A  E+EM    E+  K KE+  K +  +KELEE+ V L++ KNDL LQ+Q E D LADAEE+  +L+  K  +E +IKEL +   +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK  QE+  D+E  K++L+E+LK+KE E+ N  SKIEDE  L  QLQ+KIKELQARI+ELEE++EAER +RAKAEK R  L  ELEE+S+RLEE GGATSAQ+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E+K +++DL   +E+++KAK N +K  + +E Q SE++ K EE  R IN+ +    +    + E   +L+E ++ ++QL + KQ    Q+EE ++  EEES+AK  L+  +++   D D LRE  EEE E K+++QR + KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   SK   LEK K RLQ E+ED+++DV+R+N   + L+KKQ+ FDKV++EW+QKY E+QAELEASQ+ESR++S E+F++K   EES +QLE++KRENKNL  EI DLTEQI EGG+ +HE++K +K+++ EK ELQ +LEEAE +LE EE K  R QLE++Q++ EIDR++AEK+EE +  + NH R +ESM+++L+AE R R +A ++KKK+E D+ E+E+ ++ ANR  +E  +N +  Q  +++    ++D    +D ++EQ  M ER+  ++ AE+EE+R SLE +ER+R+  E E ++ ++R+  L  Q++  + TK+KLE D++ +Q ++E+   EAR A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK + KLE RVRELE E++ EQKR++E+ K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKRQ EEAEE + VNLAK+RKIQ E+E++EERAD AE  + KLR K+R
Sbjct:   16 YLRKSEKERIEAQNKPFDAKSSVFVVDAKESYVKATVQSREGGKVTAKTEGGATVTVKDDQVFSMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGDKKKEEATSG-KMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKKPELIEMLLITTNPYDFAYVSQGEITVPSIDDQEELMATDTAVDILGFSADEKVAIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLTSLNSADLLKALCYPRVKVGNEYVTKGQTVQQVYNSVGALAKSMYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNTLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIDWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYEQHLGKSNNF-QKPKPAKGKAEAHFSLVHYAGTVDYNIIGWLDKNKDPLNETVVGLYQKSGLKTLAFLFSGGQAAEAEGGGGKKGGKKKGSSFQTVSALFRENLNKLMTNLKSTHPHFVRCLIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGTLEEMRDEKLAQLITRTQAVCRGYLMRVEFKKMMERRESIFCIQYNVRAFMNVKHWPWMKLYFKIKPLLKSAETEKEMANMKEDFEKAKEDLAKSEAKRKELEEKMVALMQEKNDLQLQVQAEADGLADAEERCDQLIKTKIQLEAKIKELTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDENIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALGMQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMETVSKAKGNLEKMCRTLEDQLSEVKTKEEEQQRLINELSTQKARLHTESGEFSRQLDEKDAMVSQLSRGKQAFTQQIEELKRQLEEESKAKNALAHALQSARHDCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNSKCASLEKTKQRLQNEVEDLMIDVERSNAACAALDKKQRNFDKVLAEWKQKYEETQAELEASQKESRSLSTELFKVKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKHIHELEKIKKQIDQEKSELQASLEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHLRVVESMQSTLDAEIRSRNDALRIKKKMEGDLNEMEIQLNHANRQAAEAIRNLRNTQGMLKDTQLHLDDALRGQDDLKEQLAMVERRANLMQAEIEELRASLEQTERSRRVAEQELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEMEDIVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELENEVENEQKRNIEAVKGLRKHERRVKELTYQTEEDRKNVLRLQDLVDKLQTKVKAYKRQAEEAEEQSNVNLAKFRKIQHELEEAEERADIAESQVNKLRVKSR 1929          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh4 (myosin, heavy polypeptide 4, skeletal muscle [Source:MGI Symbol;Acc:MGI:1339713])

HSP 1 Score: 1765.74 bits (4572), Expect = 0.000e+0
Identity = 1019/1916 (53.18%), Postives = 1407/1916 (73.43%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDP------NNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            YL    K  ++     FD+K + ++ D KE+++ AT++   G   T KT+   T TVK D++  MNPPK+  IEDMA +T L++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y P+V++ Y+GK+R E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +A    K++++  +G K +GTLEDQI+ ANP+LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ER+YHIFYQI+SN      E LLI+ +P  +++++QGE+T+  +DD+EE+  TD A DILGFSA+EK++++K T ++++ G MKFKQ+ REEQAE DGT  A+K A+L  +N+ DL++++  P+VKVGNEYVTKGQ   QV  SVGALAKS+Y +MF W+V R+N+ LDTK  RQ+FIGVLDIAGFEIF+FN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE IDWEFIDFGMDL ACIELIEKPMGI SILEEECMFPKA+D +FK KLY+ HLGKS NF +   P  G+AEAHF L HYAG+V YN+ GWL+KNKDPLNETV+ L   S    ++ LF+  +           G +KKG + QT+S+  RE+LNKLM NL+ST PHF+RC++PNE K PG ++  LVLHQL CNGVLEGIRICRKGFP+R++Y++FKQRY +L  +AIP+G F++ K+ + K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRDEKL+ LI+  QA  RGYLMR ++KK+ ++R ++  IQ N+R ++ ++ WPW KLY K+KPLL  A  E+EM    E+  K KE+  K +  +KELEE+ V L++ KNDL LQ+Q E D LADAEE+  +L+  K  +E +IKEL +   +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK  QE+  D+E  K++L+E+LK+KE E+ N  SKIEDE  L  QLQ+KIKELQARI+ELEE++EAER +RAKAEK R  L  ELEE+S+RLEE GGATSAQ+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E+K +++DL   +E+++KAK N +K  + +E Q SE++ K EE  R IN+ +    +    + E   +L+E ++ ++QL + KQ    Q+EE ++  EEES+AK  L+  +++   D D LRE  EEE E K+++QR + KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   SK   LEK K RLQ E+ED+++DV+R+N   + L+KKQ+ FDKV++EW+QKY E+QAELEASQ+ESR++S E+F++K   EES +QLE++KRENKNL  EI DLTEQI EGG+ +HE++K +K+++ EK ELQ +LEEAE +LE EE K  R QLE++Q++ EIDR++AEK+EE +  + NH R +ESM+++L+AE R R +A ++KKK+E D+ E+E+ ++ ANR  +E  +N +  Q  +++    ++D    +D ++EQ  M ER+  ++ AE+EE+R SLE +ER+R+  E E ++ ++R+  L  Q++  + TK+KLE D++ +Q ++E+   EAR A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK + KLE RVRELE E++ EQKR++E+ K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKRQ EEAEE + VNLAK+RKIQ E+E++EERAD AE  + KLR K+R
Sbjct:   16 YLRKSEKERIEAQNKPFDAKSSVFVVDAKESYVKATVQSREGGKVTAKTEGGATVTVKDDQVFSMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGDKKKEEATSG-KMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKKPELIEMLLITTNPYDFAYVSQGEITVPSIDDQEELMATDTAVDILGFSADEKVAIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLTSLNSADLLKALCYPRVKVGNEYVTKGQTVQQVYNSVGALAKSMYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNTLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIDWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYEQHLGKSNNF-QKPKPAKGKAEAHFSLVHYAGTVDYNIIGWLDKNKDPLNETVVGLYQKSGLKTLAFLFSGGQAAEAEGGGGKKGGKKKGSSFQTVSALFRENLNKLMTNLKSTHPHFVRCLIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGTLEEMRDEKLAQLITRTQAVCRGYLMRVEFKKMMERRESIFCIQYNVRAFMNVKHWPWMKLYFKIKPLLKSAETEKEMANMKEDFEKAKEDLAKSEAKRKELEEKMVALMQEKNDLQLQVQAEADGLADAEERCDQLIKTKIQLEAKIKELTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDENIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALGMQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMETVSKAKGNLEKMCRTLEDQLSEVKTKEEEQQRLINELSTQKARLHTESGEFSRQLDEKDAMVSQLSRGKQAFTQQIEELKRQLEEESKAKNALAHALQSARHDCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNSKCASLEKTKQRLQNEVEDLMIDVERSNAACAALDKKQRNFDKVLAEWKQKYEETQAELEASQKESRSLSTELFKVKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKHIHELEKIKKQIDQEKSELQASLEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHLRVVESMQSTLDAEIRSRNDALRIKKKMEGDLNEMEIQLNHANRQAAEAIRNLRNTQGMLKDTQLHLDDALRGQDDLKEQLAMVERRANLMQAEIEELRASLEQTERSRRVAEQELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEMEDIVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELENEVENEQKRNIEAVKGLRKHERRVKELTYQTEEDRKNVLRLQDLVDKLQTKVKAYKRQAEEAEEQSNVNLAKFRKIQHELEEAEERADIAESQVNKLRVKSR 1929          
BLAST of Myosin heavy chain vs. UniProt
Match: sp|P24733|MYS_ARGIR (Myosin heavy chain, striated muscle OS=Argopecten irradians PE=1 SV=1)

HSP 1 Score: 2240.69 bits (5805), Expect = 0.000e+0
Identity = 1242/1921 (64.65%), Postives = 1556/1921 (81.00%), Query Frame = 3
Query:   81 NMNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVK-TDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXX-XXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDP--NNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTK 5831
            N++ SDPDFQYL VDRK LMK+   +FD KKNCW+PDEKE F +A I+ + GD  TVK    S T+TVKKD+I+ MNPPKF  +EDMAN+T+LN+ASVL NLR RY   LIYTYSGLFC+ +NPY+R PIYT  VI+KY+GKR+TE+PPH+FS++DNAY NM+ DR+NQS LITGESGAGKTENTKKVI Y A VA A KK+  D     K++G+LEDQI+QANPVLEAYGNAKT RNNNSSRFGKFIRIHFG +GKIAGADIE YLLEKSRV  QQ  ERNYHIFYQI SN     ++ +L++PD  LYSFINQG LT+D +DD EE K+ DEAFDILGF+ EEK S+FKCT SIL+MGEMKFKQRPREEQAE+DGTAEAEKVAFL G+NA DL++++LKPKVKVG E VTKGQN +QV+ SVGALAKSLY+RMF WLV RVNKTLDTK KR ++IGVLDIAGFEIF+FN FEQ+CINYTNERLQQFFNHHMF+LEQEEYKKE I WEFIDFGMDLQ CI+LIEKPMGILSILEEECMFPKA D +F+ KLY NH+GK+  F KP KP +P Q  AHFELHHYAG+VPY++TGWLEKNKDP+NE V+ LL ASKE LV+ LF   E+P      K+ K  A QTIS+ HRESLNKLMKNL ST PHF+RCI+PNE KQPG++DA LVLHQL CNGVLEGIRICRKGFP+R+IYSEFKQRYSILAPNAIPQGFV+GK V+ KIL  +Q+D   YRLG TKVFFKAG L +LE+MRDE+LS +IS+FQA IRGYL+R+ YKKLQDQR+ LS+IQRNIRK+L+LR W WWKLY+KVKPLL+IARQEEEMK+  +++ K+KE+  K ++ KKELEEQNV LLE KNDLFLQLQT +DS+ D EE+V KL+MQKAD E +IKELE+ LL+EED AA LE IKKKM+ +   LKKD+ DLE++LQKAEQ+K  KD QI +LQ ++++Q+E + KL KEKKA +E  KKT +SL AEE+K  +LNK KAKLEQ +DE+E+NL RE+K+R DVEK KRK+E +LK TQE V+DLERVKRELEE ++RKE E+ + +SK+EDE  LV+QLQRKIKELQARI+ELEE+LEAER ARAK EK R +L  ELEEL +RL+E GGATSAQ++LNKKREAEL+K++RDLEE+++QH+  I+  RKK QD  NE ++Q+DQLQKVK+K+EK+K ++K +++DL+ Q+    K K  S+K +K+ E+Q S+L  +LE++ R IN+  +   + Q  N++L  +LE+AE +++ L K K Q+ +QLE+AR+  EEE+RA++KL ++VRN++AD+D +RE LEEE E+KSD+QRQL KA  E+QQ ++KFE  G+ R+EEL++ KRK + ++ E E+  E A +K   LEK K+RLQ E+EDM ++VDRAN   +Q+EKKQ+ FDK  +EWQ K    Q+ELE SQ+ESR  SAE++R+KA IEE Q+ + +++RENKNLADEIHDLT+Q+ EGGRS HE+DKAR+RLEMEKEELQ ALEEAE ALEQEEAK  R+QLE++ +R EID+R+ EKEEEF+ TR NHQRA+ESM+ASLEAE++G+A+A ++KKKLE DI ELEVA+D +NR ++E EK  K++QQQ++E+ + +E+E+ Q+D+ RE   M ER+ T++  E+EE+R +LE +ER RK ++NE  +  DR+NEL+ Q S     KRKLE D+ AMQ+DL+E   E + A+E+ KKA+AD+ARL DE+R EQ+H+ Q++K++K LE+Q KE Q +LDE+E ++LKGGKK + KLE RV ELEAELD EQ+RH E+QKN RK +RRLKEL  Q DED+KNQERLQ+L++KL  KIKT+KRQVEEAEEIAA+NLAKYRK Q E+E++EERAD A+  LQK R K
Sbjct:    2 NIDFSDPDFQYLAVDRKKLMKEQTAAFDGKKNCWVPDEKEGFASAEIQSSKGDEITVKIVADSSTRTVKKDDIQSMNPPKFEKLEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAYQNMVTDRENQSCLITGESGAGKTENTKKVIMYLAKVACAVKKK--DEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVMLVTPDSGLYSFINQGCLTVDNIDDVEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGEMKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLKPKVKVGTEMVTKGQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCINYTNERLQQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFPKADDKSFQDKLYQNHMGKNRMFTKPGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKDPINENVVALLGASKEPLVAELFKAPEEPAGGGKKKKGKSSAFQTISAVHRESLNKLMKNLYSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFKQRYSILAPNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKKLQDQRIGLSVIQRNIRKWLVLRNWQWWKLYSKVKPLLSIARQEEEMKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFLQLQTLEDSMGDQEERVEKLIMQKADFESQIKELEERLLDEEDAAADLEGIKKKMEADNANLKKDIGDLENTLQKAEQDKAHKDNQISTLQGEISQQDEHIGKLNKEKKALEEANKKTSDSLQAEEDKCNHLNKLKAKLEQALDELEDNLEREKKVRGDVEKAKRKVEQDLKSTQENVEDLERVKRELEENVRRKEAEISSLNSKLEDEQNLVSQLQRKIKELQARIEELEEELEAERNARAKVEKQRAELNRELEELGERLDEAGGATSAQIELNKKREAELLKIRRDLEEASLQHEAQISALRKKHQDAANEMADQVDQLQKVKSKLEKDKKDLKREMDDLESQMTHNMKNKGCSEKVMKQFESQMSDLNARLEDSQRSINELQSQKSRLQAENSDLTRQLEDAEHRVSVLSKEKSQLSSQLEDARRSLEEETRARSKLQNEVRNMHADMDAIREQLEEEQESKSDVQRQLSKANNEIQQWRSKFESEGANRTEELEDQKRKLLGKLSEAEQTTEAANAKCSALEKAKSRLQQELEDMSIEVDRANASVNQMEKKQRAFDKTTAEWQAKVNSLQSELENSQKESRGYSAELYRIKASIEEYQDSIGALRRENKNLADEIHDLTDQLSEGGRSTHELDKARRRLEMEKEELQAALEEAEGALEQEEAKVMRAQLEIATVRNEIDKRIQEKEEEFDNTRRNHQRALESMQASLEAEAKGKADAMRIKKKLEQDINELEVALDASNRGKAEMEKTVKRYQQQIREMQTSIEEEQRQRDEARESYNMAERRCTLMSGEVEELRAALEQAERARKASDNELADANDRVNELTSQVSSVQGQKRKLEGDINAMQTDLDEMHGELKGADERCKKAMADAARLADELRAEQDHSNQVEKVRKNLESQVKEFQIRLDEAEASSLKGGKKMIQKLESRVHELEAELDNEQRRHAETQKNMRKADRRLKELAFQADEDRKNQERLQELIDKLNAKIKTFKRQVEEAEEIAAINLAKYRKAQHELEEAEERADTADSTLQKFRAK 1920          
BLAST of Myosin heavy chain vs. UniProt
Match: sp|F1PT61|MYH16_CANLF (Myosin-16 OS=Canis lupus familiaris GN=MYH16 PE=3 SV=2)

HSP 1 Score: 1866.28 bits (4833), Expect = 0.000e+0
Identity = 1063/1914 (55.54%), Postives = 1442/1914 (75.34%), Query Frame = 3
Query:   96 DPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            DP   +L    K  ++     +D KK+CW+ DEKE FIA  I+   GD  TVKT  ++T TVKKD+++QMNPPKF    DMA++TFLN+ASVL+NLRQRY    IYTYSGLFCVT+NPYK  PIY  +V + YKGK+RTEMPPH+FSISDNAY +ML +R+NQS+LITGESGAGKTENTKKVI YFA+V    K+  D  G GQ   G+LEDQI+QANPVLEA+GNAKT+RNNNSSRFGKFIRIHFGT+GK+AGADIE YLLEKSRV SQQ  ER YHIFYQILSN      E LL+ P+P  Y +++QG   ++ +DD EE++ITD AFD+LGFSAEEK+ ++K T  I++ G MKFKQ+PREEQAE D T  A+KV+ L+G+N+ +L + I +P+VKVGNE+V KGQN +Q   S+GAL K++Y++MF WLV+R+NKTLDTK++RQFFIGVLDIAGFEIF FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYK+E I+W FIDFG+DLQACI+L+EKPMGI SILEE+C+FPKA+D TFKA LYDNHLGKS NF KPK  K    EAHFEL HYAG+V YN+TGWLEKNKDPLNETV+ L   S   L++ LF   E P  + K+K+G +  T+S+ +RE LNKLM  L ST+PHF+RCIVPNEFKQ GV+DAHL++HQL CNGVLEGIRICRKGFPNRM Y EFKQRY +L PN IPQGFV+ K+ +  +L ++ LD N Y++G+TKVFF+AG LA LEDMRDE+L+ ++++ Q ++RG+LMR ++KK+ ++R+ L +IQRN RK+L LR W WWKLY KVKPLLN+ARQEEEMK   EEL     + +++    KELEE+   L + KNDL +QLQ EQ+++ DAEE++++++  K D+E +I ++ + L EEE  AA L   K+K++GE+ +LK+D+  LE++L K E+EK A D ++++L   ++ +E+ + KL+KEK+A +E+ +KT + L AEE+KV +L K  +KL   I E+E+N  +E+KIRA+VEK +RK E++LK T + ++D+ER K +LEE +K+++ME+ + +SK EDE  L + LQRK+KE QARI+ELEE+LEAER  RAK EK R  L  +LE+LSDRLEE GGATSAQ++ N+KREAEL+KL+R+LEE+ +Q +   +  RKK  D + E +E ++ LQ+VK+K+EK+K  MK +++DL   +E++ K+K N++  I+++E   SE   K+ E  R+  + N    + Q  N EL    EE++S++NQ+ ++K  + +Q+++ ++  +EES++++     + N   DLD ++E LEEE   KS++QR + K   E+   + K+E     R+EEL+E KRK   R+ E EE AE A+++A  LEK K RLQ E+ED+ +D+++AN  A+ L+KKQ+ FDK+++EWQQK  E Q E+++SQ+E R    E F++K   EES E LESVK+ENK L +EI +L +Q+GEGGRSVHE+ K +K+LE+EKEELQ ALEEAE +LE EE+K  R QLE++Q++ +IDRR+ EKEEEFEATR NHQRA+ES++ASLEAE++GRAEA ++KKK+E D+ E+E+ +D AN+  SE  K  K+ QQQ+++L   ++++  Q +++REQ  + ER+L+++  ELEEVR  LE SER+RK  E E +EIT+R NE+++Q+   +  KRKLE+D+  + S+ EE  +E R A+E+AKKA+ D+AR+ +E+RQEQ+H   ++KIKK  E   K+LQAK++E+E  ALKGGK+ + KLE R++ELE ELDGEQK+HVE+ K  RK ERRLKEL  QT+ED K  +R+Q+LVEKLQ K+K YKRQ+EEAEE A   LA+YRK   E++D+EERA  AE AL KLRT++R
Sbjct:   14 DP-MPFLAPPEKERIEAMNKPYDIKKSCWVKDEKEGFIAGEIQSEQGDQVTVKTVNNQTVTVKKDDVQQMNPPKFYQASDMADMTFLNEASVLNNLRQRYTNMRIYTYSGLFCVTVNPYKWLPIYGARVANMYKGKKRTEMPPHLFSISDNAYHDMLMNRENQSMLITGESGAGKTENTKKVIQYFANVGGTGKQSSD--GKGQ---GSLEDQIIQANPVLEAFGNAKTIRNNNSSRFGKFIRIHFGTTGKLAGADIESYLLEKSRVISQQAAERGYHIFYQILSNKKPELIESLLLVPNPKEYHWVSQGVTVVENMDDGEELQITDVAFDVLGFSAEEKIGIYKLTGGIMHFGNMKFKQKPREEQAEVDTTEVADKVSHLMGLNSGELQKGITRPRVKVGNEFVQKGQNVEQCNNSIGALGKAIYDKMFKWLVVRINKTLDTKMQRQFFIGVLDIAGFEIFEFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKREGIEWVFIDFGLDLQACIDLLEKPMGIFSILEEQCVFPKATDATFKAALYDNHLGKSNNFLKPKGGKGKGPEAHFELVHYAGTVAYNITGWLEKNKDPLNETVVGLFQKSSLGLLALLFKEEEAPAGSKKQKRGSSFMTVSNFYREQLNKLMATLHSTAPHFVRCIVPNEFKQSGVVDAHLIMHQLACNGVLEGIRICRKGFPNRMQYPEFKQRYQVLNPNVIPQGFVDNKKASELLLGSIDLDVNEYKIGHTKVFFRAGILAKLEDMRDERLAKIMTMLQCRLRGFLMRIEFKKMLERRIGLKVIQRNTRKFLELRFWGWWKLYNKVKPLLNVARQEEEMKAKEEELRNAMSKTQELLSRVKELEEKMATLSQEKNDLTIQLQAEQENVIDAEERLTQMMKTKMDLESQISDMRERLEEEEGTAASLSATKRKLEGEMSDLKRDLEGLETTLAKTEKEKQALDHRVRTLTGDLSLREDSIAKLQKEKRALEELHQKTLDDLQAEEDKVNHLTKTNSKLSTQIHELEDNWEQEKKIRAEVEKARRKAESDLKMTIDNLNDMERSKLDLEEVVKKRDMEINSVNSKYEDEQSLNSTLQRKLKEHQARIEELEEELEAERSMRAKVEKQRSDLSRDLEDLSDRLEEAGGATSAQIEQNRKREAELLKLRRELEEAALQSEAAASTLRKKHTDSMAELTEHVENLQRVKSKLEKDKQVMKAEIDDLNASMETVQKSKMNAEAHIRKLEDSLSEANAKVAELERNQAEINAVRTRLQAENGELSREYEESQSRLNQILRIKTSLTSQVDDYKRQLDEESKSRSAAMVSLANTKHDLDLVKEQLEEEQGGKSELQRLVSKLNTEVTTWRTKYETDAIQRTEELEETKRKLAARLQEAEETAEAAQARAASLEKNKQRLQAEVEDLTIDLEKANAAAAALDKKQRVFDKMLAEWQQKCEELQVEVDSSQKECRMYMTESFKIKTAYEESLEHLESVKKENKTLQEEIKELIDQLGEGGRSVHELQKLKKKLEIEKEELQVALEEAESSLEVEESKVIRIQLELAQVKADIDRRIHEKEEEFEATRKNHQRAIESLQASLEAEAKGRAEALRLKKKMETDLNEMEIQLDHANKNNSELVKTLKRLQQQIKDLQVQMDEDARQHEELREQYNLQERRLSLLQTELEEVRSGLEGSERSRKLLEQEVVEITERHNEVNIQNQSLLVVKRKLESDVQRISSEHEELISEFRSADERAKKAMTDAARMAEELRQEQDHCMHLEKIKKNYEITIKDLQAKMEEAEQLALKGGKRTIMKLEARIKELETELDGEQKQHVETVKTLRKNERRLKELVFQTEEDHKTNQRMQELVEKLQNKLKVYKRQIEEAEEQANQTLARYRKTVHELDDAEERAGMAETALNKLRTRHR 1921          
BLAST of Myosin heavy chain vs. UniProt
Match: sp|P05661|MYSA_DROME (Myosin heavy chain, muscle OS=Drosophila melanogaster GN=Mhc PE=1 SV=4)

HSP 1 Score: 1854.72 bits (4803), Expect = 0.000e+0
Identity = 1104/1917 (57.59%), Postives = 1440/1917 (75.12%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKR------KKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKIL-EAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 5888
            +DSKK+CWIPDEKE ++   I+   GD+ +V     E + +K +++E++NPPKF  IEDMA++T LN   VL NLRQRYY  LIYTYSGLFCV INPYKR+P+YT +    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K +E       K KG+LEDQ+VQ NPVLEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RV SQQ  ER+YHIFYQI+S       +  L++ +   Y  ++QG++T+  +DD EE  +TD+AFDILGF+ +EK  +++ T ++++MG MKFKQR REEQAE DG  E  +V+ L G +  +L +++LKP++KVGNE+VT+G+N  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF +NGFEQ+CIN+TNE+LQQFFNH MFV+EQEEYKKE I+W+FIDFGMDL ACI+LIEKPMGILSILEEE MFPKA+D TF  KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YN+TGWLEKNKDPLN+TV++    S+  L+  +FA     +  G++      KKGG   T+SS ++E LN LM  L+ST PHF+RCI+PNE KQPGV+DAHLV+HQL CNGVLEGIRICRKGFPNRM+Y +FK RY IL P  I    ++  +  SK+L E+ +L+ +LYRLG+TKVFF+AG L  +E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTWPW+KL+ KVKPLLN++R E+E+ +  E+  K +E      K +KELE  N KLL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L +EED    L   KKK   EI  LKKD+ DLE ++QKAEQ+K  KD QI++L D++A Q+E +NKL KEKK   E  +KT E L A E+K+ +LNK KAKLEQT+DE+E++L RE+K+R DVEK KRK+E +LK TQE V DLER K+ELE+ ++RK+ EL + ++K+EDE  +V + QR+IKELQARI+ELEE++EAERQARAKAEK R  L  ELEEL +RLEE GGATSAQ++LNKKREAEL KL+RDLEE+N+QH+  +A  RKK  D V E +EQ+DQL K+KAK E ++     +LN  +   + L + KA  +K  K+++   +E+Q KL+E NR +ND + +  K    N++L  +LEEAESQ++QL K+K  + TQLE+ +++A+EESR +A L    RNL  DLDNLRE +EEE E K+D+QRQL KA  E Q  ++K+E  G  RSEEL+EAKRK   R+ E EE  E+   K   LEK K RL  E+ED+ ++VDRAN +A+  EKKQK FDK++ EW+ K  +  AEL+ASQ+E R  S E+FR+K   EE QEQLE+V+RENKNLADE+ DL +QIGEGGR++HEI+KARKRLE EK+ELQ ALEEAE ALEQEE K  R+QLE+SQ+RQEIDRR+ EKEEEFE TR NHQRA++SM+ASLEAE++G+AEA +MKKKLE DI ELE+A+D AN+  +E +KN K++QQQ++++ + +E+E+  +D  REQ  ++ER+   +  ELEE R  LE ++R R+  E E  +  ++LNE+S Q++   A KRKLE++L  + SDL+E   EA+ + E+AKKA+ D+ARL DE+R EQ+HAQ  +K++K LE Q KELQ +LDE+E NALKGGKKA+ KLEQRVRELE ELDGEQ+RH ++QKN RK ERR+KEL  Q++ED+KN ER+QDLV+KLQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K R K R+  S  RG S AP  T+
Sbjct:   32 YDSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGEVRDIKSEKVEKVNPPKFEKIEDMADMTVLNTPCVLHNLRQRYYAKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDE-----AAKSKGSLEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHIMFVMEQEEYKKEGINWDFIDFGMDLLACIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYQILNPRGIKD--LDCPKKASKVLIESTELNEDLYRLGHTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEHDRQTCHNELNQTRTACDQLGRDKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAG-SVGRGASPAPRATS 1940          
BLAST of Myosin heavy chain vs. UniProt
Match: sp|P02563|MYH6_RAT (Myosin-6 OS=Rattus norvegicus GN=Myh6 PE=1 SV=2)

HSP 1 Score: 1796.17 bits (4651), Expect = 0.000e+0
Identity = 1052/1918 (54.85%), Postives = 1414/1918 (73.72%), Query Frame = 3
Query:  108 QYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG-------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            +YL    K  ++     FD +  C++PD+KE ++ A I    G   T +T+  +T TVK+D++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA   + + D     K  GTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ERNYHIFYQILSN      + LL++ +P  Y+F++QGE+++  +DD EE+  TD AFD+LGF+AEEK  ++K T +I++ G MKFKQ+ REEQAE DGT +A+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV YS+GALAKS+Y +MF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+DMTFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+ GWLEKNKDPLNETV+ L   S   L+++LF+      +TG        +KKG + QT+S+ HRE+LNKLM NL++T PHF+RCI+PNE K PGV+D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++  +   K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG LMR ++KK+ ++R AL +IQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  ++K+  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+LADAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L AEE+KV  L K+K KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K +LEE+LK+KE ++   +SKIEDE  L  QLQ+K+KE QARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + KLEEA R +ND      K Q  N EL  +LEE E+ I QL + K     Q+E+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+GEGG++VHE++K RK+LE+EK ELQ ALEEAE +LE EE K  R+QLE +QI+ EI+R+LAEK+EE E  + NH R ++S++ SL+AE+R R EA ++KKK+E D+ E+E+ +  ANRI SE +K+ K  Q  +++    ++D     D ++E   + ER+ T++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K++ADL+ +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   13 RYLRKSEKERLEAQTRPFDIRTECFVPDDKEEYVKAKIVSREGGKVTAETENGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRSKKDNPNANK--GTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLDMLLVTNNPYDYAFVSQGEVSVASIDDSEELLATDSAFDVLGFTAEEKAGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYYSIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNF-QKPRNVKGKQEAHFSLVHYAGTVDYNILGWLEKNKDPLNETVVGLYQKSSLKLMATLFSTYASA-DTGDSGKGKGGKKKGSSFQTVSALHRENLNKLMTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSGKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQARGQLMRIEFKKMVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMANMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDISQQNSKIEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLTRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSHMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALIWQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSARHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKIRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSQANRIASEAQKHLKNAQAHLKDTQLQLDDAVRANDDLKENIAIVERRNTLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLVRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1926          
BLAST of Myosin heavy chain vs. UniProt
Match: sp|Q9BE39|MYH7_BOVIN (Myosin-7 OS=Bos taurus GN=MYH7 PE=1 SV=1)

HSP 1 Score: 1794.25 bits (4646), Expect = 0.000e+0
Identity = 1056/1917 (55.09%), Postives = 1416/1917 (73.87%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFA-------PAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            YL    K  ++     FD KK+ ++PD+KE F+ ATI    G   T +T+  +T TVK+D++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVTINPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA   + + +  TG   KGTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      + LLI+ +P  Y+FI+QGE T+  +DD EE+  TD AFD+LGF+ EEK S++K T +I++ G MKFK + REEQAE DGT EA+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQN  QV+Y+ GALAK++Y RMF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+DMTFKAKL+DNHLGKS NF +      G+ EAHF L HYAG+V YN+ GWL+KNKDPLNETV++L   S   ++SSLFA       P E     GK KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K PGVID  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++   K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG L R ++KKL ++R +L IIQ NIR ++ ++ WPW KLY K+KPLL  A  E+E+    EE  +LKE  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+LADAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELK+D+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K++L+E+LK+K+ EL   +++IEDE  L +QLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E SEQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + K EE  R +ND  +   K Q  N EL  +L+E E+ I+QL + K     QLE+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+G  G+++HE++K RK+LE EK ELQ ALEEAE +LEQEE K  R+QLE +QI+ E++R+LAEK+EE E  + NH R ++S++ SL+AE+R R EA ++KKK+E D+ E+E+ +  ANR+ +E +K  K  Q  +++    ++D     D ++E   + ER+  ++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K+EADL+ +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   15 YLRKSEKERLEAQTRPFDLKKDVFVPDDKEEFVKATILSREGGKVTAETEHGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGLFCVTINPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKEQATG---KGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTTEEKNSMYKLTGAIMHFGNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVVYAKGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLFDNHLGKSSNF-QKPRNIKGKPEAHFSLIHYAGTVDYNIIGWLQKNKDPLNETVVDLYKKSSLKMLSSLFANYAGFDTPIE--KGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVIDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEIALMKEEFGRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKVKLEQHVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELSEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKLELQSALEEAEASLEQEEGKILRAQLEFNQIKAEMERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSHANRLAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMEADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1925          
BLAST of Myosin heavy chain vs. TrEMBL
Match: tr|O96062|O96062_DUGJA (Myosin heavy chain OS=Dugesia japonica GN=DjMHC-A PE=2 SV=1)

HSP 1 Score: 3306.15 bits (8571), Expect = 0.000e+0
Identity = 1807/1935 (93.39%), Postives = 1887/1935 (97.52%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 5888
            MNP+DPDFQYLGVDRKAL+KQYGDSFDSKKNCWIPDEKE FI+ATIED+SGDV+T+KT+K ETKTVKKDEI+QMNPPKF+MIEDMANLTFLNDASVLDNLRQR+YKNLIYTYSGLFCVTINPYKRFPIYT QVI+KYKGKRRTEMPPHIFSISDNAY+NML DRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKE+D++G+G KRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILS GGK FHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFS++EKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQ+KDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGKPKPPKPGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF PAED +++GKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVT KILEAVQLD NLYRLGNTK+FFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMR+QYKKLQDQRVALSIIQRNIRKYL+LRTW WWKLYTKVKPLLNIARQEEEMKKAAEEL KLKEEFEKVDKFKKELEEQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADME RIKELEDHLLEEED +AGLE++KKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIK+LQDQ+A+QEEEMNK+KKEKKAADE+QKKTEESL AEEEKVKNLNKAKAKLEQTIDEMEENLSREQK+RADVEKVKRKIETELKQTQETVDDLERVKRELEEQLKRKEMEL NASSKIEDESGLVAQLQ+KIKELQARIQELEEDLEAERQARAKAEKSRHQLEGELEELSDRLEEQGGATSAQ++LNKKREAEL+KLKRDLEE+NMQHDQ+IAQ+RKKQQDV NEFS+QLDQLQK KAK+EKEKNEMKEDLNDLQ QLE+LNKAKANSDK+IKE+E+QN+ELQGKLEE NRHINDANNTSGKNQQ NAELQARLEEAESQINQL KVKQQMQTQLEEARQ  ++ESR KAKLSSDVRNLNADLDNLREALEEENENKSD+QRQLVKAQ EMQQ+K+KFEG+GS+RSEELDEAKRKFM RIHELEEE+E+AKSK GQLEK+KARLQGEIEDMLVDVDRAN LASQLEKKQKTFDKVVSEWQQKYAESQAE+EASQRESR +SAEVFR+KAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHE +KARKRLEMEKEELQHALEEAEQALEQEEAK+QRSQLEMSQ+RQEIDRR+AEKEEEFEATRVNHQRAMESMEASLEAESRGR E+TKMKKKLEHDIGELEVAVDTANR RSE EKNAKKFQQQVQEL +MVEDEKHQKDQIREQT M ERK+ M+L ELEEVR SLENSERNRKNTE+EK+E+TDRLNELSVQSS FMATKRKLEADLAAMQSDLEEA+ EARQANEQAKKAVADS+RLFDEIRQEQEHAQQ+DKIKKQLEAQNKELQ KLDESENNA+KGGKK L KLEQRVRELEAELD EQKRHVE+QKN+RK+ERRLKE+GLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPG TT
Sbjct:    1 MNPTDPDFQYLGVDRKALLKQYGDSFDSKKNCWIPDEKEGFISATIEDSSGDVFTIKTEKLETKTVKKDEIQQMNPPKFMMIEDMANLTFLNDASVLDNLRQRFYKNLIYTYSGLFCVTINPYKRFPIYTAQVIAKYKGKRRTEMPPHIFSISDNAYSNMLTDRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEDDESGSGGKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSAGGKQFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSSDEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQSKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGKPKPPKPGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFVPAEDASSSGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTGKILEAVQLDKNLYRLGNTKIFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRKQYKKLQDQRVALSIIQRNIRKYLMLRTWAWWKLYTKVKPLLNIARQEEEMKKAAEELAKLKEEFEKVDKFKKELEEQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMESRIKELEDHLLEEEDASAGLEEMKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKALQDQIARQEEEMNKMKKEKKAADELQKKTEESLQAEEEKVKNLNKAKAKLEQTIDEMEENLSREQKVRADVEKVKRKIETELKQTQETVDDLERVKRELEEQLKRKEMELSNASSKIEDESGLVAQLQKKIKELQARIQELEEDLEAERQARAKAEKSRHQLEGELEELSDRLEEQGGATSAQLELNKKREAELLKLKRDLEEANMQHDQMIAQSRKKQQDVANEFSDQLDQLQKAKAKIEKEKNEMKEDLNDLQSQLEALNKAKANSDKKIKELESQNAELQGKLEELNRHINDANNTSGKNQQLNAELQARLEEAESQINQLTKVKQQMQTQLEEARQNLDDESRTKAKLSSDVRNLNADLDNLREALEEENENKSDLQRQLVKAQSEMQQMKSKFEGTGSVRSEELDEAKRKFMARIHELEEESESAKSKVGQLEKIKARLQGEIEDMLVDVDRANALASQLEKKQKTFDKVVSEWQQKYAESQAEVEASQRESRAVSAEVFRLKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHETEKARKRLEMEKEELQHALEEAEQALEQEEAKAQRSQLEMSQVRQEIDRRIAEKEEEFEATRVNHQRAMESMEASLEAESRGRTESTKMKKKLEHDIGELEVAVDTANRFRSEAEKNAKKFQQQVQELQAMVEDEKHQKDQIREQTMMNERKMAMILGELEEVRSSLENSERNRKNTESEKVELTDRLNELSVQSSSFMATKRKLEADLAAMQSDLEEASNEARQANEQAKKAVADSSRLFDEIRQEQEHAQQLDKIKKQLEAQNKELQVKLDESENNAMKGGKKVLGKLEQRVRELEAELDAEQKRHVETQKNTRKIERRLKEIGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGTTT 1935          
BLAST of Myosin heavy chain vs. TrEMBL
Match: tr|Q02456|Q02456_SCHMA (Myosin heavy chain OS=Schistosoma mansoni GN=MYH PE=2 SV=1)

HSP 1 Score: 2561.56 bits (6638), Expect = 0.000e+0
Identity = 1414/1931 (73.23%), Postives = 1649/1931 (85.40%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAP 5876
            M+PSDPDF+YLGVDRKAL+K+  + FDSK   W+ DEKE ++ A I+D +GD  TV       K VKKD+ +Q+NPPKF +IEDMANLT LNDASVL+NLR RYY+ LIYTYSGLFCV +NPYKRFPIYT QV  KYKGKRR EMPPHIFSISDNAY NML DR+NQS+LITGESGAGKTENTKKVI+YFA VAAA+KKE+DD+     +KGTLEDQIVQANPVLEAYGNAKT RNNNSSRFGKFIRIHFGT+GKIAGADIE YLLEKSRV SQ KGERNYHIFYQ+LS  G  +H+KLL+  DPALYSFINQGELTIDGVDD EEMK+ DEAF++LGF+ +EK+SLFKCT SI NMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDL+ S LKPKVKVG E+VTKGQN +QV Y+V ALAKSLYNRMF WLV RVNKTLDTKVKRQFFIGVLDIAGFEIF  NGFEQICINYTNERLQQFFNHHMFVLEQEEYK+E I W FIDFGMDLQACI+LIEKPMGILSILEEEC+ PKASD TF +KLYDNHLGKSPNF KPKPPKPG  EAHFELHHYAGSVPY +TGWLEKNKDPLN++V+ LL  SK+ LVS+LF P       GK+ KGG+  T++  HRESLNKLMKNLQSTSP FIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPN IP GFV+G+QVT KILEA QLD NLY+ GNTKVFFKAGTLA LED+RD+KL+ +ISLFQA+IRGYLMR+QYKKLQDQRVAL+++QRNIRKYL+LR WPWW+LYTKVKP+LNIARQEEEMKKAAEEL KLKEE+EK++K KKELEEQNV +L+ KNDLFLQLQTEQDSLADAEEK+SKLV+Q+ DME RIKELE+ L +EED AA L ++KKKM  EIEELKKDV DLESSLQKAEQEK  KD QI++LQ +MA+Q+E + KL K+KK  +E  K+T+E+L AEE+KV +LNK KAKLE T+DEMEENL+REQKIR DVEK KRK+E +LK TQETVDDLERVKR+LEEQL+RKE E+   S K EDE GLVAQLQRKIKELQ RIQELEEDLEAER AR+KAEKSR QLE ELEE+ DRLEEQ GAT+AQ DL KKREAELMKLKRDLE++ +Q++Q IA  RKKQ D +NE ++QLDQ  K KAK EKE+++ K +L+D   Q++S+ KAK NS+K +K +E+Q  E+  KL+EA R++N+  +T  ++ Q  +ELQ +LEEAESQ++QL K+KQQ+  QLEEAR   E+ESR KAKL+ +VRNL +DLD+LRE LEEE   K D+QRQL K QGE+QQL+++  G G +RSEE++E KRK   +I  LE EAE+AKSK GQLEK KARLQGE+ED++VDV+RAN LASQLE+KQ  F++ ++EWQ+KYA+SQAELE +QR++R  S E+FR+KAQ+EE  EQ+E ++RENKNL+DEIHDLTEQ+GEGGRSVHEIDK R+RLEMEKEELQ ALEEAE ALEQEEAK QR+QLEMSQIRQEIDRRLAEKEEEFEATR NHQRAMES +ASLEAE +G+AEA ++KKKLE DI ELEV++D ANR R+EQE+N KKFQQQV+EL S +ED++ Q+D +REQ    ER+ T++  EL+E+R +L+ +ER+RK  E E+ E +DR  E+S Q++   A KRKLEADLAAMQ+DLEEAA EA+QA+E+AKKA+ADSAR+F+EIRQEQEH Q ++K +KQLE Q KEL A+L++SE+ A+K G+KA+ KLEQRVRELE EL  EQ+RH E+QKN RKV+RR+KE+ LQ +EDKK+ +R+Q+LVEKLQGKIKTYKRQV+EAEEIAA+NLAKYRKIQ EIED+EERADQAEQALQKLR KNRSSVSTARG S AP
Sbjct:    1 MDPSDPDFKYLGVDRKALLKELAN-FDSKNVIWVEDEKEGYVLADIKDTTGDTITVALKDGSEKKVKKDDAQQVNPPKFFLIEDMANLTHLNDASVLENLRARYYRQLIYTYSGLFCVAVNPYKRFPIYTEQVALKYKGKRRGEMPPHIFSISDNAYHNMLQDRENQSILITGESGAGKTENTKKVISYFAVVAAASKKEDDDSS----KKGTLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTTGKIAGADIEHYLLEKSRVVSQMKGERNYHIFYQLLSTYGSKYHDKLLVQTDPALYSFINQGELTIDGVDDSEEMKLCDEAFEVLGFNDDEKLSLFKCTTSICNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLLTSFLKPKVKVGTEFVTKGQNLNQVTYAVSALAKSLYNRMFGWLVARVNKTLDTKVKRQFFIGVLDIAGFEIFTENGFEQICINYTNERLQQFFNHHMFVLEQEEYKREKIQWTFIDFGMDLQACIDLIEKPMGILSILEEECIVPKASDQTFLSKLYDNHLGKSPNFTKPKPPKPGHVEAHFELHHYAGSVPYTITGWLEKNKDPLNDSVVALLGDSKDPLVSNLFTPV--VGEPGKKTKGGSFLTVTYMHRESLNKLMKNLQSTSPSFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNVIPDGFVDGRQVTEKILEATQLDKNLYQCGNTKVFFKAGTLAHLEDLRDDKLNGIISLFQAEIRGYLMRKQYKKLQDQRVALTLMQRNIRKYLVLRNWPWWRLYTKVKPMLNIARQEEEMKKAAEELAKLKEEYEKLEKLKKELEEQNVTVLQQKNDLFLQLQTEQDSLADAEEKISKLVLQRGDMEQRIKELEERLADEEDQAANLTEVKKKMSAEIEELKKDVEDLESSLQKAEQEKQTKDNQIRTLQSEMAQQDEMIGKLNKDKKNLEEQNKRTQEALQAEEDKVNHLNKLKAKLESTLDEMEENLAREQKIRGDVEKSKRKLEGDLKATQETVDDLERVKRDLEEQLRRKEAEIGGLSGKFEDEQGLVAQLQRKIKELQTRIQELEEDLEAERAARSKAEKSRQQLESELEEVVDRLEEQDGATAAQSDLTKKREAELMKLKRDLEDTRLQNEQAIATMRKKQSDAINELADQLDQANKAKAKAEKERSQFKAELDDAHNQVDSIMKAKLNSEKTVKALESQLQEVSVKLDEATRNLNEQASTKARSSQEVSELQRQLEEAESQLSQLNKIKQQLSAQLEEARHSLEDESRMKAKLNGEVRNLTSDLDSLRETLEEEQSAKGDLQRQLQKLQGELQQLRSRGGGGGDVRSEEVEELKRKMNAKIPALESEAESAKSKCGQLEKTKARLQGELEDLMVDVERANGLASQLERKQNNFNRTLAEWQKKYADSQAELENAQRDARGQSTEIFRLKAQLEEVHEQMEGLRRENKNLSDEIHDLTEQLGEGGRSVHEIDKNRRRLEMEKEELQAALEEAESALEQEEAKVQRAQLEMSQIRQEIDRRLAEKEEEFEATRKNHQRAMESQQASLEAEGKGKAEAMRVKKKLEQDINELEVSLDGANRARAEQEENVKKFQQQVRELQSQLEDDQRQRDDLREQFQAAERRATVLAGELDELRIALDQAERSRKIAEAERAEASDRATEMSTQTASLAAQKRKLEADLAAMQADLEEAANEAKQADERAKKAMADSARVFEEIRQEQEHTQHVEKARKQLEIQVKELMARLEDSESGAMKNGRKAMGKLEQRVRELETELAAEQRRHGETQKNLRKVDRRMKEISLQAEEDKKSHDRMQELVEKLQGKIKTYKRQVQEAEEIAAINLAKYRKIQHEIEDAEERADQAEQALQKLRAKNRSSVSTARGVSPAP 1924          
BLAST of Myosin heavy chain vs. TrEMBL
Match: tr|A0A158QSF0|A0A158QSF0_9CEST (Uncharacterized protein OS=Mesocestoides corti PE=3 SV=1)

HSP 1 Score: 2531.52 bits (6560), Expect = 0.000e+0
Identity = 1413/1951 (72.42%), Postives = 1661/1951 (85.14%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQY-GDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAE---------DPNNTG-KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPG-----MTT 5888
            M+PSDPDF+YLGVDRKAL+K+    SFDSK   W+ DEKE ++ A I + SGD  TV+     TK +KKD+I+Q+NPPKF M EDMA+LT+LNDASVL+NLR RYY  LIYTYSGLFCV +NPYKR+PIY+ +V  KYKGKRR EMPPH+FSI+DNAY +MLADR+NQS+LITGESGAGKTENTKKVI+YFA V A   K+    G   ++KG+LEDQIVQANP+LEAYGNAKT RNNNSSRFGKFIRIHFGT+GKIAGADIEFYLLEKSRV SQ KGERN+HIFYQ+LS+ GK +H+KLL++ DPALYSFINQGELTIDGVDD EEMK+TDEA DILGF+ +E+MSLFKCT S++NMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDL+ S LKPKVKVGNE+VTKGQN DQV ++V ALAKSLY+R+F WLV RVNKTLDTKVKRQ+FIGVLDIAGFEIF+ NGFEQICINYTNERLQQFFNHHMFV EQEEY+KE I W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+D TFK KLYDNHLGKSPNF KPKPPK GQ EAHFELHHYAGSVPYN+TGWL KNKDPLN+TV+NLL  SKE+LV+ +FAP E         +P+  G K+KK  +  T++ THRESLNKLMKNL STSP FIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPN IP GF++GKQVT KIL+A QL    Y+ GNTKVFFKAGTLA+LEDMRDEKL+ +IS FQAQIRGYLMR++YKKLQDQR AL++IQRNIRKYL+LRTWPWW+LYTKVKP+LNIARQEEEMKKAAEEL KLKEEFEK++K KKELEEQNV LL+ KND+FLQLQTEQD+LAD+EEKVSKL++QKADME +IKELE+ L +EED++  LE+ KKK+  EI+ELKKDV DLES+LQKAEQEK AKD QI+ LQ +M +QE+++ +L KEKKA +E  K+T E+L AEE+KV +L K KAKLE T+DEMEENL+REQKIR+DVEK KRK+E +LK TQETVDD+ERVKR+LEEQL+RK+ EL N  SK E++ GL+ QLQRKIKELQARI ELEEDLEAER AR+KAEK+R QLE EL+E+SDRLEEQGGAT+AQMDLNKKREAEL+KLKRDLEE+ +Q++Q IA  RKKQ D +NE ++QLDQ QK+KAK+EKEK ++K + +DLQGQ+ +L K K N++K  K  EAQ SELQ +L+EA R   DA +   +  Q   ELQ +LEEAESQI QL K KQQ+ +QLEEAR+  +EE+RAK+KLSS+VRNLN+DLD LRE+LEEE  +KSD+QRQ+ K Q E+     K  G G I++EE +E KR+   +I E E EAE AK K  QLEKVKARLQG+IED++VDV+RAN LASQLEKKQK FDK + EWQ KYAESQ+ELE +QRE+R  S +VFR+KAQ+EE+Q+Q+E+V+RENKNL+DEIHDLTEQ+GEGGRSVHE DKARKRLEMEKEELQ ALEEAE ALEQEEAK QR+ LE+SQ+R EIDRRLAEKEEEFEATR NHQRA+ESM+ASLEAE +G+A+A +MKKKLE DI ELEVA+D+ANR R+E EKN KKFQQQV+EL S +E+E+  ++++RE  +  ER+  M+ AE+E++R  LE SER RK  E E+ E  DR +ELSVQS+ F A KRK+EADLAAMQ+DLEEAA EA+QA+E+AKKA+ADSAR+F+E+RQEQEH Q ++K +KQLE Q KELQ +L+E+E+NA+KGGKKAL+KLEQRVRELE ELD EQ+RH E+QKN RK++RRLKE+ LQ DEDKKN +R+Q+LV++LQGKIKTYKRQVEEAEEIAAVNLAKYRKIQ E+ED+EERADQAEQALQKLR KNRSSVS +RG S APG     MTT
Sbjct:    1 MDPSDPDFEYLGVDRKALLKEAEAGSFDSKSVAWVEDEKEGYVMADIVETSGDTVTVRLKDGTTKQIKKDDIQQVNPPKFTMTEDMADLTYLNDASVLENLRARYYHKLIYTYSGLFCVAVNPYKRYPIYSYEVAMKYKGKRRAEMPPHLFSIADNAYHSMLADRENQSILITGESGAGKTENTKKVISYFAFVTANPSKK----GEEVEKKGSLEDQIVQANPLLEAYGNAKTNRNNNSSRFGKFIRIHFGTTGKIAGADIEFYLLEKSRVTSQMKGERNFHIFYQLLSDYGKKYHDKLLVTADPALYSFINQGELTIDGVDDSEEMKLTDEAIDILGFTNDERMSLFKCTTSVINMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLLNSFLKPKVKVGNEFVTKGQNLDQVNFAVNALAKSLYSRLFTWLVARVNKTLDTKVKRQYFIGVLDIAGFEIFDENGFEQICINYTNERLQQFFNHHMFVQEQEEYRKENIQWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDETFKNKLYDNHLGKSPNFAKPKPPKAGQKEAHFELHHYAGSVPYNITGWLVKNKDPLNDTVVNLLMESKESLVAHMFAPPEGTHVTECLKNPHLDGTKKKKSSSFMTVTYTHRESLNKLMKNLMSTSPSFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNVIPAGFIDGKQVTEKILDACQLSKESYQCGNTKVFFKAGTLAELEDMRDEKLNKIISNFQAQIRGYLMRKEYKKLQDQRTALALIQRNIRKYLMLRTWPWWRLYTKVKPMLNIARQEEEMKKAAEELAKLKEEFEKLEKLKKELEEQNVTLLQQKNDIFLQLQTEQDNLADSEEKVSKLILQKADMEQQIKELEERLNDEEDSSRNLEEAKKKLAAEIDELKKDVEDLESTLQKAEQEKQAKDNQIRQLQSEMQQQEDQLARLNKEKKALEEQNKRTSEALQAEEDKVNHLTKLKAKLESTLDEMEENLAREQKIRSDVEKAKRKLEGDLKATQETVDDMERVKRDLEEQLRRKDAELNNMGSKSEEDQGLINQLQRKIKELQARIAELEEDLEAERAARSKAEKARQQLEAELDEVSDRLEEQGGATAAQMDLNKKREAELIKLKRDLEEARIQNEQQIAAMRKKQTDAINEVTDQLDQAQKLKAKLEKEKTDLKAECDDLQGQVANLAKQKMNAEKNWKTFEAQVSELQARLDEATRQNTDAGSQKARLTQDVTELQRQLEEAESQIGQLTKAKQQLASQLEEARRNLDEETRAKSKLSSEVRNLNSDLDALRESLEEEQASKSDMQRQIQKLQAEIAAGVGK--GQGDIKNEEFEEMKRRLNAKIQEYESEAEAAKQKCSQLEKVKARLQGDIEDLMVDVERANGLASQLEKKQKNFDKTLGEWQAKYAESQSELENAQREARGYSTDVFRLKAQLEEAQDQIEAVRRENKNLSDEIHDLTEQLGEGGRSVHEADKARKRLEMEKEELQAALEEAESALEQEEAKVQRAALELSQVRSEIDRRLAEKEEEFEATRKNHQRAIESMQASLEAEVKGKADAMRMKKKLEQDINELEVALDSANRSRAEMEKNVKKFQQQVRELESQIEEEQRSREELRETASTAERRAQMMAAEMEDLRNHLEASERARKTAEMERAEAADRASELSVQSASFTAMKRKMEADLAAMQADLEEAANEAKQADERAKKAMADSARVFEEVRQEQEHTQHVEKARKQLEQQVKELQVRLEEAESNAMKGGKKALAKLEQRVRELETELDAEQRRHGETQKNYRKIDRRLKEVTLQADEDKKNYDRMQELVDQLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQHEVEDAEERADQAEQALQKLRAKNRSSVSMSRGPSAAPGGRSINMTT 1945          
BLAST of Myosin heavy chain vs. TrEMBL
Match: tr|A0A0X3P9Q4|A0A0X3P9Q4_SCHSO (Uncharacterized protein OS=Schistocephalus solidus GN=TR110603 PE=3 SV=1)

HSP 1 Score: 2526.9 bits (6548), Expect = 0.000e+0
Identity = 1422/1933 (73.56%), Postives = 1659/1933 (85.83%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYG-DSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPG 5879
            M+PSDPDF YLGVDRKAL+K+    SFDSKK  W+ DEKE F+ A IE+ SGD  TV+      KTVKKD ++Q+NPPKF+MIEDMA+LT+LNDASVL+NLR RYYKNLIYTYSGLFCVTINPYKRFPIYT +V  KYKGKRR EMPPHIFSISDNAY NMLADR+NQS+LITGESGAGKTENTKKVI+YFA+V A   K+ED       +KG+LEDQI+QANP+LEAYGNAKT RNNNSSRFGKFIRIHFGT+GKIAGADIEFYLLEKSRV +Q KGERN+HIFYQ+LS+ GK + +KLL+SPDPALYSFINQGELTIDGVDD EEMKITDEA DILGF+ +E+MSLFKCT SILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDL+ S LKPKVKVGNEYVTKGQN DQV Y+V ALAKSLY+R+F WLV+RVNKTLDTKVKRQ+FIGVLDIAGFEIF+ NGFEQICINYTNERLQQFFNHHMFV EQEEYKKE I W FIDFGMDLQACI+LIEKPMGILSILEEECMFPKASD TFKAKLYDNHLGKSPNF KP+PPKPGQ EAHFELHHYAGSVPYN+TGWL+KNKDPLN+TV++LL  SKEALV+ +FA  E+    GK+KK  +  T+S  HRESLNKLMKNL STSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIP GFV+GKQVT KILEA QL T  Y+ G TKVFFKAG LA+LEDMRDEKLS +IS FQAQIRGYLMR+QYK LQDQR ALS+IQRNIRKYL+LRTWPWW+LYTKVKP+LNIARQEEEMKKAAEEL KLKEEFEK++K KKELEEQNV LL+ KND+FLQLQ EQD+LADAEEK SKL++QKADME +IKELED L +EEDN  GLE+ KKK+  EI+ELKKDV DLESSLQKAEQEK  KD QI++LQ ++ +QEE+M +L KEKKA +E  K+T E+L AEE+KV +LNK KAKLEQT+DEMEENL+REQKIRADVEK KRK+E +LK TQE VDD+ERVKR+LEEQL+RKE E+ +  SK E++ GL+AQLQRKIKELQARI ELEEDLEAER AR+KAEK+R QLE EL+EL+DRLEEQGGAT+AQMDLNKKREAELMKLKRDLEE+ MQ++Q +A  RK+Q D V+E ++QLDQ QK KAK+EKEKN+ K +L+DLQGQ+  L K K NS+K  K +E+Q SE+  +LEEA R   D  +   +  Q  A+LQ +LEEAESQI QL K KQQ+  QLEEAR+  +EE+R+KAKLSS++RNLN+DLD LRE+LEEE   K+D+QRQ+ K Q ++   + +      +RSEE++E KR+   +I ELE E++ AK K  QLEK+KARLQGEIED++VDV+RAN LASQLEKKQK FDK + EWQ KYAESQAELE +QRE+R  S +VFR+KAQ+EE+ +Q+E+++RENKNL+DEIHDLTEQ+GEGGRSVHE DKARKRLEMEKEELQ ALEEAE ALEQEEAK QR+ LE+SQ+R EIDRRLAEKEEEFEATR NHQRAMESM+ASLEAE++G+AEA KMKKKLE DI E+E+++D ANR R+E EKN KK QQ+ +E+ +M+EDE+ ++D++RE  +  ER+  M+  E+E++R  LE++ER RK+ E E+ E +DR +E+S Q +   A KRK+EADLAAMQ+DLEEAA EA+QA+E+AKKA+ADSAR+F+E+RQEQEH Q +++ +KQLE Q KE+Q +L+ESE NA+KGGKKAL+KLEQRVRELE E++ EQ+RH E+QKN RKV+RRLKE+ LQ +EDKKN +R+Q+LV++LQGKIKTYKRQVEEAEEIAAVNLAKYRKIQ E+ED+EERADQAEQALQKLR KNRSSVS ARG S+ PG
Sbjct:    1 MDPSDPDFVYLGVDRKALLKEVEVGSFDSKKVAWVEDEKEGFVLADIEETSGDNVTVRLKDGTPKTVKKDTLQQVNPPKFIMIEDMADLTYLNDASVLENLRARYYKNLIYTYSGLFCVTINPYKRFPIYTFEVALKYKGKRRAEMPPHIFSISDNAYHNMLADRENQSILITGESGAGKTENTKKVISYFAYVTAGVTKKED---AQVDKKGSLEDQIIQANPLLEAYGNAKTTRNNNSSRFGKFIRIHFGTTGKIAGADIEFYLLEKSRVTAQMKGERNFHIFYQLLSDYGKKYLDKLLVSPDPALYSFINQGELTIDGVDDAEEMKITDEAIDILGFTNDERMSLFKCTTSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLLNSFLKPKVKVGNEYVTKGQNLDQVNYAVNALAKSLYSRLFTWLVMRVNKTLDTKVKRQYFIGVLDIAGFEIFDENGFEQICINYTNERLQQFFNHHMFVQEQEEYKKENIQWTFIDFGMDLQACIDLIEKPMGILSILEEECMFPKASDQTFKAKLYDNHLGKSPNFTKPRPPKPGQKEAHFELHHYAGSVPYNITGWLDKNKDPLNDTVVSLLQQSKEALVALMFAAQEETG--GKKKKSSSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPTGFVDGKQVTEKILEACQLSTESYQCGTTKVFFKAGILAELEDMRDEKLSKIISFFQAQIRGYLMRKQYKTLQDQRTALSLIQRNIRKYLVLRTWPWWRLYTKVKPMLNIARQEEEMKKAAEELAKLKEEFEKMEKLKKELEEQNVTLLQQKNDIFLQLQAEQDNLADAEEKCSKLILQKADMESQIKELEDRLADEEDNVNGLEETKKKLTAEIDELKKDVEDLESSLQKAEQEKQTKDNQIRTLQGELQQQEEQMGRLNKEKKALEEQNKRTMEALQAEEDKVNHLNKLKAKLEQTLDEMEENLAREQKIRADVEKSKRKLEGDLKATQEAVDDMERVKRDLEEQLRRKEAEMASMGSKSEEDQGLIAQLQRKIKELQARIAELEEDLEAERAARSKAEKARQQLEAELDELTDRLEEQGGATAAQMDLNKKREAELMKLKRDLEEARMQNEQTVAMMRKRQMDAVSELTDQLDQSQKAKAKLEKEKNDYKAELDDLQGQVAHLTKLKMNSEKNAKALESQISEVTARLEEATRSGADLGSQKARAAQEAADLQHQLEEAESQIGQLSKAKQQLAAQLEEARRNLDEETRSKAKLSSEMRNLNSDLDALRESLEEEQSAKADMQRQIQKLQADLASGRGR--PDDGVRSEEMEELKRRMNAKIQELESESDAAKQKCSQLEKIKARLQGEIEDLMVDVERANGLASQLEKKQKNFDKTLGEWQTKYAESQAELENAQREARGFSTDVFRLKAQLEENADQMEALRRENKNLSDEIHDLTEQLGEGGRSVHESDKARKRLEMEKEELQAALEEAEAALEQEEAKVQRAALELSQVRSEIDRRLAEKEEEFEATRKNHQRAMESMQASLEAETKGKAEAMKMKKKLEQDINEMEISLDGANRARAELEKNVKKLQQEAREMQTMLEDEQRERDEMRENASAAERRANMLSGEVEDLRNHLESAERARKSAEAERGEASDRASEMSAQVASLSALKRKMEADLAAMQADLEEAANEAKQADERAKKAMADSARVFEEVRQEQEHTQAVERARKQLEQQLKEMQVRLEESEANAMKGGKKALAKLEQRVRELEGEVEAEQRRHGETQKNYRKVDRRLKEVALQAEEDKKNYDRMQELVDQLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQHEVEDAEERADQAEQALQKLRAKNRSSVSVARGASVTPG 1926          
BLAST of Myosin heavy chain vs. TrEMBL
Match: tr|A0A068YE18|A0A068YE18_ECHMU (Myosin heavy chain OS=Echinococcus multilocularis GN=EmuJ_000920900 PE=3 SV=1)

HSP 1 Score: 2526.12 bits (6546), Expect = 0.000e+0
Identity = 1399/1933 (72.37%), Postives = 1649/1933 (85.31%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQY-GDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPG 5879
            M+PSDPDF+YLGVDRKAL+K+    SFDSK   W+ DEKE ++ A IE+ SGD  TV+     TK +KKD+I+Q+NPPKF+M EDMA+LT+LNDASVL+NLR RYY  LIYTYSGLFCV +NPYKR+PIY+ +V  KYKGKRR EMPPH+FSISDNAY +MLADR+NQS+LITGESGAGKTENTKKVI+YFA V A   K+    G   ++KG+LEDQIVQANP+LEAYGNAKT RNNNSSRFGKFIRIHFGT+GKIAGADIEFYLLEKSRV SQ KGERN+HIFYQ+LS+ GK +H+KLL+S DPALYSFINQGELTIDGVDD EEMK+TDEA DILGFS +E+MSLFKCT S++NMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDL+ S LKPKVKVGNE+VTKGQN DQV ++V ALAKSLY+R+F WLV RVNKTLDTKVKRQ+FIGVLDIAGFEIF  NGFEQICINYTNERLQQFFNHHMFV EQEEY+KE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+D TFK KLYDNHLGKSPNF KPKPPK GQ EAHFELHHYAGSVPYN+TGWL+KNKDPLN+TV+NLL  SKE LV+ +FAP ED     K+KK G+  T++ THRESLNKLMKNL STSP FIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRM+YSEFKQRYSILAPN IP GFV+GKQVT KIL+A QL  + Y+ GNTKVFFKAGTLA+LEDMRDEKL+ +IS FQAQIRGYLMR++YKKLQDQR AL++IQRNIRKYL+LRTWPWW+LYTKVKP+LNIARQEEEM+KAAEEL K+KEEFEK++K KKELEEQNV LL+ KND+FLQLQTEQD+LAD+EEKVSKL++QKADME +IKELE+ L +EED +  LE+ KKK+  EI+ELKKDV DLES+LQKAEQEK AKD QIK LQ +M +QE+++ +L KEKKA +E  K+T E+L AEE+KV +LNK KAKLE T+DEMEENL+REQKIR DVEK KRK+E +LK TQE+VDDLERVKR+LEEQL+RK+ E+ N  SK E++ GL+ QLQRKIKELQARI ELEEDLEAER AR+KAEK+R QLE EL+E+SDRLEEQGGAT+AQMDLNKKREAEL+KLKRDLEE+ +Q++Q +   RKKQ D VNE ++QLDQ  K+KAKVEKEK ++K + +DLQ Q+ ++ K K N++K  K  E+Q +ELQ KL+E +R   DA +   +  Q   ELQ +LEEAESQ+ QL K KQQ+ +QLEEAR+  +EESRAK+KL+S+VRNL +DLD LRE+LEEE   KSD+QRQ+ K Q E+     K  G G I++EE +E KR+   ++ E E +AE+AK K  QLEK+KARLQGEIED++VDV+RAN LASQLEKKQK FDK + EWQ KYAESQAELE +QRE R  S +VFR+KAQ+EE+ +Q+E+V+RENKNL+DEIHDLTEQ+GEGGRSVHE DKARKRLEMEKEELQ ALEEAE ALEQEEAK QR+ LE+SQ+R EIDRRLAEKEEEFEATR NHQRA+ESM+ASLEAE +G+A+A +MKKKLE DI ELEVA+D+ANR R+E EKNAKKFQQQV+E+ S +E+++H +D++RE  +  ER+  M+  EL+++R  LE SER RK  E E+ E +DR +EL+ QS+ F A KRK+EADLAAMQ+DLEEAA EA+QA+E+AKKA+ADSAR+F+E+RQEQEH Q ++K +KQ E Q KELQ +L+E+E NA+KGGKKAL+KLEQRVRELE ELD EQ+RH E+QKN RK++RRLKE+ +Q DEDKKN +RLQ+LV++LQGKIKTYKRQVEEAEEIAAVNLAKYRKIQ E+ED+EERADQAEQALQKLR KNRSSVS +RG S  P 
Sbjct:    1 MDPSDPDFEYLGVDRKALLKEAEAGSFDSKSVAWVEDEKEGYVMADIEETSGDTVTVRLKDGNTKKIKKDDIQQVNPPKFIMAEDMADLTYLNDASVLENLRARYYHKLIYTYSGLFCVAVNPYKRYPIYSYEVAMKYKGKRRAEMPPHLFSISDNAYHSMLADRENQSILITGESGAGKTENTKKVISYFAFVTANPAKK----GEEVEKKGSLEDQIVQANPLLEAYGNAKTNRNNNSSRFGKFIRIHFGTTGKIAGADIEFYLLEKSRVTSQMKGERNFHIFYQLLSDYGKKYHDKLLVSADPALYSFINQGELTIDGVDDAEEMKLTDEAIDILGFSNDERMSLFKCTTSVVNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLLNSFLKPKVKVGNEFVTKGQNLDQVNFAVNALAKSLYSRLFTWLVARVNKTLDTKVKRQYFIGVLDIAGFEIFEENGFEQICINYTNERLQQFFNHHMFVQEQEEYRKENIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDQTFKQKLYDNHLGKSPNFAKPKPPKAGQKEAHFELHHYAGSVPYNITGWLDKNKDPLNDTVVNLLQESKETLVAYMFAPPEDGT---KKKKSGSFMTVTYTHRESLNKLMKNLMSTSPSFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMVYSEFKQRYSILAPNVIPAGFVDGKQVTEKILDACQLSKDSYQCGNTKVFFKAGTLAELEDMRDEKLNKIISNFQAQIRGYLMRKEYKKLQDQRTALALIQRNIRKYLMLRTWPWWRLYTKVKPMLNIARQEEEMRKAAEELAKMKEEFEKLEKLKKELEEQNVTLLQQKNDIFLQLQTEQDNLADSEEKVSKLILQKADMEQQIKELEERLNDEEDASKNLEEAKKKLAAEIDELKKDVEDLESTLQKAEQEKQAKDNQIKQLQSEMQQQEDQIARLNKEKKALEEQNKRTTEALQAEEDKVNHLNKLKAKLESTLDEMEENLAREQKIRGDVEKAKRKLEGDLKSTQESVDDLERVKRDLEEQLRRKDAEMANMGSKSEEDQGLINQLQRKIKELQARIAELEEDLEAERAARSKAEKARQQLEAELDEVSDRLEEQGGATAAQMDLNKKREAELIKLKRDLEEARIQNEQQVQALRKKQADAVNEITDQLDQATKLKAKVEKEKGDLKAECDDLQSQIANITKQKMNAEKNWKTCESQLAELQAKLDETSRQATDAGSQKARLSQDITELQRQLEEAESQLGQLSKAKQQLASQLEEARRNLDEESRAKSKLTSEVRNLTSDLDALRESLEEEQSAKSDMQRQIQKLQSELAAGVGK--GQGDIKTEEFEEMKRRLTAKLQEAESDAESAKQKCSQLEKIKARLQGEIEDLMVDVERANGLASQLEKKQKNFDKTLGEWQAKYAESQAELENAQREGRGYSTDVFRLKAQLEEANDQIEAVRRENKNLSDEIHDLTEQLGEGGRSVHEADKARKRLEMEKEELQAALEEAESALEQEEAKVQRAALELSQVRSEIDRRLAEKEEEFEATRKNHQRAIESMQASLEAEVKGKADAMRMKKKLEQDINELEVALDSANRGRAEMEKNAKKFQQQVREMESQMEEDQHVRDELRENVSTAERRAQMLAGELDDLRTHLETSERARKAAELERAEASDRASELTAQSASFAAMKRKMEADLAAMQADLEEAANEAKQADERAKKAMADSARVFEEVRQEQEHTQHVEKARKQAEQQVKELQVRLEEAEANAMKGGKKALAKLEQRVRELETELDAEQRRHGETQKNYRKIDRRLKEVTMQADEDKKNYDRLQELVDQLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQHEVEDAEERADQAEQALQKLRAKNRSSVSMSRGPSATPA 1924          
The following BLAST results are available for this feature:
BLAST of Myosin heavy chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
MYH70.000e+055.04myosin, heavy chain 7, cardiac muscle, beta [Sourc... [more]
MYH60.000e+054.64myosin, heavy chain 6, cardiac muscle, alpha [Sour... [more]
MYH60.000e+054.64myosin, heavy chain 6, cardiac muscle, alpha [Sour... [more]
MYH80.000e+053.26myosin, heavy chain 8, skeletal muscle, perinatal ... [more]
MYH20.000e+053.31myosin, heavy chain 2, skeletal muscle, adult [Sou... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
myo-50.000e+053.67MYOsin heavy chain structural genes [Source:RefSe... [more]
unc-540.000e+053.64Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
unc-540.000e+053.64Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
unc-540.000e+053.64Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
myo-30.000e+051.48Myosin-3 [Source:UniProtKB/Swiss-Prot;Acc:P12844][more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
Mhc0.000e+058.37Myosin heavy chain [Source:FlyBase gene name;Acc:F... [more]
Mhc0.000e+058.30Myosin heavy chain [Source:FlyBase gene name;Acc:F... [more]
Mhc0.000e+058.32Myosin heavy chain [Source:FlyBase gene name;Acc:F... [more]
Mhc0.000e+058.19Myosin heavy chain [Source:FlyBase gene name;Acc:F... [more]
Mhc0.000e+058.56Myosin heavy chain [Source:FlyBase gene name;Acc:F... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
vmhcl0.000e+054.09ventricular myosin heavy chain-like [Source:ZFIN;A... [more]
smyhc20.000e+054.27slow myosin heavy chain 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
FO904953.10.000e+054.27pep:known chromosome:GRCz10:19:890369:910641:1 gen... [more]
smyhc20.000e+054.41slow myosin heavy chain 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
vmhc0.000e+054.24ventricular myosin heavy chain [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
myh40.000e+054.17myosin, heavy chain 4, skeletal muscle [Source:Xen... [more]
myh20.000e+053.40myosin, heavy chain 2, skeletal muscle, adult [Sou... [more]
myh40.000e+053.91myosin, heavy chain 4, skeletal muscle [Source:Re... [more]
myh130.000e+053.01myosin, heavy chain 13, skeletal muscle [Source:Xe... [more]
myh150.000e+048.50myosin, heavy chain 15 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Myh60.000e+054.76myosin, heavy polypeptide 6, cardiac muscle, alpha... [more]
Myh70.000e+055.24myosin, heavy polypeptide 7, cardiac muscle, beta ... [more]
Myh70.000e+055.24myosin, heavy polypeptide 7, cardiac muscle, beta ... [more]
Myh40.000e+053.18myosin, heavy polypeptide 4, skeletal muscle [Sour... [more]
Myh40.000e+053.18myosin, heavy polypeptide 4, skeletal muscle [Sour... [more]
back to top
BLAST of Myosin heavy chain vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P24733|MYS_ARGIR0.000e+064.65Myosin heavy chain, striated muscle OS=Argopecten ... [more]
sp|F1PT61|MYH16_CANLF0.000e+055.54Myosin-16 OS=Canis lupus familiaris GN=MYH16 PE=3 ... [more]
sp|P05661|MYSA_DROME0.000e+057.59Myosin heavy chain, muscle OS=Drosophila melanogas... [more]
sp|P02563|MYH6_RAT0.000e+054.85Myosin-6 OS=Rattus norvegicus GN=Myh6 PE=1 SV=2[more]
sp|Q9BE39|MYH7_BOVIN0.000e+055.09Myosin-7 OS=Bos taurus GN=MYH7 PE=1 SV=1[more]
back to top
BLAST of Myosin heavy chain vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|O96062|O96062_DUGJA0.000e+093.39Myosin heavy chain OS=Dugesia japonica GN=DjMHC-A ... [more]
tr|Q02456|Q02456_SCHMA0.000e+073.23Myosin heavy chain OS=Schistosoma mansoni GN=MYH P... [more]
tr|A0A158QSF0|A0A158QSF0_9CEST0.000e+072.42Uncharacterized protein OS=Mesocestoides corti PE=... [more]
tr|A0A0X3P9Q4|A0A0X3P9Q4_SCHSO0.000e+073.56Uncharacterized protein OS=Schistocephalus solidus... [more]
tr|A0A068YE18|A0A068YE18_ECHMU0.000e+072.37Myosin heavy chain OS=Echinococcus multilocularis ... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..10
score: 0.463
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.562
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.546
NoneNo IPR availableTMHMMTMhelixcoord: 12..30
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 25..47
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.518
NoneNo IPR availableTMHMMTMhelixcoord: 12..31
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..10
score: 0.471
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.715
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 4..23
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..10
score: 0.513
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableTMHMMTMhelixcoord: 27..49
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..11
score: 0.462
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableCOILSCoilCoilcoord: 1381..1443
NoneNo IPR availableCOILSCoilCoilcoord: 1803..1837
NoneNo IPR availableCOILSCoilCoilcoord: 1162..1372
NoneNo IPR availableCOILSCoilCoilcoord: 840..1154
NoneNo IPR availableCOILSCoilCoilcoord: 1451..1471
NoneNo IPR availableCOILSCoilCoilcoord: 1683..1717
NoneNo IPR availableCOILSCoilCoilcoord: 1521..1587
NoneNo IPR availableCOILSCoilCoilcoord: 1859..1886
NoneNo IPR availableCOILSCoilCoilcoord: 1767..1801
NoneNo IPR availableCOILSCoilCoilcoord: 1725..1759
NoneNo IPR availableCOILSCoilCoilcoord: 1606..1668
NoneNo IPR availableCOILSCoilCoilcoord: 1479..1513
NoneNo IPR availableCOILSCoilCoilcoord: 1961..1963
NoneNo IPR availableCOILSCoilCoilcoord: 1894..1921
NoneNo IPR availableGENE3DG3DSA:1.20.5.340coord: 836..927
e-value: 6.0E-24
score: 83.8
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 836..961
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 1232..1349
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 953..1069
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 1427..1549
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 1064..1151
NoneNo IPR availableTMHMMTMhelixcoord: 26..48
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
IPR001609Myosin head, motor domainPRINTSPR00193MYOSINHEAVYcoord: 228..255
score: 80.67
coord: 459..487
score: 73.27
coord: 115..134
score: 62.52
coord: 171..196
score: 70.97
coord: 513..541
score: 48.56
IPR001609Myosin head, motor domainSMARTSM00242MYSc_2acoord: 79..777
e-value: 0.0
score: 1344.6
IPR001609Myosin head, motor domainPFAMPF00063Myosin_headcoord: 88..764
e-value: 9.5E-284
score: 942.7
IPR001609Myosin head, motor domainPROSITEPS51456MYOSIN_MOTORcoord: 85..776
score: 264.325
IPR000048IQ motif, EF-hand binding siteSMARTSM00015iq_5coord: 778..800
e-value: 9.8E-4
score: 28.4
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 779..808
score: 8.974
IPR027401Myosin-like IQ motif-containing domainGENE3DG3DSA:4.10.270.10coord: 775..835
e-value: 3.4E-30
score: 103.3
IPR002928Myosin tailPFAMPF01576Myosin_tail_1coord: 841..1921
e-value: 1.4E-174
score: 582.6
IPR004009Myosin, N-terminal, SH3-likePFAMPF02736Myosin_Ncoord: 34..73
e-value: 8.9E-14
score: 50.9
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 56..835

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001609Myosin_head_motor_dom
IPR000048IQ_motif_EF-hand-BS
IPR027401Myosin-like_IQ_dom
IPR002928Myosin_tail
IPR004009Myosin_N
IPR027417P-loop_NTPase
Vocabulary: cellular component
TermDefinition
GO:0016459myosin complex
Vocabulary: molecular function
TermDefinition
GO:0003774motor activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0003779actin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000428musculature system
PLANA:0007549body wall musculature compartment
PLANA:0000101muscle cell
PLANA:0000023temporary embryonic pharynx
PLANA:0000058embryonic digestive system
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000002Stage 2
PLANA:0000007Stage 7
PLANA:0000006Stage 6
PLANA:0000005Stage 5
PLANA:0000003Stage 3
PLANA:0000004Stage 4
PLANA:0000008Stage 8
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025388 ID=SMED30025388|Name=Myosin heavy chain|organism=Schmidtea mediterranea sexual|type=transcript|length=6089bp
TTTTTTTTCGAGTTTGTGCTAGAAATTAATTTCAGTTTGAAATTTTTTGC
CTATTTCGAGTTCTTTGAAAACAATCTGAAAACATGAACCCATCTGATCC
CGATTTTCAATATCTCGGTGTCGACCGAAAAGCTTTAATGAAGCAGTATG
GGGATTCCTTTGACAGCAAGAAAAACTGTTGGATTCCTGACGAGAAAGAA
GCCTTCATTGCGGCGACAATTGAAGATGCGTCTGGAGATGTCTATACGGT
CAAAACCGATAAAAGTGAAACCAAGACTGTTAAAAAGGACGAAATCGAAC
AAATGAATCCACCGAAATTTTTGATGATTGAAGACATGGCAAATTTAACC
TTTCTAAACGATGCCAGCGTTCTTGATAATTTAAGACAAAGATATTACAA
GAATCTGATTTATACCTACTCTGGACTGTTTTGTGTGACAATAAATCCAT
ACAAAAGATTTCCAATTTACACCCCGCAGGTGATTTCAAAATACAAAGGT
AAACGACGAACTGAAATGCCTCCACATATTTTCTCGATATCCGACAATGC
TTACACCAACATGTTGGCGGACCGAGATAATCAATCTGTCTTAATTACTG
GTGAAAGTGGAGCTGGGAAAACTGAAAATACAAAAAAAGTTATCACTTAT
TTTGCACACGTTGCAGCTGCTACTAAAAAAGAAGAGGATGATACTGGAAC
TGGTCAAAAGAGAAAGGGAACATTGGAAGACCAAATCGTGCAAGCAAATC
CTGTTTTAGAAGCATACGGTAACGCAAAAACTGTGCGAAACAACAATTCA
TCCAGATTTGGTAAATTCATTCGTATTCATTTCGGTACAAGTGGAAAAAT
AGCTGGAGCTGATATTGAATTTTACTTACTCGAAAAATCGAGAGTAAATT
CTCAACAGAAAGGTGAAAGAAACTATCACATTTTCTATCAAATTTTATCG
AACGGAGGAAAACCATTTCATGAAAAATTACTCATCTCTCCTGATCCAGC
TTTGTATTCCTTCATTAATCAAGGTGAATTAACAATCGATGGAGTCGACG
ATGAAGAAGAAATGAAAATAACTGATGAAGCTTTCGACATTTTGGGATTT
TCTGCCGAAGAAAAAATGAGCTTGTTCAAGTGTACTTGCTCAATTTTAAA
CATGGGCGAAATGAAATTTAAACAAAGGCCAAGAGAAGAACAAGCCGAAG
CCGACGGTACTGCTGAAGCTGAGAAAGTGGCTTTTCTGTTGGGTGTCAAT
GCAAAAGATTTAATGCAATCGATTCTGAAACCGAAAGTTAAAGTTGGTAA
TGAATATGTCACAAAGGGGCAGAATAAAGATCAAGTTCTTTATTCGGTTG
GTGCGCTAGCAAAATCTCTTTACAACAGAATGTTTGCGTGGTTGGTTTTG
AGAGTTAACAAAACCCTCGACACTAAAGTCAAGCGACAATTTTTCATCGG
TGTTTTGGATATTGCCGGTTTCGAAATTTTCAATTTCAATGGATTTGAAC
AAATTTGTATTAATTACACCAATGAAAGATTGCAGCAATTTTTTAACCAT
CACATGTTCGTGTTGGAACAGGAAGAGTACAAGAAGGAAGCGATCGATTG
GGAGTTCATTGATTTTGGAATGGATCTTCAAGCGTGCATTGAGCTCATTG
AAAAGCCAATGGGTATTCTGTCAATCTTAGAAGAAGAGTGCATGTTTCCG
AAAGCATCTGATATGACATTTAAAGCAAAATTGTATGATAATCATCTCGG
AAAAAGTCCCAATTTTGGAAAGCCAAAACCTCCAAAACCCGGACAGGCTG
AAGCTCACTTCGAATTGCATCACTATGCTGGCAGTGTGCCATACAATGTT
ACTGGTTGGCTGGAAAAGAATAAAGATCCTCTCAACGAAACTGTGATAAA
TCTACTTGCGGCAAGTAAAGAGGCATTAGTTTCGAGTTTGTTTGCTCCGG
CTGAAGATCCAAATAATACGGGTAAACGGAAAAAGGGTGGGGCCATGCAG
ACCATTTCTTCAACTCATAGGGAATCCTTGAATAAATTGATGAAAAATTT
ACAAAGTACCAGTCCACATTTTATCCGATGCATTGTTCCAAACGAATTCA
AACAACCTGGTGTAATCGACGCTCATTTGGTATTACATCAATTGCATTGT
AACGGTGTCCTTGAAGGCATCAGAATCTGTCGAAAGGGTTTCCCAAACAG
AATGATTTATTCTGAATTTAAACAAAGATATTCTATCTTGGCTCCAAATG
CAATTCCACAGGGATTTGTTGAAGGCAAACAAGTAACGAGCAAAATTCTG
GAAGCTGTTCAATTGGACACCAATCTTTACCGCCTGGGAAATACTAAGGT
ATTTTTCAAAGCTGGAACTTTGGCTGATTTAGAAGACATGCGTGATGAAA
AATTATCTTCACTGATTTCATTGTTTCAAGCTCAAATACGCGGATATTTG
ATGCGAAGACAATATAAAAAATTACAAGATCAGAGAGTTGCTCTATCTAT
CATTCAAAGAAATATTCGTAAATATCTTCTTCTGAGAACATGGCCATGGT
GGAAATTGTATACCAAAGTTAAGCCACTTTTGAACATTGCTCGTCAAGAG
GAAGAAATGAAAAAGGCCGCTGAAGAATTGACAAAATTAAAGGAAGAATT
CGAAAAAGTTGACAAATTCAAAAAAGAACTTGAAGAACAAAACGTCAAAT
TGTTGGAAGCTAAAAACGATTTGTTCTTACAATTACAAACCGAACAAGAC
AGTTTAGCCGATGCCGAGGAAAAGGTTTCAAAATTGGTTATGCAAAAAGC
CGATATGGAAGGAAGAATTAAAGAATTGGAAGATCACCTTCTAGAAGAAG
AAGATAATGCTGCTGGACTGGAAGATATCAAGAAGAAAATGCAGGGTGAG
ATTGAAGAGTTGAAAAAAGATGTTGTCGATTTGGAATCTTCATTACAAAA
GGCTGAACAAGAGAAAACCGCGAAAGATCAACAGATAAAATCGTTACAAG
ATCAAATGGCAAAACAAGAAGAAGAGATGAACAAATTGAAAAAGGAGAAA
AAGGCCGCCGATGAAGTGCAAAAGAAAACCGAAGAATCTCTACTAGCGGA
AGAAGAGAAAGTCAAAAATCTAAACAAAGCTAAAGCCAAATTGGAACAGA
CCATTGATGAGATGGAAGAAAACCTCTCGCGAGAACAGAAAATCCGAGCT
GACGTAGAAAAAGTTAAACGAAAAATCGAAACTGAACTGAAACAAACTCA
AGAGACCGTAGACGATTTGGAAAGAGTAAAACGAGAATTAGAGGAACAAT
TGAAGCGCAAGGAAATGGAATTAGTCAATGCTTCATCGAAAATTGAAGAC
GAATCGGGATTAGTTGCCCAGCTTCAGAGGAAAATCAAAGAACTTCAAGC
TCGAATTCAAGAATTGGAAGAAGATCTGGAAGCAGAAAGACAAGCCCGTG
CAAAAGCAGAGAAAAGCCGACATCAACTCGAAGGCGAGTTGGAAGAATTG
AGTGATCGACTGGAAGAACAAGGAGGCGCAACCTCAGCTCAAATGGATCT
CAATAAGAAGCGAGAGGCAGAATTAATGAAATTAAAGAGAGATTTAGAAG
AATCGAATATGCAACACGATCAGGTTATCGCACAAGCTCGAAAGAAGCAA
CAGGATGTTGTCAATGAATTCTCAGAACAGCTCGATCAACTGCAGAAAGT
CAAAGCTAAAGTTGAAAAAGAAAAGAATGAGATGAAAGAAGATTTAAATG
ACCTACAAGGACAGCTGGAATCATTAAATAAAGCCAAGGCTAACAGCGAC
AAACGAATCAAAGAAATCGAAGCTCAAAATTCCGAATTACAGGGCAAATT
GGAAGAGGCAAATAGACATATCAATGATGCCAACAATACATCTGGAAAGA
ATCAACAAACCAATGCGGAACTCCAAGCACGTTTAGAAGAAGCCGAATCG
CAAATCAATCAGCTGGGTAAAGTCAAGCAACAAATGCAGACTCAACTCGA
AGAAGCCAGGCAAATCGCTGAGGAAGAGTCGAGAGCAAAGGCTAAATTGA
GTTCTGATGTTCGCAATCTCAATGCCGATTTAGACAATCTCAGGGAGGCA
CTGGAAGAGGAAAATGAGAACAAAAGTGACATACAGAGACAGCTAGTTAA
AGCTCAGGGAGAAATGCAACAATTGAAGGCTAAATTCGAAGGCTCGGGAT
CCATTCGTTCAGAAGAGTTGGATGAAGCCAAGCGAAAGTTTATGACACGA
ATCCATGAGCTGGAAGAGGAAGCTGAAACCGCCAAATCGAAAGCCGGACA
ACTAGAAAAAGTTAAAGCTCGACTCCAAGGAGAAATCGAAGATATGCTGG
TCGACGTTGACAGAGCGAATACACTCGCATCTCAGTTGGAAAAGAAGCAG
AAAACATTCGATAAAGTCGTGTCAGAATGGCAGCAGAAATATGCTGAATC
TCAGGCGGAATTGGAAGCATCCCAGAGAGAAAGCAGGACGATTTCAGCTG
AGGTGTTTCGAATGAAAGCACAAATCGAAGAAAGTCAAGAGCAGTTGGAA
AGCGTTAAACGGGAAAACAAAAATCTAGCAGATGAAATCCACGATTTGAC
AGAGCAAATCGGAGAAGGAGGTCGCAGTGTTCACGAAATCGACAAAGCAA
GGAAACGATTGGAAATGGAAAAGGAAGAATTGCAACATGCGTTAGAAGAA
GCCGAACAAGCTTTGGAACAGGAAGAAGCCAAGTCTCAACGATCACAACT
GGAAATGAGCCAGATCAGACAAGAAATCGACAGGCGATTGGCTGAGAAGG
AAGAGGAATTCGAGGCCACTCGAGTCAATCATCAAAGAGCAATGGAGTCA
ATGGAAGCCTCACTTGAAGCCGAATCCAGAGGCAGGGCTGAAGCAACGAA
GATGAAAAAGAAACTGGAGCACGATATCGGTGAACTGGAAGTTGCAGTGG
ATACCGCCAACAGAATCCGATCGGAGCAAGAAAAGAACGCAAAGAAATTC
CAGCAGCAAGTTCAAGAATTGCTATCAATGGTGGAGGATGAGAAACACCA
GAAGGATCAGATACGAGAGCAAACGACGATGACAGAAAGGAAATTGACAA
TGGTCCTGGCAGAGCTTGAGGAGGTTCGTGGCTCATTGGAAAATTCCGAG
AGAAACAGGAAAAATACCGAGAATGAGAAAATGGAAATAACTGATCGATT
GAATGAGTTGAGTGTCCAGAGCTCCGGTTTCATGGCTACCAAGCGGAAAT
TGGAAGCTGATTTGGCTGCTATGCAGTCCGATTTAGAGGAGGCCGCTACT
GAAGCCCGACAAGCCAATGAACAAGCCAAGAAGGCTGTTGCTGACAGTGC
GAGATTGTTTGATGAAATCCGGCAAGAGCAGGAACACGCACAGCAAATCG
ATAAGATCAAGAAACAACTCGAGGCCCAAAATAAAGAATTGCAAGCCAAA
TTAGATGAATCGGAGAATAATGCTTTGAAAGGTGGCAAAAAAGCCTTGAG
CAAACTAGAGCAACGCGTTCGTGAACTTGAAGCCGAATTAGACGGAGAAC
AAAAAAGACACGTTGAAAGTCAAAAGAACTCCAGAAAAGTTGAAAGACGG
CTTAAGGAGCTTGGATTACAAACCGACGAAGATAAGAAGAACCAAGAAAG
ATTGCAAGATCTGGTGGAGAAGCTTCAAGGTAAAATCAAAACCTACAAAC
GCCAGGTGGAAGAGGCGGAAGAAATTGCTGCTGTAAACTTAGCAAAATAC
AGAAAGATCCAACAGGAAATCGAAGATTCCGAAGAAAGAGCTGATCAAGC
TGAACAAGCGTTGCAGAAGCTGAGGACCAAAAACCGCAGCTCCGTTTCGA
CAGCGAGAGGCGGTAGCATGGCTCCCGGCATGACCACAGTGAAATCGACA
TCACTCTCTGTTTCGGCTTCGAGCCGACGACAAGGTTCTAGTGTTTCCAG
AGAGAGCTAAGTCAGAAATTCTAGTAACACAACGATAAATTATTAGGATT
TACTTAATTGACATTATTTGCATGTTATCAATTATTGGACACAATTTAGT
GATGCTTTTATTTAATAAAATTTACATTTTGAAAAAAAA
back to top

protein sequence of SMED30025388-orf-1

>SMED30025388-orf-1 ID=SMED30025388-orf-1|Name=SMED30025388-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1959bp
MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDAS
GDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNL
RQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIF
SISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKE
EDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHF
GTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLL
ISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKC
TCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKP
KVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVK
RQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYK
KEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKL
YDNHLGKSPNFGKPKPPKPGQAEAHFELHHYAGSVPYNVTGWLEKNKDPL
NETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLN
KLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICR
KGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYR
LGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQ
RVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQEEEMKKAAEELT
KLKEEFEKVDKFKKELEEQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSK
LVMQKADMEGRIKELEDHLLEEEDNAAGLEDIKKKMQGEIEELKKDVVDL
ESSLQKAEQEKTAKDQQIKSLQDQMAKQEEEMNKLKKEKKAADEVQKKTE
ESLLAEEEKVKNLNKAKAKLEQTIDEMEENLSREQKIRADVEKVKRKIET
ELKQTQETVDDLERVKRELEEQLKRKEMELVNASSKIEDESGLVAQLQRK
IKELQARIQELEEDLEAERQARAKAEKSRHQLEGELEELSDRLEEQGGAT
SAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQL
DQLQKVKAKVEKEKNEMKEDLNDLQGQLESLNKAKANSDKRIKEIEAQNS
ELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQ
MQTQLEEARQIAEEESRAKAKLSSDVRNLNADLDNLREALEEENENKSDI
QRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETA
KSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQ
QKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLAD
EIHDLTEQIGEGGRSVHEIDKARKRLEMEKEELQHALEEAEQALEQEEAK
SQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRAMESMEASLEAESRG
RAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMV
EDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKM
EITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKK
AVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNALKG
GKKALSKLEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDED
KKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSE
ERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTTVKSTSLSVSASSRRQ
GSSVSRES*
back to top
Aliases
The feature 'Myosin heavy chain' has the following synonyms
Synonym
Dj-mhc