Myosin heavy chain

Overview
NameMyosin heavy chain
Smed IDSMED30025388
Uniprot Best hitMyosin heavy chain, striated muscle OS=Argopecten irradians OX=31199 PE=1 SV=1 (E=0)
Length (bp)6089
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Myosin heavy chain (SMED30025388) t-SNE clustered cells

Violin plots show distribution of expression levels for Myosin heavy chain (SMED30025388) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myosin heavy chain (SMED30025388) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myosin heavy chain (SMED30025388) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Don't be a BOT, type this for download: vrwUwvpu

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30025388

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 27

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30025388SMESG000013389.1 dd_Smed_v4_579_0_1dd_Smed_v4PMID:28292427whole organismasexual adultsingle-cell RNA-sequencing evidence
muscle cellSMED30025388SMESG000013389.1 dd_Smed_v4_579_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
enteric muscle cellSMED30025388SMESG000013389.1 dd_Smed_v4_579_0_1dd_Smed_v4PMID:30471994FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
anterior region of the whole animalSMED30025388SMESG000013389.1 dd_Smed_v4_579_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
muscle cellSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:21566185whole organismasexual adultfluorescence in situ hybridization evidence
embryonic pharynx radial muscle cellSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
embryonic pharynx radial muscle cellSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
pharynx musculatureSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
embryonic pharynx circular muscle cellSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
pharynx musculatureSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
body wall musculatureSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
enteric musculatureSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
pharynx musculatureSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
embryonic pharynx circular muscle cellSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
body wall musculatureSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
embryonic pharynx circular muscle cellSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
embryonic pharynx circular muscle cellSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
enteric musculatureSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
embryonic pharynx radial muscle cellSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
body wall musculatureSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
embryonic pharynx radial muscle cellSMED30025388SMESG000013389.1 SMED30025388smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
parapharyngeal regionSMED30025388SMESG000013389.1 SmedASXL_017031SmedAsxl_ww_GCZZ01PMID:27034770whole organismasexual adultRNA-sequencing evidence
muscle cellSMED30025388SMESG000013389.1 EC386316ncbi_smed_estsPMID:21566185whole organismasexual adultfluorescence in situ hybridization evidence
pharynxSMED30025388SMESG000013389.1 EC386316ncbi_smed_estsPMID:22385657whole organismasexual adultcolorimetric in situ hybridization evidence
muscle progenitor cellSMED30025388SMESG000013389.1 dd_Smed_v6_579_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
pharynx musculatureSMED30025388SMESG000013389.1 dd_Smed_v6_579_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
musculature systemSMED30025388SMESG000013389.1 dd_Smed_v6_579_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
Homology
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH7 (myosin heavy chain 7 [Source:HGNC Symbol;Acc:HGNC:7577])

HSP 1 Score: 1792.7 bits (4642), Expect = 0.000e+0
Identity = 1054/1915 (55.04%), Postives = 1414/1915 (73.84%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF---APAEDP--NNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            YL    K  ++     FD KK+ ++PD+K+ F+ A I    G   T +T+  +T TVK+D++ Q NPPKF  IEDMA LTFL++ +VL NL+ RY   +IYTYSGLFCVT+NPYK  P+YTP+V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA   + + D   G   KGTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      + LLI+ +P  Y+FI+QGE T+  +DD EE+  TD AFD+LGF++EEK S++K T +I++ G MKFK + REEQAE DGT EA+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQN  QV+Y+ GALAK++Y RMF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+DMTFKAKL+DNHLGKS NF +      G+ EAHF L HYAG V YN+ GWL+KNKDPLNETV+ L   S   L+S+LF   A A+ P     GK KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K PGV+D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++   K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG L R +YKKL ++R +L +IQ NIR ++ ++ WPW KLY K+KPLL  A +E+EM    EE T+LKE  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+LADAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELK+D+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K++L+E+LK+K+ EL   +++IEDE  L +QLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + K EE  R +ND  +   K Q  N EL  +L+E E+ I+QL + K     QLE+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ E EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+G  G+++HE++K RK+LE EK ELQ ALEEAE +LE EE K  R+QLE +QI+ EI+R+LAEK+EE E  + NH R ++S++ SL+AE+R R EA ++KKK+E D+ E+E+ +  ANR+ +E +K  K  Q  +++    ++D     D ++E   + ER+  ++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K++ADL+ +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   15 YLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIYTYSGLFCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPG---KGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFGNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVIYATGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLFDNHLGKSANF-QKPRNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDPLNETVVGLYQKSSLKLLSTLFANYAGADAPIEKGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLARMEYKKLLERRDSLLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKMELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1925          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH6 (myosin heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:7576])

HSP 1 Score: 1791.16 bits (4638), Expect = 0.000e+0
Identity = 1048/1918 (54.64%), Postives = 1412/1918 (73.62%), Query Frame = 3
Query:  108 QYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG-------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            QYL    K  ++     FD +  C++PD+KE F+ A I    G     +T+  +T TVK+D++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA   + + D     K  GTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ERNYHIFYQILSN      + LL++ +P  Y+F++QGE+++  +DD EE+  TD AFD+LGF++EEK  ++K T +I++ G MKFKQ+ REEQAE DGT +A+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV YS+GALAK++Y +MF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+DMTFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+ GWLEKNKDPLNETV+ L   S   L+++LF+      +TG        +KKG + QT+S+ HRE+LNKLM NL++T PHF+RCI+PNE K PGV+D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++ T K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG LMR ++KK+ ++R AL +IQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  ++KE  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+L DAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L  EE+KV +L+K+K KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K +LEE+LK+KE ++   +SKIEDE  L  QLQ+K+KE QARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + KLEEA R +ND      K Q  N EL  +LEE E+ I+QL + K     Q+E+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+GEGG++VHE++K RK+LE+EK ELQ ALEEAE +LE EE K  R+QLE +QI+ EI+R+LAEK+EE E  + NHQR ++S++ SL+AE+R R E  ++KKK+E D+ E+E+ +  ANR+ +E +K  K  Q  +++    ++D     D ++E   + ER+  ++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K+E+DL  +QS++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   14 QYLRKSEKERLEAQTRPFDIRTECFVPDDKEEFVKAKILSREGGKVIAETENGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRGKKDNANANK--GTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLDMLLVTNNPYDYAFVSQGEVSVASIDDSEELMATDSAFDVLGFTSEEKAGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYYSIGALAKAVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNF-QKPRNIKGKQEAHFSLIHYAGTVDYNILGWLEKNKDPLNETVVALYQKSSLKLMATLFSSYATA-DTGDSGKSKGGKKKGSSFQTVSALHRENLNKLMTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPVAIPEGQFIDSRKGTEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRMQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMATMKEEFGRIKETLEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKVRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHQRVVDSLQTSLDAETRSRNEVLRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQSEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELEGELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1927          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH8 (myosin heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:7578])

HSP 1 Score: 1766.9 bits (4575), Expect = 0.000e+0
Identity = 1020/1915 (53.26%), Postives = 1406/1915 (73.42%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF-----APAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            YL    K  ++     FD+K + ++ + KE+++ +TI+   G   TVKT+   T TV++D++  MNPPK+  IEDMA +T L++  VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y P+V++ Y+GK+R E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +A   +K++D++G   K +GTLEDQI+ ANP+LEA+GNAKTVRN+NSSRFGKFIRIHFGT+GK+A ADIE YLLEKSRV  Q K ER+YHIFYQI SN      E LLI+ +P  Y+F++QGE+T+  +DD+EE+  TD A DILGF+ EEK+S++K T ++++ G MKFKQ+ REEQAE DGT  A+K A+L  +N+ DL++++  P+VKVGNEYVTKGQ   QV  +VGALAK++Y +MF W+V R+N+ LDTK  RQ+FIGVLDIAGFEIF+FN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDL ACIELIEKP+GI SILEEECMFPKA+D +FK KLYD HLGKS NF +      G+AEAHF L HYAG+V YN+TGWL+KNKDPLN+TV+ L   S    ++SLF     A A+     G +KKG + QT+S+  RE+LNKLM NL+ST PHF+RCI+PNE K PG ++  LVLHQL CNGVLEGIRICRKGFP+R++Y +FKQRY +L  +AIP+G F++ K+ + K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRDEKL+ +I+  QA  RG+LMR +Y+K+  +R AL  IQ N+R ++ ++ WPW KL+ K+KPLL  A  E+EM    EE  K K+E  K +  +KELEE+ V LL+ KNDL LQ+Q+E DSLADAEE+  +L+  K  +E +IKE+ +   EEE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK  QE+  D+E  K++L+E+L++KE E+ N  SKIEDE  +  QLQ+KIKELQARI+EL E++EAER +RAKAEK R  L  ELEE+S+RLEE GGATSAQ++LNKKREAE  KL+RDLEE+ +QH+ ++A  RKK  D + E  EQ+D LQ+VK K+EKEK+E+K + +DL    E+++KAK N +K  + +E Q SEL+ K EE  R IND      + Q    E   +L+E ++ ++QL + KQ    Q+EE +   EEE++AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ E EE  E   +K   LEK K RLQ E+ED+++DV+R+N   + L+KKQ+ FDKV+SEW+QKY E+QAELEASQ+ESR++S E+F++K   EES +QLE+++RENKNL  EI DLTEQI EGG+ +HE++K +K++E EK E+Q ALEEAE +LE EE K  R QLE++Q++ E+DR++AEK+EE +  + NH R +E+M+++L+AE R R +A ++KKK+E D+ E+E+ ++ ANR+ +E  +N +  Q  ++E    ++D    ++ ++EQ  + ER+  ++ AE+EE+  +LE +ER+RK  E E ++ ++R+  L  Q++  + TK+KLE D++ +QS++EE   E+R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK LE   K+LQ +LDE+E  ALKGGKK + KLE RVRELE E++ EQKR+ E+ K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K+YKRQ EEAEE +  NL+K+RK+Q E+E++EERAD AE  + KLR K+R
Sbjct:   18 YLRKSEKERIEAQNKPFDAKTSVFVAEPKESYVKSTIQSKEGGKVTVKTEGGATLTVREDQVFPMNPPKYDKIEDMAMMTHLHEPGVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYKPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKDESG---KMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQITSNKKPDLIEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIDILGFTPEEKVSIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTVQQVYNAVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPLGIFSILEEECMFPKATDTSFKNKLYDQHLGKSANF-QKPKVVKGKAEAHFSLIHYAGTVDYNITGWLDKNKDPLNDTVVGLYQKSAMKTLASLFSTYASAEADSSAKKGAKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVFFKAGLLGLLEEMRDEKLAQIITRTQAVCRGFLMRVEYQKMLQRREALFCIQYNVRAFMNVKHWPWMKLFFKIKPLLKSAETEKEMATMKEEFQKTKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQSEADSLADAEERCEQLIKNKIQLEAKIKEVTERAEEEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLSKEKKALQETHQQTLDDLQAEEDKVNILTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDMENDKQQLDEKLEKKEFEISNLISKIEDEQAVEIQLQKKIKELQARIEELGEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQVELNKKREAEFQKLRRDLEEATLQHEAMVAALRKKHADSMAELGEQIDNLQRVKQKLEKEKSELKMETDDLSSNAEAISKAKGNLEKMCRSLEDQVSELKTKEEEQQRLINDLTAQRARLQTEAGEYSRQLDEKDALVSQLSRSKQASTQQIEELKHQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERSNAACAALDKKQRNFDKVLSEWKQKYEETQAELEASQKESRSLSTELFKVKNVYEESLDQLETLRRENKNLQQEISDLTEQIAEGGKQIHELEKIKKQVEQEKCEIQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHTRVVETMQSTLDAEIRSRNDALRVKKKMEGDLNEMEIQLNHANRLAAESLRNYRNTQGILKETQLHLDDALRGQEDLKEQLAIVERRANLLQAEIEELWATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLENDVSQLQSEVEEVIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELEGEVENEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNVLRLQDLVDKLQAKVKSYKRQAEEAEEQSNANLSKFRKLQHELEEAEERADIAESQVNKLRVKSR 1928          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH2 (myosin heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:7572])

HSP 1 Score: 1745.71 bits (4520), Expect = 0.000e+0
Identity = 1014/1902 (53.31%), Postives = 1399/1902 (73.55%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAED--------PNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            FD+K + ++ + KE+F+  TI+   G   TVKT+   T TVK D++  MNPPK+  IEDMA +T L++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y P+V++ Y+GK+R E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +A   +K++++  +G K +GTLEDQI+ ANP+LEA+GNAKTVRN+NSSRFGKFIRIHFGT+GK+A ADIE YLLEKSRV  Q K ER+YHIFYQI SN      E LLI+ +P  Y F++QGE+++  +DD+EE+  TD A DILGF+ EEK+S++K T ++++ G +KFKQ+ REEQAE DGT  A+K A+L  +N+ DL++++  P+VKVGNEYVTKGQ  +QV  +VGALAK++Y +MF W+V R+N+ LDTK  RQ+FIGVLDIAGFEIF+FN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDL ACIELIEKPMGI SILEEECMFPKA+D +FK KLYD HLGKS NF +      G+AEAHF L HYAG V YN+TGWLEKNKDPLNETV+ L   S    ++ LF+ A+             G +KKG + QT+S+  RE+LNKLM NL+ST PHF+RCI+PNE K PG ++  LVLHQL CNGVLEGIRICRKGFP+R++Y++FKQRY +L  +AIP+G F++ K+ + K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRD+KL+ LI+  QA+ RG+L R +Y+++ ++R A+  IQ NIR ++ ++ WPW KL+ K+KPLL  A  E+EM    EE  K+K+E  K +  +KELEE+ V LL+ KNDL LQ+Q E + LADAEE+  +L+  K  +E +IKE+ +   +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK  QE++ D+E  K++L+E+LK+KE E+ N  SKIEDE  L  QLQ+KIKELQARI+ELEE++EAER +RAKAEK R  L  ELEE+S+RLEE GGATSAQ+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+EMK +++DL   +E+++KAK N +K  + +E Q SEL+ K EE  R IND     G+ Q  + E   +L+E E+ ++QL + KQ    Q+EE ++  EEE +AK  L+  +++   D D LRE  EEE E+K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+   EE  E   +K   LEK K RLQ E+ED+++DV+R N   + L+KKQ+ FDK+++EW+QK  E+ AELEASQ+E+R++  E+F++K   EES +QLE++KRENKNL  EI DLTEQI EGG+ +HE++K +K++E EK ELQ ALEEAE +LE EE K  R QLE++Q++ E+DR++AEK+EE +  + NH R +ESM+++L+AE R R +A ++KKK+E D+ E+E+ ++ ANR+ +E  +N +  Q  +++    ++D    ++ ++EQ  M ER+  ++ AE+EE+R +LE +ER+RK  E E ++ ++R+  L  Q++  + TK+KLE D++ MQ ++E+   EAR A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK + KLE RVRELE E++ EQKR+ E+ K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K+YKRQ EEAEE +  NLAK+RK+Q E+E++EERAD AE  + KLR K+R
Sbjct:   32 FDAKTSVFVAEPKESFVKGTIQSREGGKVTVKTEGGATLTVKDDQVFPMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYKPEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKEEITSG-KIQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVVFQLKAERSYHIFYQITSNKKPELIEMLLITTNPYDYPFVSQGEISVASIDDQEELMATDSAIDILGFTNEEKVSIYKLTGAVMHYGNLKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTVEQVSNAVGALAKAVYEKMFLWMVARINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYDQHLGKSANF-QKPKVVKGKAEAHFALIHYAGVVDYNITGWLEKNKDPLNETVVGLYQKSAMKTLAQLFSGAQTAEGEGAGGGAKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVFFKAGLLGLLEEMRDDKLAQLITRTQARCRGFLARVEYQRMVERREAIFCIQYNIRSFMNVKHWPWMKLFFKIKPLLKSAETEKEMATMKEEFQKIKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQAEAEGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKIKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEISNLQSKIEDEQALGIQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNVETVSKAKGNLEKMCRTLEDQLSELKSKEEEQQRLINDLTAQRGRLQTESGEFSRQLDEKEALVSQLSRGKQAFTQQIEELKRQLEEEIKAKNALAHALQSSRHDCDLLREQYEEEQESKAELQRALSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQAAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERTNAACAALDKKQRNFDKILAEWKQKCEETHAELEASQKEARSLGTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKCELQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHIRIVESMQSTLDAEIRSRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQIHLDDALRSQEDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQMQGEMEDILQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQLRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNTNLAKFRKLQHELEEAEERADIAESQVNKLRVKSR 1931          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH2 (myosin heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:7572])

HSP 1 Score: 1745.71 bits (4520), Expect = 0.000e+0
Identity = 1014/1902 (53.31%), Postives = 1399/1902 (73.55%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAED--------PNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            FD+K + ++ + KE+F+  TI+   G   TVKT+   T TVK D++  MNPPK+  IEDMA +T L++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y P+V++ Y+GK+R E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +A   +K++++  +G K +GTLEDQI+ ANP+LEA+GNAKTVRN+NSSRFGKFIRIHFGT+GK+A ADIE YLLEKSRV  Q K ER+YHIFYQI SN      E LLI+ +P  Y F++QGE+++  +DD+EE+  TD A DILGF+ EEK+S++K T ++++ G +KFKQ+ REEQAE DGT  A+K A+L  +N+ DL++++  P+VKVGNEYVTKGQ  +QV  +VGALAK++Y +MF W+V R+N+ LDTK  RQ+FIGVLDIAGFEIF+FN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDL ACIELIEKPMGI SILEEECMFPKA+D +FK KLYD HLGKS NF +      G+AEAHF L HYAG V YN+TGWLEKNKDPLNETV+ L   S    ++ LF+ A+             G +KKG + QT+S+  RE+LNKLM NL+ST PHF+RCI+PNE K PG ++  LVLHQL CNGVLEGIRICRKGFP+R++Y++FKQRY +L  +AIP+G F++ K+ + K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRD+KL+ LI+  QA+ RG+L R +Y+++ ++R A+  IQ NIR ++ ++ WPW KL+ K+KPLL  A  E+EM    EE  K+K+E  K +  +KELEE+ V LL+ KNDL LQ+Q E + LADAEE+  +L+  K  +E +IKE+ +   +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK  QE++ D+E  K++L+E+LK+KE E+ N  SKIEDE  L  QLQ+KIKELQARI+ELEE++EAER +RAKAEK R  L  ELEE+S+RLEE GGATSAQ+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+EMK +++DL   +E+++KAK N +K  + +E Q SEL+ K EE  R IND     G+ Q  + E   +L+E E+ ++QL + KQ    Q+EE ++  EEE +AK  L+  +++   D D LRE  EEE E+K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+   EE  E   +K   LEK K RLQ E+ED+++DV+R N   + L+KKQ+ FDK+++EW+QK  E+ AELEASQ+E+R++  E+F++K   EES +QLE++KRENKNL  EI DLTEQI EGG+ +HE++K +K++E EK ELQ ALEEAE +LE EE K  R QLE++Q++ E+DR++AEK+EE +  + NH R +ESM+++L+AE R R +A ++KKK+E D+ E+E+ ++ ANR+ +E  +N +  Q  +++    ++D    ++ ++EQ  M ER+  ++ AE+EE+R +LE +ER+RK  E E ++ ++R+  L  Q++  + TK+KLE D++ MQ ++E+   EAR A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK + KLE RVRELE E++ EQKR+ E+ K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K+YKRQ EEAEE +  NLAK+RK+Q E+E++EERAD AE  + KLR K+R
Sbjct:   32 FDAKTSVFVAEPKESFVKGTIQSREGGKVTVKTEGGATLTVKDDQVFPMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYKPEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKEEITSG-KIQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVVFQLKAERSYHIFYQITSNKKPELIEMLLITTNPYDYPFVSQGEISVASIDDQEELMATDSAIDILGFTNEEKVSIYKLTGAVMHYGNLKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTVEQVSNAVGALAKAVYEKMFLWMVARINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYDQHLGKSANF-QKPKVVKGKAEAHFALIHYAGVVDYNITGWLEKNKDPLNETVVGLYQKSAMKTLAQLFSGAQTAEGEGAGGGAKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVFFKAGLLGLLEEMRDDKLAQLITRTQARCRGFLARVEYQRMVERREAIFCIQYNIRSFMNVKHWPWMKLFFKIKPLLKSAETEKEMATMKEEFQKIKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQAEAEGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKIKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEISNLQSKIEDEQALGIQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNVETVSKAKGNLEKMCRTLEDQLSELKSKEEEQQRLINDLTAQRGRLQTESGEFSRQLDEKEALVSQLSRGKQAFTQQIEELKRQLEEEIKAKNALAHALQSSRHDCDLLREQYEEEQESKAELQRALSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQAAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERTNAACAALDKKQRNFDKILAEWKQKCEETHAELEASQKEARSLGTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKCELQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHIRIVESMQSTLDAEIRSRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQIHLDDALRSQEDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQMQGEMEDILQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQLRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNTNLAKFRKLQHELEEAEERADIAESQVNKLRVKSR 1931          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: myo-5 (MYOsin heavy chain structural genes [Source:UniProtKB/TrEMBL;Acc:Q21000])

HSP 1 Score: 1769.21 bits (4581), Expect = 0.000e+0
Identity = 1046/1949 (53.67%), Postives = 1412/1949 (72.45%), Query Frame = 3
Query:   93 SDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTK-VKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASK-EALVSSL---FAPAED---------PNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVE---GKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 5888
            +DP +Q+L    + L+      FDSKKN W+ D +E FIAA I+ + GD   V T K   KT+KKD+ +QMNPPK+   EDMANLTFLNDASVL NLRQRYY  +IYTYSGLFCV INPYKR PIY+  V   Y GKRR EMPPH+F++SD AY NM  DR+NQS+LITGESGAGKTENTKKVI+YFA V A+ +  +  +    K + +LEDQIVQ NPVLEA+GNAKTVRNNNSSRFGKFIRIHF T GK+AGADIE YLLEKSRV  Q  GER+YHIFYQI S+  K   EKL ++     Y+F++Q E+TIDGVDD+EEM ITDEAFDI+ F+A EK  LF  T  I++MGE+KFKQRPREEQAE +   E E    L  V ++  + ++LKP+VKVG E+V KGQN DQV ++VGALAK+L+ RMF+WL+ R NKTLD + + R FFIGVLDIAGFEIF+ N FEQ+ IN+ NE+LQQFFNHHMFVLEQEEYK+E I WEFIDFG+DLQACIELIEKP+GI+S+L+EEC+ PKASD+T  +KL D HLGK PNF KP+PPK  QAEAH  + HYAG+V YNV GWLEKNKDPLN+T + +L A+K   L++ L   +A  ED              K+ K  +  T+S  +RESLNKLM  L  T PHFIRCI+PNE K+ G+IDA+LVL+QL CNGVLEGIRICRKGFPNRM + +FKQRY++LA +A   G      G+++++ +++   L    ++ G TKVFFKAG LA LE++RDE L  +++ FQ   R YL + +YK+  DQ+V L ++QRNIR +  LR+W W+KL+ +VKPL+  +++ EE +   ++   L+EE  + ++ +K++E +N +L   K  L +QL+ E+DS A+ EE+ +KL+ QKAD+E ++  + D L +EE+  A L   KKK++ + E LKK V DLE++++K E EK AKD QI+SLQD++  Q+E ++KL KEKK  +EV +K  E + AEE+KV +LNK KAKLE T+DE+E+ L RE++ R D EK +RK+E ELK  QE +++L R K E E+ +K+K++EL +  S++EDE  LVA+LQR+IKEL ARIQELEE+L+AER +R+KAEK+R++++ ELEEL DRL+E GGAT AQ++LNKKREAEL KL++DLE++ +  +  +A  RKK  D V E S+QLD +QK++ K+E+EKN+ + ++++LQ   +   K + N ++  K++EAQ +++  K +E  R I +      K    N +L  +LE+AE+Q+  L ++KQQ  +QLEE ++  ++E+R +  L S V N   + +  RE+LEEE + K+D+QRQL KA  E+QQ +AKFEG G  R+EEL+E +RK   ++ E++E+ E A  K G LEK K RL  ++ED  VD DRAN++AS LEKKQK FDKV+ EW++K     AE+E SQRE+R  + E FR++ Q+EES EQ E+VKRENK LA E+ D+ +Q+GEGG+SVH++ K R+RLE+EKEELQ AL+EAE ALE EEAK  R+Q+E+SQIR EI++RL EKEEEFE TR NH R +ESM+ SLE ESRGRAE  K KKKLE D+ ELE+A+D +N++  + +K+ KK Q  ++EL   VE+E+    + R+   + ER+  ++  E E++    E SER R+  E E  E+ D +NELS  +S  +ATKRK+E DL  +QS++EEA ++A+ ++E+AKKA+ D+++L DE+R EQEHA  +++ KK LE+Q K+LQ +LDE+E   +KGGK+ L+KL+ R+ ELE EL+GE +RH E+QK  R  +R+ +EL  Q DEDKK+QER+ DL+EKLQ KIKTYKRQ+E+AE +A+ NLAKYR++Q  +ED++ERAD AE ALQKLR K RS+        +A  M+T
Sbjct:    5 ADPGWQFLRQSPEQLLAATTKKFDSKKNVWVADPEEGFIAAEIKSSKGDTVVVVTSKGVEKTIKKDDAQQMNPPKYEKTEDMANLTFLNDASVLHNLRQRYYSMMIYTYSGLFCVVINPYKRLPIYSESVCQMYLGKRRNEMPPHLFAVSDEAYRNMTNDRENQSMLITGESGAGKTENTKKVISYFAMVGASQQSNKKKSKK-DKAQVSLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNTGGKVAGADIEHYLLEKSRVIKQAPGERSYHIFYQIYSDAVKGLREKLFLTRPIKEYTFVSQAEVTIDGVDDKEEMLITDEAFDIMKFTATEKSELFAITAGIMHMGELKFKQRPREEQAELEEGKEGELACKLYCVESEKFINALLKPRVKVGTEWVNKGQNLDQVNWAVGALAKALFARMFSWLIRRCNKTLDAQDLSRDFFIGVLDIAGFEIFDLNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYKREGIQWEFIDFGLDLQACIELIEKPLGIVSMLDEECIVPKASDLTLASKLNDQHLGKHPNFQKPRPPKGKQAEAHLAIVHYAGTVRYNVKGWLEKNKDPLNDTAVTVLKANKGNQLMADLWADYATQEDVAAAAKDGKKAVGKKKGKSASFMTVSMMYRESLNKLMHMLHQTHPHFIRCIIPNELKKAGMIDANLVLNQLTCNGVLEGIRICRKGFPNRMPFLDFKQRYAVLAADAAKAGKDPKDAGEKISAALIKDGSLKQEEFQCGLTKVFFKAGVLAHLEELRDEALGKIMAKFQCACRHYLAQCEYKRKLDQKVGLIVLQRNIRAWCTLRSWSWFKLFGRVKPLIKGSKKNEEFEALEKKFKVLEEEKTQEERKRKDMEAENARLEAEKQALLIQLEQERDSSAEGEERSAKLLAQKADLEKQMANMNDQLCDEEEKNAALTKQKKKIEQDNEGLKKTVSDLETTIKKQESEKQAKDHQIRSLQDEIQSQDEVISKLNKEKKHQEEVNRKLLEDIQAEEDKVNHLNKTKAKLESTLDELEDTLEREKRGRQDCEKQRRKVEGELKIAQELIEELNRHKHEQEQVIKKKDIELSSIQSRLEDEQSLVAKLQRQIKELLARIQELEEELDAERNSRSKAEKARNEMQMELEELGDRLDEAGGATQAQIELNKKREAELAKLRQDLEDAAINSETSMAALRKKHNDAVAELSDQLDTIQKMRGKLEREKNDKQREVDELQQSADVEAKQRQNCERMAKQLEAQLTDMTLKSDEQARLIQELTMGKNKVHNENQDLNRQLEDAEAQLCALNRIKQQQHSQLEELKRTLDQETRERQSLHSQVSNYQLECEQFRESLEEEQDAKTDVQRQLSKANSEIQQWRAKFEGEGVSRAEELEETRRKLTHKVQEMQEQLENANQKIGTLEKNKQRLAHDLEDAQVDADRANSIASSLEKKQKGFDKVLDEWRRKCEALVAEVEQSQRETRAAATETFRLRNQLEESGEQTEAVKRENKALAQELKDIADQLGEGGKSVHDLQKMRRRLEIEKEELQQALDEAECALEAEEAKVMRAQIEVSQIRSEIEKRLQEKEEEFENTRKNHSRTIESMQVSLETESRGRAELLKTKKKLEGDVNELEIALDHSNKLNVDGQKSMKKLQDTIRELQYQVEEEQRSLSESRDHANLAERRSQVLQQEKEDLAIIYEQSERTRRQAELELAEVKDSVNELSNSNSLLLATKRKVEGDLQLLQSEIEEAMSDAKTSDEKAKKAIMDASKLADELRSEQEHASNLNQSKKTLESQVKDLQMRLDEAEAAGIKGGKRQLAKLDMRIHELETELEGENRRHAETQKVLRNKDRKCRELQFQVDEDKKSQERMYDLIEKLQQKIKTYKRQIEDAESLASGNLAKYRQLQHVVEDAQERADAAENALQKLRLKGRSTSGVFGPRGLAHSMST 1952          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 1733.77 bits (4489), Expect = 0.000e+0
Identity = 1040/1939 (53.64%), Postives = 1411/1939 (72.77%), Query Frame = 3
Query:   96 DPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPAL-YSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTK-VKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASK-EALVSSLF-----------APAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGK---QVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARG 5861
            DP +QYL   R+ +++     +DSKKN WIPD +E ++A  I    GD  T+ T +    T+KK+ +++MNPPKF   EDM+NL+FLNDASVL NLR RY   LIYTYSGLFCV INPYKR PIYT      + GKR+TEMPPH+F++SD AY NML D +NQS+LITGESGAGKTENTKKVI YFA V A +++E        K+K TLEDQIVQ NPVLEA+GNAKTVRNNNSSRFGKFIRIHF   G++A  DIE YLLEKSRV  Q  GER YHIFYQI S+  +P  +K L+   P   Y F+ Q EL IDG+DD EE ++TDEAFDIL FSA EK   ++   + ++MG MKFKQRPREEQAE DGT EAEK + + G+  ++ ++++ KP+VKVG E+V+KGQN +QV ++VGA+AK LY+R+F WLV + N TLD K + R +FIGVLDIAGFEIF+FN FEQ+ IN+ NE+LQQFFNHHMFVLEQEEY +E I W FIDFG+DLQACIELIEKP+GI+S+L+EEC+ PKA+D+T  +KL D HLGK PNF KPKPPK  Q EAHF + HYAG+V YN   WLEKNKDPLN+TV++ +  SK   L+  ++              E      K+ K G+  T+S  +RESLN LM  L  T PHFIRCI+PNE KQ G+IDA LVL+QL CNGVLEGIRICRKGFPNR ++ +F QRY+ILA         + K    + SK++    L   ++R+G TKVFFKAG LA LED+RDEKL+++++ FQ+QIR +L  +  K+  +QR  L I+QRN+R +  LRTW W+KLY KVKP+L   ++ EE++K  +++  L++   K +K +KELEE + KL+E K  LF  L++ +  L+DAEE+++KL  Q+ D   ++ EL D L + ED  A ++  KKK++ E+E LKK + DLE SL+KAE EK +KD QI+SLQD+M +Q+E + KL KEKK  +E+ +K  E L +EE+K  + NK KAKLEQT+D++E++L RE++ RAD++K KRK+E ELK  QE +D+  R + +LE  LK+KE EL + SS++EDE  LV++LQR+IK+ Q+RI ELEE+LE ERQ+R+KA++++  L+ ELEEL ++L+EQGGAT+AQ+++NKKREAEL KL+RDLEE+NM H+  +   RKK  D V E ++QLDQL K KAKVEK+K +   D  DL  QL+     K N++K  K+ E Q +ELQ K +E +R + D  +  G+    N +L  +LE+AESQ+NQL ++K Q+ +QLEEAR+ A+EE+R +  +++  +N   + + L+E+LEEE E K++I RQL KA  ++QQ KA+FEG G ++++EL++AKR+   +I+EL+E  + A SK   LEK K+RL G+++D  VDV+RAN +AS LEKKQK FDK++ EW++K  +  AEL+ +QR+ R  S ++F+ K   EE  E +E ++RENK+L+ EI DLT+Q+GEGGRSVHE+ K  +RLE+EKEELQHAL+EAE ALE EE+K  R+Q+E+SQIR EI++R+ EKEEEFE TR NH RA+ESM+ASLE E++G+AE  ++KKKLE DI ELE+A+D AN+  ++ +KN K++Q+QV+EL   VE+E+      REQ    E++ T++ +E EE+  + E +ER RK  E E  +  D+ NE + Q S   + KRKLE ++ A+ +DL+E   E + A E++KKA+AD+ RL +E+RQEQEH+Q +D+++K LE Q KE+Q +LDE+E  ALKGGKK ++KLEQRVRELE+ELDGEQ+R  ++ KN  + +RR++EL  Q DEDKKN ERLQDL++KLQ K+KT K+QVEEAEE+A +NL KY+++  ++ED+EERADQAE +L K+R+K+R+S S A G
Sbjct:    6 DPGWQYLRRTREQVLEDQSKPYDSKKNVWIPDPEEGYLAGEITATKGDQVTIVTARGNEVTLKKELVQEMNPPKFEKTEDMSNLSFLNDASVLHNLRSRYAAMLIYTYSGLFCVVINPYKRLPIYTDSCARMFMGKRKTEMPPHLFAVSDEAYRNMLQDHENQSMLITGESGAGKTENTKKVICYFAAVGA-SQQEGGAEVDPNKKKVTLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNKHGRLASCDIEHYLLEKSRVIRQAPGERCYHIFYQIYSD-FRPELKKELLLDLPIKDYWFVAQAELIIDGIDDVEEFQLTDEAFDILNFSAVEKQDCYRLMSAHMHMGNMKFKQRPREEQAEPDGTDEAEKASNMYGIGCEEFLKALTKPRVKVGTEWVSKGQNCEQVNWAVGAMAKGLYSRVFNWLVKKCNLTLDQKGIDRDYFIGVLDIAGFEIFDFNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYAREGIQWVFIDFGLDLQACIELIEKPLGIISMLDEECIVPKATDLTLASKLVDQHLGKHPNFEKPKPPKGKQGEAHFAMRHYAGTVRYNCLNWLEKNKDPLNDTVVSAMKQSKGNDLLVEIWQDYTTQEEAAAKAKEGGGGGKKKGKSGSFMTVSMLYRESLNNLMTMLNKTHPHFIRCIIPNEKKQSGMIDAALVLNQLTCNGVLEGIRICRKGFPNRTLHPDFVQRYAILAAKEAKSDDDKKKCAEAIMSKLVNDGSLSEEMFRIGLTKVFFKAGVLAHLEDIRDEKLATILTGFQSQIRWHLGLKDRKRRMEQRAGLLIVQRNVRSWCTLRTWEWFKLYGKVKPMLKAGKEAEELEKINDKVKALEDSLAKEEKLRKELEESSAKLVEEKTSLFTNLESTKTQLSDAEERLAKLEAQQKDASKQLSELNDQLADNEDRTADVQRAKKKIEAEVEALKKQIQDLEMSLRKAESEKQSKDHQIRSLQDEMQQQDEAIAKLNKEKKHQEEINRKLMEDLQSEEDKGNHQNKVKAKLEQTLDDLEDSLEREKRARADLDKQKRKVEGELKIAQENIDESGRQRHDLENNLKKKESELHSVSSRLEDEQALVSKLQRQIKDGQSRISELEEELENERQSRSKADRAKSDLQRELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAVAELTDQLDQLNKAKAKVEKDKAQAVRDAEDLAAQLDQETSGKLNNEKLAKQFELQLTELQSKADEQSRQLQDFTSLKGRLHSENGDLVRQLEDAESQVNQLTRLKSQLTSQLEEARRTADEEARERQTVAAQAKNYQHEAEQLQESLEEEIEGKNEILRQLSKANADIQQWKARFEGEGLLKADELEDAKRRQAQKINELQEALDAANSKNASLEKTKSRLVGDLDDAQVDVERANGVASALEKKQKGFDKIIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGLRRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHARALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNGADTREQFFNAEKRATLLQSEKEELLVANEAAERARKQAEYEAADARDQANEANAQVSSLTSAKRKLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQHVDRLRKGLEQQLKEIQVRLDEAEAAALKGGKKVIAKLEQRVRELESELDGEQRRFQDANKNLGRADRRVRELQFQVDEDKKNFERLQDLIDKLQQKLKTQKKQVEEAEELANLNLQKYKQLTHQLEDAEERADQAENSLSKMRSKSRASASVAPG 1942          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 1733.77 bits (4489), Expect = 0.000e+0
Identity = 1040/1939 (53.64%), Postives = 1411/1939 (72.77%), Query Frame = 3
Query:   96 DPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPAL-YSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTK-VKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASK-EALVSSLF-----------APAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGK---QVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARG 5861
            DP +QYL   R+ +++     +DSKKN WIPD +E ++A  I    GD  T+ T +    T+KK+ +++MNPPKF   EDM+NL+FLNDASVL NLR RY   LIYTYSGLFCV INPYKR PIYT      + GKR+TEMPPH+F++SD AY NML D +NQS+LITGESGAGKTENTKKVI YFA V A +++E        K+K TLEDQIVQ NPVLEA+GNAKTVRNNNSSRFGKFIRIHF   G++A  DIE YLLEKSRV  Q  GER YHIFYQI S+  +P  +K L+   P   Y F+ Q EL IDG+DD EE ++TDEAFDIL FSA EK   ++   + ++MG MKFKQRPREEQAE DGT EAEK + + G+  ++ ++++ KP+VKVG E+V+KGQN +QV ++VGA+AK LY+R+F WLV + N TLD K + R +FIGVLDIAGFEIF+FN FEQ+ IN+ NE+LQQFFNHHMFVLEQEEY +E I W FIDFG+DLQACIELIEKP+GI+S+L+EEC+ PKA+D+T  +KL D HLGK PNF KPKPPK  Q EAHF + HYAG+V YN   WLEKNKDPLN+TV++ +  SK   L+  ++              E      K+ K G+  T+S  +RESLN LM  L  T PHFIRCI+PNE KQ G+IDA LVL+QL CNGVLEGIRICRKGFPNR ++ +F QRY+ILA         + K    + SK++    L   ++R+G TKVFFKAG LA LED+RDEKL+++++ FQ+QIR +L  +  K+  +QR  L I+QRN+R +  LRTW W+KLY KVKP+L   ++ EE++K  +++  L++   K +K +KELEE + KL+E K  LF  L++ +  L+DAEE+++KL  Q+ D   ++ EL D L + ED  A ++  KKK++ E+E LKK + DLE SL+KAE EK +KD QI+SLQD+M +Q+E + KL KEKK  +E+ +K  E L +EE+K  + NK KAKLEQT+D++E++L RE++ RAD++K KRK+E ELK  QE +D+  R + +LE  LK+KE EL + SS++EDE  LV++LQR+IK+ Q+RI ELEE+LE ERQ+R+KA++++  L+ ELEEL ++L+EQGGAT+AQ+++NKKREAEL KL+RDLEE+NM H+  +   RKK  D V E ++QLDQL K KAKVEK+K +   D  DL  QL+     K N++K  K+ E Q +ELQ K +E +R + D  +  G+    N +L  +LE+AESQ+NQL ++K Q+ +QLEEAR+ A+EE+R +  +++  +N   + + L+E+LEEE E K++I RQL KA  ++QQ KA+FEG G ++++EL++AKR+   +I+EL+E  + A SK   LEK K+RL G+++D  VDV+RAN +AS LEKKQK FDK++ EW++K  +  AEL+ +QR+ R  S ++F+ K   EE  E +E ++RENK+L+ EI DLT+Q+GEGGRSVHE+ K  +RLE+EKEELQHAL+EAE ALE EE+K  R+Q+E+SQIR EI++R+ EKEEEFE TR NH RA+ESM+ASLE E++G+AE  ++KKKLE DI ELE+A+D AN+  ++ +KN K++Q+QV+EL   VE+E+      REQ    E++ T++ +E EE+  + E +ER RK  E E  +  D+ NE + Q S   + KRKLE ++ A+ +DL+E   E + A E++KKA+AD+ RL +E+RQEQEH+Q +D+++K LE Q KE+Q +LDE+E  ALKGGKK ++KLEQRVRELE+ELDGEQ+R  ++ KN  + +RR++EL  Q DEDKKN ERLQDL++KLQ K+KT K+QVEEAEE+A +NL KY+++  ++ED+EERADQAE +L K+R+K+R+S S A G
Sbjct:    6 DPGWQYLRRTREQVLEDQSKPYDSKKNVWIPDPEEGYLAGEITATKGDQVTIVTARGNEVTLKKELVQEMNPPKFEKTEDMSNLSFLNDASVLHNLRSRYAAMLIYTYSGLFCVVINPYKRLPIYTDSCARMFMGKRKTEMPPHLFAVSDEAYRNMLQDHENQSMLITGESGAGKTENTKKVICYFAAVGA-SQQEGGAEVDPNKKKVTLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNKHGRLASCDIEHYLLEKSRVIRQAPGERCYHIFYQIYSD-FRPELKKELLLDLPIKDYWFVAQAELIIDGIDDVEEFQLTDEAFDILNFSAVEKQDCYRLMSAHMHMGNMKFKQRPREEQAEPDGTDEAEKASNMYGIGCEEFLKALTKPRVKVGTEWVSKGQNCEQVNWAVGAMAKGLYSRVFNWLVKKCNLTLDQKGIDRDYFIGVLDIAGFEIFDFNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYAREGIQWVFIDFGLDLQACIELIEKPLGIISMLDEECIVPKATDLTLASKLVDQHLGKHPNFEKPKPPKGKQGEAHFAMRHYAGTVRYNCLNWLEKNKDPLNDTVVSAMKQSKGNDLLVEIWQDYTTQEEAAAKAKEGGGGGKKKGKSGSFMTVSMLYRESLNNLMTMLNKTHPHFIRCIIPNEKKQSGMIDAALVLNQLTCNGVLEGIRICRKGFPNRTLHPDFVQRYAILAAKEAKSDDDKKKCAEAIMSKLVNDGSLSEEMFRIGLTKVFFKAGVLAHLEDIRDEKLATILTGFQSQIRWHLGLKDRKRRMEQRAGLLIVQRNVRSWCTLRTWEWFKLYGKVKPMLKAGKEAEELEKINDKVKALEDSLAKEEKLRKELEESSAKLVEEKTSLFTNLESTKTQLSDAEERLAKLEAQQKDASKQLSELNDQLADNEDRTADVQRAKKKIEAEVEALKKQIQDLEMSLRKAESEKQSKDHQIRSLQDEMQQQDEAIAKLNKEKKHQEEINRKLMEDLQSEEDKGNHQNKVKAKLEQTLDDLEDSLEREKRARADLDKQKRKVEGELKIAQENIDESGRQRHDLENNLKKKESELHSVSSRLEDEQALVSKLQRQIKDGQSRISELEEELENERQSRSKADRAKSDLQRELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAVAELTDQLDQLNKAKAKVEKDKAQAVRDAEDLAAQLDQETSGKLNNEKLAKQFELQLTELQSKADEQSRQLQDFTSLKGRLHSENGDLVRQLEDAESQVNQLTRLKSQLTSQLEEARRTADEEARERQTVAAQAKNYQHEAEQLQESLEEEIEGKNEILRQLSKANADIQQWKARFEGEGLLKADELEDAKRRQAQKINELQEALDAANSKNASLEKTKSRLVGDLDDAQVDVERANGVASALEKKQKGFDKIIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGLRRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHARALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNGADTREQFFNAEKRATLLQSEKEELLVANEAAERARKQAEYEAADARDQANEANAQVSSLTSAKRKLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQHVDRLRKGLEQQLKEIQVRLDEAEAAALKGGKKVIAKLEQRVRELESELDGEQRRFQDANKNLGRADRRVRELQFQVDEDKKNFERLQDLIDKLQQKLKTQKKQVEEAEELANLNLQKYKQLTHQLEDAEERADQAENSLSKMRSKSRASASVAPG 1942          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 1733.77 bits (4489), Expect = 0.000e+0
Identity = 1040/1939 (53.64%), Postives = 1411/1939 (72.77%), Query Frame = 3
Query:   96 DPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPAL-YSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTK-VKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASK-EALVSSLF-----------APAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGK---QVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARG 5861
            DP +QYL   R+ +++     +DSKKN WIPD +E ++A  I    GD  T+ T +    T+KK+ +++MNPPKF   EDM+NL+FLNDASVL NLR RY   LIYTYSGLFCV INPYKR PIYT      + GKR+TEMPPH+F++SD AY NML D +NQS+LITGESGAGKTENTKKVI YFA V A +++E        K+K TLEDQIVQ NPVLEA+GNAKTVRNNNSSRFGKFIRIHF   G++A  DIE YLLEKSRV  Q  GER YHIFYQI S+  +P  +K L+   P   Y F+ Q EL IDG+DD EE ++TDEAFDIL FSA EK   ++   + ++MG MKFKQRPREEQAE DGT EAEK + + G+  ++ ++++ KP+VKVG E+V+KGQN +QV ++VGA+AK LY+R+F WLV + N TLD K + R +FIGVLDIAGFEIF+FN FEQ+ IN+ NE+LQQFFNHHMFVLEQEEY +E I W FIDFG+DLQACIELIEKP+GI+S+L+EEC+ PKA+D+T  +KL D HLGK PNF KPKPPK  Q EAHF + HYAG+V YN   WLEKNKDPLN+TV++ +  SK   L+  ++              E      K+ K G+  T+S  +RESLN LM  L  T PHFIRCI+PNE KQ G+IDA LVL+QL CNGVLEGIRICRKGFPNR ++ +F QRY+ILA         + K    + SK++    L   ++R+G TKVFFKAG LA LED+RDEKL+++++ FQ+QIR +L  +  K+  +QR  L I+QRN+R +  LRTW W+KLY KVKP+L   ++ EE++K  +++  L++   K +K +KELEE + KL+E K  LF  L++ +  L+DAEE+++KL  Q+ D   ++ EL D L + ED  A ++  KKK++ E+E LKK + DLE SL+KAE EK +KD QI+SLQD+M +Q+E + KL KEKK  +E+ +K  E L +EE+K  + NK KAKLEQT+D++E++L RE++ RAD++K KRK+E ELK  QE +D+  R + +LE  LK+KE EL + SS++EDE  LV++LQR+IK+ Q+RI ELEE+LE ERQ+R+KA++++  L+ ELEEL ++L+EQGGAT+AQ+++NKKREAEL KL+RDLEE+NM H+  +   RKK  D V E ++QLDQL K KAKVEK+K +   D  DL  QL+     K N++K  K+ E Q +ELQ K +E +R + D  +  G+    N +L  +LE+AESQ+NQL ++K Q+ +QLEEAR+ A+EE+R +  +++  +N   + + L+E+LEEE E K++I RQL KA  ++QQ KA+FEG G ++++EL++AKR+   +I+EL+E  + A SK   LEK K+RL G+++D  VDV+RAN +AS LEKKQK FDK++ EW++K  +  AEL+ +QR+ R  S ++F+ K   EE  E +E ++RENK+L+ EI DLT+Q+GEGGRSVHE+ K  +RLE+EKEELQHAL+EAE ALE EE+K  R+Q+E+SQIR EI++R+ EKEEEFE TR NH RA+ESM+ASLE E++G+AE  ++KKKLE DI ELE+A+D AN+  ++ +KN K++Q+QV+EL   VE+E+      REQ    E++ T++ +E EE+  + E +ER RK  E E  +  D+ NE + Q S   + KRKLE ++ A+ +DL+E   E + A E++KKA+AD+ RL +E+RQEQEH+Q +D+++K LE Q KE+Q +LDE+E  ALKGGKK ++KLEQRVRELE+ELDGEQ+R  ++ KN  + +RR++EL  Q DEDKKN ERLQDL++KLQ K+KT K+QVEEAEE+A +NL KY+++  ++ED+EERADQAE +L K+R+K+R+S S A G
Sbjct:    6 DPGWQYLRRTREQVLEDQSKPYDSKKNVWIPDPEEGYLAGEITATKGDQVTIVTARGNEVTLKKELVQEMNPPKFEKTEDMSNLSFLNDASVLHNLRSRYAAMLIYTYSGLFCVVINPYKRLPIYTDSCARMFMGKRKTEMPPHLFAVSDEAYRNMLQDHENQSMLITGESGAGKTENTKKVICYFAAVGA-SQQEGGAEVDPNKKKVTLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNKHGRLASCDIEHYLLEKSRVIRQAPGERCYHIFYQIYSD-FRPELKKELLLDLPIKDYWFVAQAELIIDGIDDVEEFQLTDEAFDILNFSAVEKQDCYRLMSAHMHMGNMKFKQRPREEQAEPDGTDEAEKASNMYGIGCEEFLKALTKPRVKVGTEWVSKGQNCEQVNWAVGAMAKGLYSRVFNWLVKKCNLTLDQKGIDRDYFIGVLDIAGFEIFDFNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYAREGIQWVFIDFGLDLQACIELIEKPLGIISMLDEECIVPKATDLTLASKLVDQHLGKHPNFEKPKPPKGKQGEAHFAMRHYAGTVRYNCLNWLEKNKDPLNDTVVSAMKQSKGNDLLVEIWQDYTTQEEAAAKAKEGGGGGKKKGKSGSFMTVSMLYRESLNNLMTMLNKTHPHFIRCIIPNEKKQSGMIDAALVLNQLTCNGVLEGIRICRKGFPNRTLHPDFVQRYAILAAKEAKSDDDKKKCAEAIMSKLVNDGSLSEEMFRIGLTKVFFKAGVLAHLEDIRDEKLATILTGFQSQIRWHLGLKDRKRRMEQRAGLLIVQRNVRSWCTLRTWEWFKLYGKVKPMLKAGKEAEELEKINDKVKALEDSLAKEEKLRKELEESSAKLVEEKTSLFTNLESTKTQLSDAEERLAKLEAQQKDASKQLSELNDQLADNEDRTADVQRAKKKIEAEVEALKKQIQDLEMSLRKAESEKQSKDHQIRSLQDEMQQQDEAIAKLNKEKKHQEEINRKLMEDLQSEEDKGNHQNKVKAKLEQTLDDLEDSLEREKRARADLDKQKRKVEGELKIAQENIDESGRQRHDLENNLKKKESELHSVSSRLEDEQALVSKLQRQIKDGQSRISELEEELENERQSRSKADRAKSDLQRELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAVAELTDQLDQLNKAKAKVEKDKAQAVRDAEDLAAQLDQETSGKLNNEKLAKQFELQLTELQSKADEQSRQLQDFTSLKGRLHSENGDLVRQLEDAESQVNQLTRLKSQLTSQLEEARRTADEEARERQTVAAQAKNYQHEAEQLQESLEEEIEGKNEILRQLSKANADIQQWKARFEGEGLLKADELEDAKRRQAQKINELQEALDAANSKNASLEKTKSRLVGDLDDAQVDVERANGVASALEKKQKGFDKIIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGLRRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHARALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNGADTREQFFNAEKRATLLQSEKEELLVANEAAERARKQAEYEAADARDQANEANAQVSSLTSAKRKLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQHVDRLRKGLEQQLKEIQVRLDEAEAAALKGGKKVIAKLEQRVRELESELDGEQRRFQDANKNLGRADRRVRELQFQVDEDKKNFERLQDLIDKLQQKLKTQKKQVEEAEELANLNLQKYKQLTHQLEDAEERADQAENSLSKMRSKSRASASVAPG 1942          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: myo-3 (Myosin-3 [Source:UniProtKB/Swiss-Prot;Acc:P12844])

HSP 1 Score: 1670.21 bits (4324), Expect = 0.000e+0
Identity = 1009/1960 (51.48%), Postives = 1397/1960 (71.28%), Query Frame = 3
Query:   87 NP----SDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAA---ATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTK-VKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKE-ALVSSLFAPAEDPNNT-----------GKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNL----YRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTAR--GGSMAPGMTT 5888
            NP    +DP F +LG+ R+A        FDSKKNCWIPD ++ F+AA I+  +G+  TV T K    TVKKD+ ++MNPPKF   EDMANLTFLN+ASVL NL+ RY   +IYTYSGLFCV INPYKR PIY+  VI  + GKRR EMPPH+F++SD AY NM+ D++NQS+LITGESGAGKTENTKKVI+YFA V A   A+ KE  D   G    GTLE+QIVQ NPVLEA+GNAKTVRNNNSSRFGKFIR HF  SGK+AG DIE YLLEKSRV  Q  GER YHIFYQI+S        KL +S D   Y F +Q ELTI+G+DD+EEM++T EAFDI+GF   E M L++ T  I++MGEMKFKQRPREEQAE DG  +A   A +LG+ A++ ++++ KP+V+VG E+V KGQN +QV ++V  LAK++Y RMF W++ R NKTLD K ++R+ FIGVLDIAGFEIF+ N FEQ+ IN+ NERLQQFFNHHMFVLEQEEYK+E I W FIDFG+DLQACIELIEKP+GI+SIL+EEC+ PKA+DMT+  KL D HLGK PNF KPKPPK  Q +AHF + HYAG+V YN T +LEKNKDPLN+T + LL  S + +L+  ++   +                GKR K  +  T+S  +RESLN LM  L  T PHFIRCI+PNE K  GVID+ LVL+QL CNGVLEGIRICRKGFPNRM+Y +FK RY+ILA +A  +   + K+ +  IL+ + +D NL    +++G TK+FFKAG LA LED+RDE LS ++++FQ++IR YL + + ++  +Q+  L ++QRN+R +  LRTW W+KL+ KVKP+L   +++E M + A ++ KL+E  ++ +  + +LE Q   L+E KN LFL L+TE+ +LADAEE+  KL   KA +E ++ ++   L + ++    L   KKK   E+ + KK V DLE SL+KAEQEK ++D  I+SLQD+MA Q+E + KL KEKK  +E  +K  E L +EE+KV +L K + KLEQ +DE+EEN+ RE++ R D+EK KRK+E +LK  QE +D++ + K ++E  LKRKE +L + ++K+ + + ++A+LQR IKEL AR  ELEE+LEAER +R K+++SR + E ELEEL++RLE+QGGAT+AQ++ NKKREAE+ KL+R+ EE ++ H+  I+  RK+  D V E +EQL+ LQK+KAK E EK++++ DL + Q   +S  +++ + +K +K IE Q SELQ K +E +R + D      +    N++L   LEE ++Q+N L ++K  +Q+QL+E R+  +EESR +  L++  +NL  +   LRE L+EE E+K+D+ RQ+ K   E+QQ KA+F+  G  + EE++ AK+    ++ EL +  E   +K    EKV+ +L  +++D   DV++A    +  EK ++ F+ +++EW++K  +  +EL+A+QR++R +S ++F+ K   +E  E L+S +RENK+LA E+ DLT+Q+GEGGRSV E+ K  ++LE+EKEELQ AL+EAE ALE EEAK  R+Q+E+SQIR EI++R+ EKEEEFE TR NHQRA+ESM+A+LEAE++ + EA ++KKKLE DI +LE+A+D ANR  ++ +K  KK+ + VQEL   +E+E+ QKD+IREQ   +E++  ++ +E +E+    E +ER R+N E E +E+ ++ N+L+   S     +RKLE +L A  ++LEE A E + A EQ +KA AD+ARL +E+RQEQEH+  I++I+K LE Q KE+Q +LD++EN ALKGGKK +++LE R+R +E ELDGEQ+RH +++KN RK ERR+KE+  Q  E+KKN+ERL +LV+KLQ K+K +KRQVEEAEE+AA NL KY+ +  + E +EERAD AE AL K+R K R+S S A   G  M P  ++
Sbjct:    4 NPDAFENDPGFPFLGISREARAATAARPFDSKKNCWIPDPEDGFVAAEIQSTTGEQVTVVTVKGNQITVKKDQCQEMNPPKFDKTEDMANLTFLNEASVLGNLKDRYKDLMIYTYSGLFCVVINPYKRLPIYSESVIKHFMGKRRNEMPPHLFAVSDEAYRNMVQDKENQSMLITGESGAGKTENTKKVISYFAIVGATQAASGKEAKDGKKG----GTLEEQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRTHFSGSGKLAGGDIEHYLLEKSRVVRQAPGERCYHIFYQIMSGNDPSLRGKLKLSNDITYYHFCSQAELTIEGMDDKEEMRLTQEAFDIMGFEDNETMDLYRSTAGIMHMGEMKFKQRPREEQAEPDGEEDALNAAAMLGIQAEEFLKALTKPRVRVGTEWVNKGQNLEQVNWAVSGLAKAIYARMFKWIITRCNKTLDAKEIERKHFIGVLDIAGFEIFDLNSFEQLWINFVNERLQQFFNHHMFVLEQEEYKREGIAWTFIDFGLDLQACIELIEKPLGIISILDEECIVPKATDMTYAQKLLDQHLGKHPNFQKPKPPKGKQGDAHFAIVHYAGTVRYNATNFLEKNKDPLNDTAVALLKHSTDNSLMLDIWQDYQTQEEAAEAAKAGQTAGGKRGKSSSFATVSMIYRESLNNLMNMLYQTHPHFIRCIIPNEKKASGVIDSALVLNQLTCNGVLEGIRICRKGFPNRMLYPDFKHRYAILAADAAKES--DPKKASVGILDKISVDGNLTDEEFKVGETKIFFKAGVLAKLEDLRDEILSRIVTMFQSRIRSYLAKAEVRRRYEQQTGLLVVQRNVRAWCTLRTWEWFKLFGKVKPMLKAGKEQEAMGELAVKIQKLEEAVQRGEIARSQLESQVADLVEEKNALFLSLETEKANLADAEERNEKLNQLKATLESKLSDITGQLEDMQERNEDLARQKKKTDQELSDTKKHVQDLELSLRKAEQEKQSRDHNIRSLQDEMANQDEAVAKLNKEKKHQEESNRKLNEDLQSEEDKVNHLEKIRNKLEQQMDELEENIDREKRSRGDIEKAKRKVEGDLKVAQENIDEITKQKHDVETTLKRKEEDLHHTNAKLAENNSIIAKLQRLIKELTARNAELEEELEAERNSRQKSDRSRSEAERELEELTERLEQQGGATAAQLEANKKREAEIAKLRREKEEDSLNHETAISSLRKRHGDSVAELTEQLETLQKLKAKSEAEKSKLQRDLEESQHATDSEVRSRQDLEKALKTIEVQYSELQTKADEQSRQLQDFAALKNRLNNENSDLNRSLEEMDNQLNSLHRLKSTLQSQLDETRRNYDEESRERQALAATAKNLEHENTILREHLDEEAESKADLTRQISKLNAEIQQWKARFDSEGLNKLEEIEAAKKALQLKVQELTDTNEGLFAKIASQEKVRFKLMQDLDDAQSDVEKAAAQVAFYEKHRRQFESIIAEWKKKTDDLSSELDAAQRDNRQLSTDLFKAKTANDELAEYLDSTRRENKSLAQEVKDLTDQLGEGGRSVAELQKIVRKLEVEKEELQKALDEAEAALEAEEAKVLRAQIEVSQIRSEIEKRIQEKEEEFENTRRNHQRALESMQATLEAETKQKEEALRIKKKLESDINDLEIALDHANRAYADAQKTIKKYMETVQELQFQIEEEQRQKDEIREQFLASEKRNAILQSEKDELAQQAEAAERARRNAEAECIELREQNNDLNAHVSALTGQRRKLEGELLAAHAELEEIANELKNAVEQGQKASADAARLAEELRQEQEHSMHIERIRKGLELQIKEMQIRLDDAENAALKGGKKIIAQLEARIRAIEQELDGEQRRHQDTEKNWRKAERRVKEVEFQVVEEKKNEERLTELVDKLQCKLKIFKRQVEEAEEVAASNLNKYKVLTAQFEQAEERADIAENALSKMRNKIRASASMAPPDGFPMVPSASS 1957          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: Mhc (gene:FBgn0264695 transcript:FBtr0307496)

HSP 1 Score: 1877.83 bits (4863), Expect = 0.000e+0
Identity = 1116/1912 (58.37%), Postives = 1446/1912 (75.63%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKR------KKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAP 5876
            +DSKK+CWIPDEKE ++   I+   GD+ +V     ET+ +KKD ++Q+NPPK+   EDM+NLT+LNDASVL NLRQRYY  LIYTYSGLFCV INPYKR+P+YT +    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K +E       K KG+LEDQ+VQ NPVLEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RV SQQ  ER+YHIFYQI+S       +  L++ +   Y  ++QG++T+  +DD EE  +TD+AFDILGF+ +EK  +++ T ++++MG MKFKQR REEQAE DG  E  +V+ L G +  +L +++LKP++KVGNE+VT+G+N  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF +NGFEQ+CIN+TNE+LQQFFNHHMFVLEQEEYK+E IDW FIDFGMDL ACI+LIEKPMGILSILEEE MFPKA+D TF  KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YN+TGWLEKNKDPLN+TV++    S+  L+  +FA     +  G++      KKGG   T+SS ++E LN LM  L+ST PHF+RCI+PNE KQPGV+DAHLV+HQL CNGVLEGIRICRKGFPNRM+Y +FK RY IL P  I +G  + K+ T  ++E+ +L+ + YRLGNTKVFF+AG L  +E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTWPW+KL+ KVKPLLN++R E+E+ +  E+  K +E      K +KELE  N KLL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L +EED    L   KKK   EI  LKKD+ DLE ++QKAEQ+K  KD QI++L D++A Q+E +NKL KEKK   E  +KT E L A E+K+ +LNK KAKLEQT+DE+E++L RE+K+R DVEK KRK+E +LK TQE V DLER K+ELE+ ++RK+ EL + ++K+EDE  +V + QR+IKELQARI+ELEE++EAERQARAKAEK R  L  ELEEL +RLEE GGATSAQ++LNKKREAEL KL+RDLEE+N+QH+  +A  RKK  D V E +EQ+DQL K+KAK EKEKNE    LNDL+  ++ +   KA  +K  K+++   +E+Q KL+E NR +ND + +  K    N++L  +LEEAESQ++QL K+K  + TQLE+ +++A+EESR +A L    RNL  DLDNLRE +EEE E K+D+QRQL KA  E Q  ++K+E  G  RSEEL+EAKRK   R+ E EE  E+   K   LEK K RL  E+ED+ ++VDRAN +A+  EKKQK FDK++ EW+ K  +  AEL+ASQ+E R  S E+FR+K   EE QEQLE+V+RENKNLADE+ DL +QIGEGGR++HEI+KARKRLE EK+ELQ ALEEAE ALEQEE K  R+QLE+SQ+RQEIDRR+ EKEEEFE TR NHQRA++SM+ASLEAE++G+AEA +MKKKLE DI ELE+A+D AN+  +E +KN K++QQQ++++ + +E+E+  +D  REQ  ++ER+   +  ELEE R  LE ++R R+  E E  +  ++LNE+S Q++   A KRKLE++L  + SDL+E   EA+ + E+AKKA+ D+ARL DE+R EQ+HAQ  +K++K LE Q KELQ +LDE+E NALKGGKKA+ KLEQRVRELE ELDGEQ+RH ++QKN RK ERR+KEL  Q++ED+KN ER+QDLV+KLQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K R K R+  S  RG S AP
Sbjct:   32 YDSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGETRDLKKDLLQQVNPPKYEKAEDMSNLTYLNDASVLHNLRQRYYNKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDE-----AAKSKGSLEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHHMFVLEQEEYKREGIDWAFIDFGMDLLACIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYQILNPKGI-KGIEDPKKCTKVLIESTELNDDQYRLGNTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEKEKNEYYGQLNDLRAGVDHITNEKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAG-SVGRGASPAP 1936          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: Mhc (gene:FBgn0264695 transcript:FBtr0080900)

HSP 1 Score: 1877.45 bits (4862), Expect = 0.000e+0
Identity = 1117/1916 (58.30%), Postives = 1448/1916 (75.57%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKR------KKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 5888
            +DSKK+CWIPDEKE ++   I+   GD+ +V     ET+ +KKD ++Q+NPPK+   EDM+NLT+LNDASVL NLRQRYY  LIYTYSGLFCV INPYKR+P+YT +    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K +E       K KG+LEDQ+VQ NPVLEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RV SQQ  ER+YHIFYQI+S       +  L++ +   Y  ++QG++T+  +DD EE  +TD+AFDILGF+ +EK  +++ T ++++MG MKFKQR REEQAE DG  E  +V+ L G +  +L +++LKP++KVGNE+VT+G+N  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF +NGFEQ+CIN+TNE+LQQFFNHHMFVLEQEEYK+E IDW FIDFGMDL ACI+LIEKPMGILSILEEE MFPKA+D TF  KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YN+TGWLEKNKDPLN+TV++    S+  L+  +FA     +  G++      KKGG   T+SS ++E LN LM  L+ST PHF+RCI+PNE KQPGV+DAHLV+HQL CNGVLEGIRICRKGFPNRM+Y +FK RY IL P  I +G  + K+ T  ++E+ +L+ + YRLGNTKVFF+AG L  +E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTWPW+KL+ KVKPLLN++R E+E+ +  E+  K +E      K +KELE  N KLL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L +EED    L   KKK   EI  LKKD+ DLE ++QKAEQ+K  KD QI++L D++A Q+E +NKL KEKK   E  +KT E L A E+K+ +LNK KAKLEQT+DE+E++L RE+K+R DVEK KRK+E +LK TQE V DLER K+ELE+ ++RK+ EL + ++K+EDE  +V + QR+IKELQARI+ELEE++EAERQARAKAEK R  L  ELEEL +RLEE GGATSAQ++LNKKREAEL KL+RDLEE+N+QH+  +A  RKK  D V E +EQ+DQL K+KAK EKEKNE    LNDL+  ++ +   KA  +K  K+++   +E+Q KL+E NR +ND + +  K    N++L  +LEEAESQ++QL K+K  + TQLE+ +++A+EESR +A L    RNL  DLDNLRE +EEE E K+D+QRQL KA  E Q  ++K+E  G  RSEEL+EAKRK   R+ E EE  E+   K   LEK K RL  E+ED+ ++VDRAN +A+  EKKQK FDK++ EW+ K  +  AEL+ASQ+E R  S E+FR+K   EE QEQLE+V+RENKNLADE+ DL +QIGEGGR++HEI+KARKRLE EK+ELQ ALEEAE ALEQEE K  R+QLE+SQ+RQEIDRR+ EKEEEFE TR NHQRA++SM+ASLEAE++G+AEA +MKKKLE DI ELE+A+D AN+  +E +KN K++QQQ++++ + +E+E+  +D  REQ  ++ER+   +  ELEE R  LE ++R R+  E E  +  ++LNE+S Q++   A KRKLE++L  + SDL+E   EA+ + E+AKKA+ D+ARL DE+R EQ+HAQ  +K++K LE Q KELQ +LDE+E NALKGGKKA+ KLEQRVRELE ELDGEQ+RH ++QKN RK ERR+KEL  Q++ED+KN ER+QDLV+KLQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K R K R+  S  RG S AP  T+
Sbjct:   32 YDSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGETRDLKKDLLQQVNPPKYEKAEDMSNLTYLNDASVLHNLRQRYYNKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDE-----AAKSKGSLEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHHMFVLEQEEYKREGIDWAFIDFGMDLLACIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYQILNPKGI-KGIEDPKKCTKVLIESTELNDDQYRLGNTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEKEKNEYYGQLNDLRAGVDHITNEKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAG-SVGRGASPAPRATS 1940          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: Mhc (gene:FBgn0264695 transcript:FBtr0301827)

HSP 1 Score: 1875.52 bits (4857), Expect = 0.000e+0
Identity = 1115/1912 (58.32%), Postives = 1444/1912 (75.52%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKR------KKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAP 5876
            +DSKK+CWIPDEKE ++   I+   GD+ +V     ET+ +KKD ++Q+NPPK+   EDM+NLT+LNDASVL NLRQRYY  LIYTYSGLFCV INPYKR+P+YT +    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K +E       K KG+LEDQ+VQ NPVLEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RV SQQ  ER+YHIFYQI+S       +  L++ +   Y  ++QG++T+  +DD EE  +TD+AFDILGF+ +EK  +++ T ++++MG MKFKQR REEQAE DG  E  +V+ L G +  +L +++LKP++KVGNE+VT+G+N  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF +NGFEQ+CIN+TNE+LQQFFNHHMFVLEQEEYK+E IDW FIDFGMDL ACI+LIEKPMGILSILEEE MFPKA+D TF  KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YN+TGWLEKNKDPLN+TV++    S+  L+  +FA     +  G++      KKGG   T+SS ++E LN LM  L+ST PHF+RCI+PNE KQPGV+DAHLV+HQL CNGVLEGIRICRKGFPNRM+Y +FK RY I+ P  + QG  + K+ T  I++ + L  + YRLGNTKVFF+AG L  +E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTWPW+KL+ KVKPLLN++R E+E+ +  E+  K +E      K +KELE  N KLL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L +EED    L   KKK   EI  LKKD+ DLE ++QKAEQ+K  KD QI++L D++A Q+E +NKL KEKK   E  +KT E L A E+K+ +LNK KAKLEQT+DE+E++L RE+K+R DVEK KRK+E +LK TQE V DLER K+ELE+ ++RK+ EL + ++K+EDE  +V + QR+IKELQARI+ELEE++EAERQARAKAEK R  L  ELEEL +RLEE GGATSAQ++LNKKREAEL KL+RDLEE+N+QH+  +A  RKK  D V E +EQ+DQL K+KAK EKEKNE    LNDL+  ++ +   KA  +K  K+++   +E+Q KL+E NR +ND + +  K    N++L  +LEEAESQ++QL K+K  + TQLE+ +++A+EESR +A L    RNL  DLDNLRE +EEE E K+D+QRQL KA  E Q  ++K+E  G  RSEEL+EAKRK   R+ E EE  E+   K   LEK K RL  E+ED+ ++VDRAN +A+  EKKQK FDK++ EW+ K  +  AEL+ASQ+E R  S E+FR+K   EE QEQLE+V+RENKNLADE+ DL +QIGEGGR++HEI+KARKRLE EK+ELQ ALEEAE ALEQEE K  R+QLE+SQ+RQEIDRR+ EKEEEFE TR NHQRA++SM+ASLEAE++G+AEA +MKKKLE DI ELE+A+D AN+  +E +KN K++QQQ++++ + +E+E+  +D  REQ  ++ER+   +  ELEE R  LE ++R R+  E E  +  ++LNE+S Q++   A KRKLE++L  + SDL+E   EA+ + E+AKKA+ D+ARL DE+R EQ+HAQ  +K++K LE Q KELQ +LDE+E NALKGGKKA+ KLEQRVRELE ELDGEQ+RH ++QKN RK ERR+KEL  Q++ED+KN ER+QDLV+KLQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K R K R+  S  RG S AP
Sbjct:   32 YDSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGETRDLKKDLLQQVNPPKYEKAEDMSNLTYLNDASVLHNLRQRYYNKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDE-----AAKSKGSLEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHHMFVLEQEEYKREGIDWAFIDFGMDLLACIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYKIMCPKLL-QGVEKDKKATEIIIKFIDLPEDQYRLGNTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEKEKNEYYGQLNDLRAGVDHITNEKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAG-SVGRGASPAP 1936          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: Mhc (gene:FBgn0264695 transcript:FBtr0307495)

HSP 1 Score: 1874.37 bits (4854), Expect = 0.000e+0
Identity = 1122/1916 (58.56%), Postives = 1443/1916 (75.31%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKR------KKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 5888
            +DSKK+CWIPDEKE ++   I+   GD+ +V     ET+ +KKD ++Q+NPPK+   EDM+NLT+LNDASVL NLRQRYY  LIYTYSGLFCV INPYKR+P+YT +    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K +E       K KG+LEDQ+VQ NPVLEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RV SQQ  ER+YHIFYQI+S       E  L+S +   Y  ++QG+ TI  V+D EE    D+AFDILGF+ +EK  +++ T ++++MG MKFKQR REEQAE DG  E  +V+ L G +  +L +++LKP++KVGNE+VT+G+N  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF +NGFEQ+CIN+TNE+LQQFFNHHMFVLEQEEYK+E IDW FIDFGMDL ACI+LIEKPMGILSILEEE MFPKA+D TF  KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YN+TGWLEKNKDPLN+TV++    S+  L+  +FA     +  G++      KKGG   T+SS ++E LN LM  L+ST PHF+RCI+PNE KQPGV+DAHLV+HQL CNGVLEGIRICRKGFPNRM+Y +FK RY ILAP AI       K    K LEAV LD ++YR+G+TKVFF+AG L  +E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTWPW+KL+ KVKPLLN++R E+E+ +  E+  K +E      K +KELE  N KLL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L +EED    L   KKK   EI  LKKD+ DLE ++QKAEQ+K  KD QI++L D++A Q+E +NKL KEKK   E  +KT E L A E+K+ +LNK KAKLEQT+DE+E++L RE+K+R DVEK KRK+E +LK TQE V DLER K+ELE+ ++RK+ EL + ++K+EDE  +V + QR+IKELQARI+ELEE++EAERQARAKAEK R  L  ELEEL +RLEE GGATSAQ++LNKKREAEL KL+RDLEE+N+QH+  +A  RKK  D V E +EQ+DQL K+KAK EKEKNE    LNDL+  ++ +   KA  +K  K+++   +E+Q KL+E NR +ND + +  K    N++L  +LEEAESQ++QL K+K  + TQLE+ +++A+EESR +A L    RNL  DLDNLRE +EEE E K+D+QRQL KA  E Q  ++K+E  G  RSEEL+EAKRK   R+ E EE  E+   K   LEK K RL  E+ED+ ++VDRAN +A+  EKKQK FDK++ EW+ K  +  AEL+ASQ+E R  S E+FR+K   EE QEQLE+V+RENKNLADE+ DL +QIGEGGR++HEI+KARKRLE EK+ELQ ALEEAE ALEQEE K  R+QLE+SQ+RQEIDRR+ EKEEEFE TR NHQRA++SM+ASLEAE++G+AEA +MKKKLE DI ELE+A+D AN+  +E +KN K++QQQ++++ + +E+E+  +D  REQ  ++ER+   +  ELEE R  LE ++R R+  E E  +  ++LNE+S Q++   A KRKLE++L  + SDL+E   EA+ + E+AKKA+ D+ARL DE+R EQ+HAQ  +K++K LE Q KELQ +LDE+E NALKGGKKA+ KLEQRVRELE ELDGEQ+RH ++QKN RK ERR+KEL  Q++ED+KN ER+QDLV+KLQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K R K R+  S  RG S AP  T+
Sbjct:   32 YDSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGETRDLKKDLLQQVNPPKYEKAEDMSNLTYLNDASVLHNLRQRYYNKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDE-----AAKSKGSLEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKEYCLLSNNIYDYRIVSQGKTTIPSVNDGEEWVAVDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHHMFVLEQEEYKREGIDWAFIDFGMDLLACIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYMILAP-AIMAAEKVAKNAAGKCLEAVGLDPDMYRIGHTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEKEKNEYYGQLNDLRAGVDHITNEKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAG-SVGRGASPAPRATS 1940          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: Mhc (gene:FBgn0264695 transcript:FBtr0080903)

HSP 1 Score: 1874.37 bits (4854), Expect = 0.000e+0
Identity = 1115/1916 (58.19%), Postives = 1448/1916 (75.57%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKR------KKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 5888
            +DSKK+CWIPDEKE ++   I+   GD+ +V     ET+ +KKD ++Q+NPPK+   EDM+NLT+LNDASVL NLRQRYY  LIYTYSGLFCV INPYKR+P+YT +    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K +E       K KG+LEDQ+VQ NPVLEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RV SQQ  ER+YHIFYQI+S       +  L++ +   Y  ++QG++T+  +DD EE  +TD+AFDILGF+ +EK  +++ T ++++MG MKFKQR REEQAE DG  E  +V+ L G +  +L +++LKP++KVGNE+VT+G+N  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF +NGFEQ+CIN+TNE+LQQFFNHHMFVLEQEEY++E I+W FIDFGMDLQ CI+LIEKPMGILSILEEE MFPKA+D TF  KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YN+TGWLEKNKDPLN+TV++    S+  L+  +FA     +  G++      KKGG   T+SS ++E LN LM  L+ST PHF+RCI+PNE KQPGV+DAHLV+HQL CNGVLEGIRICRKGFPNRM+Y +FK RY IL P  I +G  + K+ T  ++E+ +L+ + YRLGNTKVFF+AG L  +E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTWPW+KL+ KVKPLLN++R E+E+ +  E+  K +E      K +KELE  N KLL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L +EED    L   KKK   EI  LKKD+ DLE ++QKAEQ+K  KD QI++L D++A Q+E +NKL KEKK   E  +KT E L A E+K+ +LNK KAKLEQT+DE+E++L RE+K+R DVEK KRK+E +LK TQE V DLER K+ELE+ ++RK+ EL + ++K+EDE  +V + QR+IKELQARI+ELEE++EAERQARAKAEK R  L  ELEEL +RLEE GGATSAQ++LNKKREAEL KL+RDLEE+N+QH+  +A  RKK  D V E +EQ+DQL K+KAK EKEKNE    LNDL+  ++ +   KA  +K  K+++   +E+Q KL+E NR +ND + +  K    N++L  +LEEAESQ++QL K+K  + TQLE+ +++A+EESR +A L    RNL  DLDNLRE +EEE E K+D+QRQL KA  E Q  ++K+E  G  RSEEL+EAKRK   R+ E EE  E+   K   LEK K RL  E+ED+ ++VDRAN +A+  EKKQK FDK++ EW+ K  +  AEL+ASQ+E R  S E+FR+K   EE QEQLE+V+RENKNLADE+ DL +QIGEGGR++HEI+KARKRLE EK+ELQ ALEEAE ALEQEE K  R+QLE+SQ+RQEIDRR+ EKEEEFE TR NHQRA++SM+ASLEAE++G+AEA +MKKKLE DI ELE+A+D AN+  +E +KN K++QQQ++++ + +E+E+  +D  REQ  ++ER+   +  ELEE R  LE ++R R+  E E  +  ++LNE+S Q++   A KRKLE++L  + SDL+E   EA+ + E+AKKA+ D+ARL DE+R EQ+HAQ  +K++K LE Q KELQ +LDE+E NALKGGKKA+ KLEQRVRELE ELDGEQ+RH ++QKN RK ERR+KEL  Q++ED+KN ER+QDLV+KLQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K R K R+  S  RG S AP  T+
Sbjct:   32 YDSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGETRDLKKDLLQQVNPPKYEKAEDMSNLTYLNDASVLHNLRQRYYNKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDE-----AAKSKGSLEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHHMFVLEQEEYQREGIEWTFIDFGMDLQLCIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYQILNPKGI-KGIEDPKKCTKVLIESTELNDDQYRLGNTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEKEKNEYYGQLNDLRAGVDHITNEKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAG-SVGRGASPAPRATS 1940          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: myh7l (myosin heavy chain 7-like [Source:ZFIN;Acc:ZDB-GENE-061027-393])

HSP 1 Score: 1791.55 bits (4639), Expect = 0.000e+0
Identity = 1037/1917 (54.09%), Postives = 1407/1917 (73.40%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG-------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            YL    K  ++    +FD KK C++PD  E F+ AT+    GD  TV+T   +T TVK+ ++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V+  Y+GK+RTE PPHI+SISDNAY  MLADR+NQS+LITGESGAGKT NTK+VI YFA +AA+  K++ D     K KGTLEDQI+QANP LEA+GNAKT+RN+NSSRFGKFIRIHF T GK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      E LL++ +P  Y+FI+QGE T+  +DD +E+  TD AFDILGF+ EEK S++K T +I++ G MKFKQ+ REEQAEADGT +A+K A+L+G+N+ DL++ +  P+VKVGNE+VTKGQN  QV Y++GAL+K++Y +MF W+V+R+N++L+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+  WL KNKDPLNETV+ L   S   L+S+LFA     ++         K+KKG + QT+S+ HRE+LNKLM NL+ST PHF+RC++PNE K PG ++  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P AIP+G F++ K+   K+L ++ +D   YR G+TKVFFKAG L  LE+MRDE+LS +I+  QA+ RG L R +Y K+ ++R AL +IQ N+R ++ ++ WPW KL+ K+KPLL  A  E+EM    EE  KLKE + K +  +KELEE+ V LL+ KNDL LQ+Q EQD+L DAEE+   L+  K  ME + KEL + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  ++ + KL KEKKA  E  ++T + L +EE+KV  L KAK KLEQ +D++E +L +E+KIR D+E+ KRK+E +LK TQE++ DLE  K++LEE+LK+K+ E+   +SKI+DE  ++ QLQ+K+KELQAR++ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEE+ +QH+   A  RKKQ D V E  EQ+D LQ+VK K+EKEK+E++ +L+D+   +E + K+K N +K  + +E Q +E + K EE  R +ND      K Q  N E   +LEE ES ++QL + K     QLE+ ++  +EE +AK  L+  +++   D D LRE  EEE E K+++QR + KA  E+ Q + K+E     R+EEL+EAK+K   R+ E EE  E   +K   LEK K RLQ EIED++VDV+R+NT A+ L+KKQ+ FDK++SEW+QKY ESQ ELE+SQ+E+R++S E+F++K   EES + LE++KRENK L +EI DLTEQ+GEGG+++HE++K RK+LE EK E+Q ALEEAE +LE EE K  R+QLE +QI+ +I+R+L+EK+EE E  + N QR +++++++LE+E+R R EA ++KKK+E D+ E+E+ +  ANR  +E +K  K  Q  +++    ++D     D ++E T + ER+  ++ AELEE+R  LE +ER RK  E E +++T+R+  L  Q++  +  K+KLE DL+  Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE RVRELE E++ EQKR  ES K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKR  EE+EE A V+L K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   15 YLRKSEKERLEAQTKAFDLKKECFVPDAIEEFVKATVVSREGDKVTVETQGGKTVTVKEADVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVIAYRGKKRTEAPPHIYSISDNAYQYMLADRENQSILITGESGAGKTVNTKRVIQYFASIAASGGKKDQD-----KNKGTLEDQIIQANPALEAFGNAKTIRNDNSSRFGKFIRIHFDTRGKLASADIETYLLEKSRVTFQLKAERDYHIFYQILSNKKPEILEMLLVTSNPYDYAFISQGETTVPSIDDSDELMATDSAFDILGFTQEEKNSVYKLTGAIMHYGNMKFKQKQREEQAEADGTEDADKSAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVQQVNYAIGALSKAVYEKMFLWMVVRINQSLETKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKSNNF-QKPRLVKGKPEAHFALVHYAGTVDYNINNWLVKNKDPLNETVVGLYQKSSLKLLSNLFANYAGADSATGDGGKKEKKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCLIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPAAIPEGQFIDSKKGAEKLLGSLDIDHQQYRFGHTKVFFKAGLLGQLEEMRDERLSKIITGIQAKSRGLLSRAEYIKMVERRDALLVIQWNVRAFMAVKNWPWMKLFFKIKPLLRSAEAEKEMANMKEEFLKLKEAYAKSEARRKELEEKMVTLLQEKNDLQLQVQAEQDNLCDAEERCEGLIKNKIQMEAKAKELTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLTQESIMDLENDKQQLEEKLKKKDFEISQLNSKIDDEQSIIIQLQKKLKELQARVEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATAATLRKKQADSVAELGEQIDNLQRVKQKLEKEKSELRLELDDVASSMEHIVKSKTNMEKVNRTLEDQMNEYRNKCEEYQRSLNDFTTQKAKLQAENDEFSRQLEEKESLVSQLTRGKNSFSQQLEDLKRQLDEEIKAKNALAHALQSARHDTDLLREQYEEEQEAKAELQRSMSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNTAAASLDKKQRHFDKIISEWKQKYEESQCELESSQKEARSLSTELFKLKNSYEESMDHLETMKRENKILQEEISDLTEQLGEGGKTIHELEKVRKQLEQEKAEIQAALEEAEGSLEHEEGKILRTQLEFNQIKADIERKLSEKDEEMEQVKRNQQRTIDTLQSALESETRSRNEALRIKKKMEGDLNEMEIQLSQANRQAAEAQKQLKSVQAHLKDSQLQLDDSLRSNDDLKENTAIVERRNALLQAELEELRAVLEQTERGRKLAEQELLDVTERVQLLHSQNTSLINQKKKLETDLSQFQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELECEVEAEQKRSSESVKGIRKYERRIKELTYQTEEDRKNIARLQDLVDKLQLKVKAYKRAAEESEEQANVHLGKFRKLQHELDEAEERADIAESQVNKLRAKSR 1925          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: myh7l (myosin heavy chain 7-like [Source:ZFIN;Acc:ZDB-GENE-061027-393])

HSP 1 Score: 1791.55 bits (4639), Expect = 0.000e+0
Identity = 1037/1917 (54.09%), Postives = 1407/1917 (73.40%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG-------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            YL    K  ++    +FD KK C++PD  E F+ AT+    GD  TV+T   +T TVK+ ++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V+  Y+GK+RTE PPHI+SISDNAY  MLADR+NQS+LITGESGAGKT NTK+VI YFA +AA+  K++ D     K KGTLEDQI+QANP LEA+GNAKT+RN+NSSRFGKFIRIHF T GK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      E LL++ +P  Y+FI+QGE T+  +DD +E+  TD AFDILGF+ EEK S++K T +I++ G MKFKQ+ REEQAEADGT +A+K A+L+G+N+ DL++ +  P+VKVGNE+VTKGQN  QV Y++GAL+K++Y +MF W+V+R+N++L+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+  WL KNKDPLNETV+ L   S   L+S+LFA     ++         K+KKG + QT+S+ HRE+LNKLM NL+ST PHF+RC++PNE K PG ++  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P AIP+G F++ K+   K+L ++ +D   YR G+TKVFFKAG L  LE+MRDE+LS +I+  QA+ RG L R +Y K+ ++R AL +IQ N+R ++ ++ WPW KL+ K+KPLL  A  E+EM    EE  KLKE + K +  +KELEE+ V LL+ KNDL LQ+Q EQD+L DAEE+   L+  K  ME + KEL + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  ++ + KL KEKKA  E  ++T + L +EE+KV  L KAK KLEQ +D++E +L +E+KIR D+E+ KRK+E +LK TQE++ DLE  K++LEE+LK+K+ E+   +SKI+DE  ++ QLQ+K+KELQAR++ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEE+ +QH+   A  RKKQ D V E  EQ+D LQ+VK K+EKEK+E++ +L+D+   +E + K+K N +K  + +E Q +E + K EE  R +ND      K Q  N E   +LEE ES ++QL + K     QLE+ ++  +EE +AK  L+  +++   D D LRE  EEE E K+++QR + KA  E+ Q + K+E     R+EEL+EAK+K   R+ E EE  E   +K   LEK K RLQ EIED++VDV+R+NT A+ L+KKQ+ FDK++SEW+QKY ESQ ELE+SQ+E+R++S E+F++K   EES + LE++KRENK L +EI DLTEQ+GEGG+++HE++K RK+LE EK E+Q ALEEAE +LE EE K  R+QLE +QI+ +I+R+L+EK+EE E  + N QR +++++++LE+E+R R EA ++KKK+E D+ E+E+ +  ANR  +E +K  K  Q  +++    ++D     D ++E T + ER+  ++ AELEE+R  LE +ER RK  E E +++T+R+  L  Q++  +  K+KLE DL+  Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE RVRELE E++ EQKR  ES K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKR  EE+EE A V+L K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   15 YLRKSEKERLEAQTKAFDLKKECFVPDAIEEFVKATVVSREGDKVTVETQGGKTVTVKEADVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVIAYRGKKRTEAPPHIYSISDNAYQYMLADRENQSILITGESGAGKTVNTKRVIQYFASIAASGGKKDQD-----KNKGTLEDQIIQANPALEAFGNAKTIRNDNSSRFGKFIRIHFDTRGKLASADIETYLLEKSRVTFQLKAERDYHIFYQILSNKKPEILEMLLVTSNPYDYAFISQGETTVPSIDDSDELMATDSAFDILGFTQEEKNSVYKLTGAIMHYGNMKFKQKQREEQAEADGTEDADKSAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVQQVNYAIGALSKAVYEKMFLWMVVRINQSLETKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKSNNF-QKPRLVKGKPEAHFALVHYAGTVDYNINNWLVKNKDPLNETVVGLYQKSSLKLLSNLFANYAGADSATGDGGKKEKKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCLIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPAAIPEGQFIDSKKGAEKLLGSLDIDHQQYRFGHTKVFFKAGLLGQLEEMRDERLSKIITGIQAKSRGLLSRAEYIKMVERRDALLVIQWNVRAFMAVKNWPWMKLFFKIKPLLRSAEAEKEMANMKEEFLKLKEAYAKSEARRKELEEKMVTLLQEKNDLQLQVQAEQDNLCDAEERCEGLIKNKIQMEAKAKELTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLTQESIMDLENDKQQLEEKLKKKDFEISQLNSKIDDEQSIIIQLQKKLKELQARVEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATAATLRKKQADSVAELGEQIDNLQRVKQKLEKEKSELRLELDDVASSMEHIVKSKTNMEKVNRTLEDQMNEYRNKCEEYQRSLNDFTTQKAKLQAENDEFSRQLEEKESLVSQLTRGKNSFSQQLEDLKRQLDEEIKAKNALAHALQSARHDTDLLREQYEEEQEAKAELQRSMSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNTAAASLDKKQRHFDKIISEWKQKYEESQCELESSQKEARSLSTELFKLKNSYEESMDHLETMKRENKILQEEISDLTEQLGEGGKTIHELEKVRKQLEQEKAEIQAALEEAEGSLEHEEGKILRTQLEFNQIKADIERKLSEKDEEMEQVKRNQQRTIDTLQSALESETRSRNEALRIKKKMEGDLNEMEIQLSQANRQAAEAQKQLKSVQAHLKDSQLQLDDSLRSNDDLKENTAIVERRNALLQAELEELRAVLEQTERGRKLAEQELLDVTERVQLLHSQNTSLINQKKKLETDLSQFQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELECEVEAEQKRSSESVKGIRKYERRIKELTYQTEEDRKNIARLQDLVDKLQLKVKAYKRAAEESEEQANVHLGKFRKLQHELDEAEERADIAESQVNKLRAKSR 1925          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: smyhc2 (slow myosin heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-070822-12])

HSP 1 Score: 1785.77 bits (4624), Expect = 0.000e+0
Identity = 1037/1906 (54.41%), Postives = 1412/1906 (74.08%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF---APAEDPN-----NTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVS 5849
            FD KK C++PD +  ++ A++    GD  TV+T+  +T TVK+ +    NPPKF  IEDMA  TFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V+  Y+GK+RTE PPHIFSISDNAY  ML+DR+NQSVLITGESGAGKT NTK+VI YFA +AAA   ++D +   Q++KGTLEDQI+Q NP LEA+GNAKT+RN+NSSRFGKFIRIHFG SGK++ ADIE YLLEKSRV  Q K ER+YHIFYQILS       E LLI+ +P  YS+I+QGE  +  +DD +E+  TDEAFD+LGF+ EEK S++K T +I++ G MKFKQ+ REEQAEADGT +A+KVA+L+G+N+ DL++ +  P+VKVGNE+VTKGQN  QV YS+GALAKS+Y +MF W+V+R+N++LDTK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACIELIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGK+PNF +      G+ EAHF L HYAG+V YN++ WL KNKDPLNETV+ L   S   L+ +LF   A AE  +       G +KKG + QT+S+ HRE+LNKLM NL+ST PHF+RC++PNE K PG ++  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P+AIP+G F++ K+   K+L ++ +D N Y+LG+TKVFFKAG L  LE+MRD++L+ +I+  QA+ RG L R +++K+ ++R +L +IQ N+R ++ ++ WPW KLY K+KPLL  A  E+EM    EE TKLKE + K +  KKELEE+ V LL+ KNDL L +Q+EQD+LADAEE+   L+  K   E ++KEL + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L +EE+KV  L KAKAKLEQ +D++E +L +E+KIR D+E+ KRK+E +LK TQE + DLE  K+++EE+LK+K+ E+   +SKIEDE  L AQLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEE+ +QH+   +  RKK  D V++  EQ+D LQ+VK K+EKEK+E++ +L+D+   +E + KAKAN +K  + +E Q SE + K EE  R IND      K Q  N EL  +LEE +S ++QL + KQ    Q+E+ ++  EEE +AK  L+  V++   D + LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDKV++EW+QKY ESQ ELE++Q+ESR++S E+F++K   EES + LES+KRENKNL +EI DLTEQ+GE G+++HE++K RK+LE EK+E+Q ALEEAE +LE EE K  R+QLE +Q++ +I+R+L+EK+EE E  + N QR ++++++SLE+E+R R EA ++KKK+E D+ E+E+ +  ANR  SE +K  K     +++    ++D     D ++E   + ER+  ++ AEL+E+R  +E +ER RK  E E M++++R+  L  Q++  +  K+KLE D   +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE RVRELE+E++ EQ++  +S K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K+YKR  EEAEE A  NL K+RK+Q E++++EERAD AE  + KLR K+R S S
Sbjct:   31 FDMKKECFVPDPEVEYVKASVTSRDGDKVTVETEFGKTVTVKEVDCHPQNPPKFDKIEDMAMFTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVVAYRGKKRTEAPPHIFSISDNAYQYMLSDRENQSVLITGESGAGKTVNTKRVIQYFASIAAAPGGKKDPS---QEKKGTLEDQIIQCNPALEAFGNAKTIRNDNSSRFGKFIRIHFGVSGKLSSADIETYLLEKSRVTYQLKAERDYHIFYQILSQRKPELLEMLLITNNPYDYSYISQGETQVASIDDRDELIATDEAFDVLGFTQEEKNSIYKLTGAIMHYGNMKFKQKQREEQAEADGTEDADKVAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVQQVYYSIGALAKSVYEKMFLWMVVRINQSLDTKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKNPNF-QKPRIVKGRPEAHFALVHYAGTVDYNISNWLVKNKDPLNETVVGLFQKSTLKLLGTLFANYAGAESADSGGKGKGGAKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCLIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPSAIPEGQFIDNKKGAEKLLGSLDIDHNQYKLGHTKVFFKAGLLGTLEEMRDDRLALIITGIQARARGILSRIEFQKIVERRDSLLVIQWNVRAFMGVKNWPWMKLYFKIKPLLKTAETEKEMANMKEEFTKLKEAYAKSEARKKELEEKMVSLLQEKNDLQLAVQSEQDNLADAEERCEGLIKSKIQFEAKVKELTERLEDEEEMNAELVAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDEIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLTQENLMDLENDKQQMEERLKKKDFEISQLNSKIEDEQALEAQLQKKLKELQARIEELEEELEAERAARAKVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATASTLRKKHADSVSDLGEQIDNLQRVKQKLEKEKSELRLELDDVVSNMEQIVKAKANLEKMCRTLEDQMSEYRTKAEEGQRTINDFTMQKAKLQTENGELSRQLEEKDSLVSQLTRGKQSYTQQIEDLKRQLEEEVKAKNALAHAVQSARHDAELLREQYEEEQEAKAELQRSLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKVLAEWKQKYEESQTELESAQKESRSLSTELFKLKNSYEESLDHLESMKRENKNLQEEISDLTEQLGESGKNIHELEKVRKQLEQEKQEIQTALEEAEGSLEHEEGKILRAQLEFNQVKADIERKLSEKDEEMEQAKRNQQRVVDTLQSSLESETRSRNEALRLKKKMEGDLNEMEIQLSQANRQASEAQKQLKGLHGHLKDAQLQLDDALRGNDDLKENIAIVERRNNLLQAELDELRSLVEQTERGRKLAEQELMDVSERVQLLHSQNTSLLNQKKKLEGDNTQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLESRVRELESEVEMEQRKASDSVKGVRKYERRIKELTYQTEEDRKNLARLQDLVDKLQLKVKSYKRTAEEAEEQANSNLGKFRKLQHELDEAEERADIAESQVNKLRAKSRDSGS 1932          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: smyhc2 (slow myosin heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-070822-12])

HSP 1 Score: 1785.39 bits (4623), Expect = 0.000e+0
Identity = 1037/1906 (54.41%), Postives = 1412/1906 (74.08%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF---APAEDPN-----NTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVS 5849
            FD KK C++PD +  ++ A++    GD  TV+T+  +T TVK+ +    NPPKF  IEDMA  TFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V+  Y+GK+RTE PPHIFSISDNAY  ML+DR+NQSVLITGESGAGKT NTK+VI YFA +AAA   ++D +   Q++KGTLEDQI+Q NP LEA+GNAKT+RN+NSSRFGKFIRIHFG SGK++ ADIE YLLEKSRV  Q K ER+YHIFYQILS       E LLI+ +P  YS+I+QGE  +  +DD +E+  TDEAFD+LGF+ EEK S++K T +I++ G MKFKQ+ REEQAEADGT +A+KVA+L+G+N+ DL++ +  P+VKVGNE+VTKGQN  QV YS+GALAKS+Y +MF W+V+R+N++LDTK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACIELIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGK+PNF +      G+ EAHF L HYAG+V YN++ WL KNKDPLNETV+ L   S   L+ +LF   A AE  +       G +KKG + QT+S+ HRE+LNKLM NL+ST PHF+RC++PNE K PG ++  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P+AIP+G F++ K+   K+L ++ +D N Y+LG+TKVFFKAG L  LE+MRD++L+ +I+  QA+ RG L R +++K+ ++R +L +IQ N+R ++ ++ WPW KLY K+KPLL  A  E+EM    EE TKLKE + K +  KKELEE+ V LL+ KNDL L +Q+EQD+LADAEE+   L+  K   E ++KEL + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L +EE+KV  L KAKAKLEQ +D++E +L +E+KIR D+E+ KRK+E +LK TQE + DLE  K+++EE+LK+K+ E+   +SKIEDE  L AQLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEE+ +QH+   +  RKK  D V++  EQ+D LQ+VK K+EKEK+E++ +L+D+   +E + KAKAN +K  + +E Q SE + K EE  R IND      K Q  N EL  +LEE +S ++QL + KQ    Q+E+ ++  EEE +AK  L+  V++   D + LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDKV++EW+QKY ESQ ELE++Q+ESR++S E+F++K   EES + LES+KRENKNL +EI DLTEQ+GE G+++HE++K RK+LE EK+E+Q ALEEAE +LE EE K  R+QLE +Q++ +I+R+L+EK+EE E  + N QR ++++++SLE+E+R R EA ++KKK+E D+ E+E+ +  ANR  SE +K  K     +++    ++D     D ++E   + ER+  ++ AEL+E+R  +E +ER RK  E E M++++R+  L  Q++  +  K+KLE D   +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE RVRELE+E++ EQ++  +S K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K+YKR  EEAEE A  NL K+RK+Q E++++EERAD AE  + KLR K+R S S
Sbjct:   31 FDMKKECFVPDPEVEYVKASVTSRDGDKVTVETEFGKTVTVKEVDCHPQNPPKFDKIEDMAMFTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVVAYRGKKRTEAPPHIFSISDNAYQYMLSDRENQSVLITGESGAGKTVNTKRVIQYFASIAAAPGGKKDPS---QEKKGTLEDQIIQCNPALEAFGNAKTIRNDNSSRFGKFIRIHFGVSGKLSSADIETYLLEKSRVTYQLKAERDYHIFYQILSQRKPELLEMLLITNNPYDYSYISQGETQVASIDDRDELIATDEAFDVLGFTQEEKNSIYKLTGAIMHYGNMKFKQKQREEQAEADGTEDADKVAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVQQVYYSIGALAKSVYEKMFLWMVVRINQSLDTKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKNPNF-QKPRIVKGRPEAHFALVHYAGTVDYNISNWLVKNKDPLNETVVGLFQKSTLKLLGTLFANYAGAESADSGGKGKGGAKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCLIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPSAIPEGQFIDNKKGAEKLLGSLDIDHNQYKLGHTKVFFKAGLLGTLEEMRDDRLALIITGIQARARGILSRIEFQKIVERRDSLLVIQWNVRAFMGVKNWPWMKLYFKIKPLLKTAETEKEMANMKEEFTKLKEAYAKSEARKKELEEKMVSLLQEKNDLQLAVQSEQDNLADAEERCEGLIKSKIQFEAKVKELTERLEDEEEMNAELVAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDEIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLTQENLMDLENDKQQMEERLKKKDFEISQLNSKIEDEQALEAQLQKKLKELQARIEELEEELEAERAARAKVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATASTLRKKHADSVSDLGEQIDNLQRVKQKLEKEKSELRLELDDVVSNMEQIVKAKANLEKMCRTLEDQMSEYRTKSEEGQRTINDFTMQKAKLQTENGELSRQLEEKDSLVSQLTRGKQSYTQQIEDLKRQLEEEVKAKNALAHAVQSARHDAELLREQYEEEQEAKAELQRSLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKVLAEWKQKYEESQTELESAQKESRSLSTELFKLKNSYEESLDHLESMKRENKNLQEEISDLTEQLGESGKNIHELEKVRKQLEQEKQEIQTALEEAEGSLEHEEGKILRAQLEFNQVKADIERKLSEKDEEMEQAKRNQQRVVDTLQSSLESETRSRNEALRLKKKMEGDLNEMEIQLSQANRQASEAQKQLKGLHGHLKDAQLQLDDALRGNDDLKENIAIVERRNNLLQAELDELRSLVEQTERGRKLAEQELMDVSERVQLLHSQNTSLLNQKKKLEGDNTQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLESRVRELESEVEMEQRKASDSVKGVRKYERRIKELTYQTEEDRKNLARLQDLVDKLQLKVKSYKRTAEEAEEQANSNLGKFRKLQHELDEAEERADIAESQVNKLRAKSRDSGS 1932          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: smyhc2 (slow myosin heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-070822-12])

HSP 1 Score: 1783.85 bits (4619), Expect = 0.000e+0
Identity = 1037/1906 (54.41%), Postives = 1412/1906 (74.08%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF---APAEDPN-----NTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVS 5849
            FD KK C++PD +  ++ A++    GD  TV+T+  +T TVK+ +    NPPKF  IEDMA  TFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V+  Y+GK+RTE PPHIFSISDNAY  ML+DR+NQSVLITGESGAGKT NTK+VI YFA +AAA   ++D +   Q++KGTLEDQI+Q NP LEA+GNAKT+RN+NSSRFGKFIRIHFG SGK++ ADIE YLLEKSRV  Q K ER+YHIFYQILS       E LLI+ +P  YS+I+QGE  +  +DD +E+  TDEAFD+LGF+ EEK S++K T +I++ G MKFKQ+ REEQAEADGT +A+KVA+L+G+N+ DL++ +  P+VKVGNE+VTKGQN  QV YS+GALAKS+Y +MF W+V+R+N++LDTK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACIELIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGK+PNF +      G+ EAHF L HYAG+V YN++ WL KNKDPLNETV+ L   S   L+ +LF   A AE  +       G +KKG + QT+S+ HRE+LNKLM NL+ST PHF+RC++PNE K PG ++  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P+AIP+G F++ K+   K+L ++ +D N Y+LG+TKVFFKAG L  LE+MRD++L+ +I+  QA+ RG L R +++K+ ++R +L +IQ N+R ++ ++ WPW KLY K+KPLL  A  E+EM    EE TKLKE + K +  KKELEE+ V LL+ KNDL L +Q+EQD+LADAEE+   L+  K   E ++KEL + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L +EE+KV  L KAKAKLEQ +D++E +L +E+KIR D+E+ KRK+E +LK TQE + DLE  K+++EE+LK+K+ E+   +SKIEDE  L AQLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEE+ +QH+   +  RKK  D V++  EQ+D LQ+VK K+EKEK+E++ +L+D+   +E + KAKAN +K  + +E Q SE + K EE  R IND      K Q  N EL  +LEE +S ++QL + KQ    Q+E+ ++  EEE +AK  L+  V++   D + LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDKV++EW+QKY ESQ ELE++Q+ESR++S E+F++K   EES + LES+KRENKNL +EI DLTEQ+GE G+++HE++K RK+LE EK+E+Q ALEEAE +LE EE K  R+QLE +Q++ +I+R+L+EK+EE E  + N QR ++++++SLE+E+R R EA ++KKK+E D+ E+E+ +  ANR  SE +K  K     +++    ++D     D ++E   + ER+  ++ AEL+E+R  +E +ER RK  E E M++++R+  L  Q++  +  K+KLE D   +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE RVRELE+E++ EQ++  +S K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K+YKR  EEAEE A  NL K+RK+Q E++++EERAD AE  + KLR K+R S S
Sbjct:   32 FDMKKECFVPDPEVEYVKASVTSRDGDKVTVETEFGKTVTVKEVDCHPQNPPKFDKIEDMAMFTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVVAYRGKKRTEAPPHIFSISDNAYQYMLSDRENQSVLITGESGAGKTVNTKRVIQYFASIAAAPGGKKDPS---QEKKGTLEDQIIQCNPALEAFGNAKTIRNDNSSRFGKFIRIHFGVSGKLSSADIETYLLEKSRVTYQLKAERDYHIFYQILSQRKPELLEMLLITNNPYDYSYISQGETQVASIDDRDELIATDEAFDVLGFTQEEKNSIYKLTGAIMHYGNMKFKQKQREEQAEADGTEDADKVAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVQQVYYSIGALAKSVYEKMFLWMVVRINQSLDTKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKNPNF-QKPRIVKGRPEAHFALVHYAGTVDYNISNWLVKNKDPLNETVVGLFQKSTLKLLGTLFANYAGAESADSGGKGKGGAKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCLIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPSAIPEGQFIDNKKGAEKLLGSLDIDHNQYKLGHTKVFFKAGLLGTLEEMRDDRLALIITGIQARARGILSRIEFQKIVERRDSLLVIQWNVRAFMGVKNWPWMKLYFKIKPLLKTAETEKEMANMKEEFTKLKEAYAKSEARKKELEEKMVSLLQEKNDLQLAVQSEQDNLADAEERCEGLIKSKIQFEAKVKELTERLEDEEEMNAELVAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDEIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLTQENLMDLENDKQQMEERLKKKDFEISQLNSKIEDEQALEAQLQKKLKELQARIEELEEELEAERAARAKVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATASTLRKKHADSVSDLGEQIDNLQRVKQKLEKEKSELRLELDDVVSNMEQIVKAKANLEKMCRTLEDQMSEYRTKSEEGQRTINDFTMQKAKLQTENGELSRQLEEKDSLVSQLTRGKQSYTQQIEDLKRQLEEEVKAKNALAHAVQSARHDAELLREQYEEEQEAKAELQRSLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKVLAEWKQKYEESQTELESAQKESRSLSTELFKLKNSYEESLDHLESMKRENKNLQEEISDLTEQLGESGKNIHELEKVRKQLEQEKQEIQTALEEAEGSLEHEEGKILRAQLEFNQVKADIERKLSEKDEEMEQAKRNQQRVVDTLQSSLESETRSRNEALRLKKKMEGDLNEMEIQLSQANRQASEAQKQLKGLHGHLKDAQLQLDDALRGNDDLKENIAIVERRNNLLQAELDELRSLVEQTERGRKLAEQELMDVSERVQLLHSQNTSLLNQKKKLEGDNTQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLESRVRELESEVEMEQRKASDSVKGVRKYERRIKELTYQTEEDRKNLARLQDLVDKLQLKVKSYKRTAEEAEEQANSNLGKFRKLQHELDEAEERADIAESQVNKLRAKSRDSGS 1933          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: pde1b (phosphodiesterase 1B [Source:Xenbase;Acc:XB-GENE-987197])

HSP 1 Score: 1806.96 bits (4679), Expect = 0.000e+0
Identity = 1056/1924 (54.89%), Postives = 1417/1924 (73.65%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKP-FHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVIN--------LLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVST 5852
            YL    + LMK    +FD KK  WIPD+KEA+I   I+D+SG    V+T   +T TVK+D+I+QMNPPKF MIEDMA LT LN+ASVL NL++RY   +IYTYSGLFCVT+NPYK  P+YT  V++ YKGKRR+E PPHI+SI+DNAY +M+ +R+NQS+LITGESGAGKT NTK+VI YFA VAA  +     +    K  GTLEDQI++ANP +EA+GNAKT+RN+NSSRFGKFIRIHFG +GK+A ADI+ YLLEKSRV  QQ GER+YHI+YQILS G KP   + LL+S +P  Y F +QG  T+D +DD EE+  TD A DILGFS EEK   +K   ++++ G MKFKQ+ REEQAE DGT  A+K A+L+G+++ DL++ +L P+VK+GNEYVTKGQN +QV+Y+VGALAK+ Y+RMF WLV R+N+TLDTK+ RQFFIGVLDIAGFEIF +N FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFG+DLQ CI+LIEKP+GILSILEEECMFPKASDMTFKAKLYDNHLGKSPNF KPK  K  + E HFEL HYAG VPYN+ GWL+KNKDPLNETV+         LLA+  E  +SS     + P    KRKK  + QT+S  H+E+LNKLM NL+ST PHF+RCI+PNE K PGV+D  +VLHQL CNGVLEGIRICRKG+PNR++Y++FKQRY IL PNAIP   FV+ ++ T K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRDE+L+ +I++ QA+ RG LMR +Y K+  ++ AL +IQ NIR +  ++ W W KL+ K+KPLL  A+ E+EM    EE  KLKE  EK +  +KELEE+ V L + KNDL LQLQ EQD+LADAEE+   L+  K  +E ++KEL + L +EE+  + L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + +L KEKKA  E  ++  + L AEE+KV  L KAKAKLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE+V DL+  K++LEE+LK+K+ E+   +S+IEDE  + AQLQ+KIKELQARI+ELEE+LEAER  RAK EK R ++  ELEELS+RLEE GGATS Q+++NKKREAE +KL+RDLEE+ + H+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+EMK +++D    +E L K K N++K  +  E Q SE + K++E  R + D +    + Q  N EL   LEE ES +NQL + K      +EE ++  EEE++AK  L+  ++    D D +RE  EEE E K ++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E A +K   LEK K RLQ EIED+++D++RAN+ A+ L+KKQ+ FD+++ EW+QKY E+QAELEASQ+ESR++S E+F++K   EES + LE++KRENKNL +EI DLT+QI   G+ +HE++K +K LE EK ++Q ALEEAE ALE EE+K+ R QLE+SQI+ ++DR++AEK+EE E  R NHQRAMESM+ASL+AE++ R EA ++KKK+E D+ E+E+ ++ ANR  +E +K  +  Q  +++L   ++D     D ++EQ    ER+  ++LAE+EE+R +LE +ER RK  E E +E T+R+N L  Q++G +  K+KL+AD++ + +++EE+  E R A E+AKKA+ D+A + +E+++EQ+    ++++KK +E   K+LQ +LDE+E  ALKGGKK + KLE +VRELE EL+ EQK++ E+QK  RK ERR+KEL  QT+ED+KN  R+QDL++KLQ K+K+YKRQ EEAE  A  NL KYRKIQ E++D+EERAD AE  + KLR + R + S+
Sbjct:   16 YLRKSAQELMKVQTIAFDGKKKAWIPDDKEAYIEVEIKDSSGGKVNVETKDKKTLTVKEDDIQQMNPPKFDMIEDMAMLTHLNEASVLSNLKRRYANWMIYTYSGLFCVTVNPYKWLPVYTATVVAAYKGKRRSEAPPHIYSIADNAYNDMVRNRENQSMLITGESGAGKTVNTKRVIQYFAIVAALGEGLGKKSAPATKTGGTLEDQIIEANPAMEAFGNAKTLRNDNSSRFGKFIRIHFGPTGKLASADIDIYLLEKSRVIFQQPGERSYHIYYQILS-GKKPELQDMLLVSTNPYDYHFCSQGVTTVDNLDDGEELMATDHAMDILGFSQEEKTGSYKIVGAVMHFGNMKFKQKQREEQAETDGTESADKAAYLMGISSADLIKGLLHPRVKIGNEYVTKGQNVEQVVYAVGALAKATYDRMFKWLVSRINRTLDTKLARQFFIGVLDIAGFEIFEYNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWVFIDFGLDLQPCIDLIEKPLGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFQKPKLDKKRRYEPHFELMHYAGVVPYNIVGWLDKNKDPLNETVVTVFQKSSNKLLASLYEKYISSYSDEHQKPGVKEKRKKAASFQTVSQLHKENLNKLMTNLRSTQPHFVRCIIPNESKTPGVMDPFMVLHQLRCNGVLEGIRICRKGYPNRLLYADFKQRYRILNPNAIPDDKFVDSRKATEKLLGSLDIDHTQYKFGHTKVFFKAGLLGQLEEMRDERLAKIITMLQARSRGRLMRIEYHKIIARKDALMVIQWNIRAFNAVKNWSWMKLFFKIKPLLKSAQTEKEMANMKEEFLKLKEALEKSEAKRKELEERQVTLTQEKNDLGLQLQAEQDNLADAEERCDLLIKTKIQLEAKVKELTERLEDEEEMNSDLTSKKRKLEDECAELKKDIDDLEITLAKVEKEKHATENKVKNLIEEMAALDEIIARLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLTQESVMDLDNDKQQLEEKLKKKDFEISQLNSRIEDEQVMCAQLQKKIKELQARIEELEEELEAERATRAKVEKQRAEVAKELEELSERLEEAGGATSVQIEMNKKREAEFLKLRRDLEEATLHHEATAAGLRKKHADTVAELGEQIDSLQRVKQKLEKEKSEMKMEIDDFTSNIEQLTKNKGNAEKLCRTYEDQLSEAKSKVDELQRQLADISLHRARLQTENGELSRLLEEKESLVNQLSRGKASFTQTIEELKRQLEEETKAKNALAHALQASRHDCDLMREQYEEEQEAKGELQRSLSKANAEVAQWRNKYETDAIQRTEELEEAKKKLAARLQDAEEAVEVANAKCSSLEKTKHRLQTEIEDLVIDLERANSAAAALDKKQRNFDRILGEWKQKYEETQAELEASQKESRSLSTELFKLKNAYEESLDNLETMKRENKNLQEEIADLTDQISASGKMIHELEKVKKALESEKSDIQAALEEAEGALEHEESKTLRIQLELSQIKADVDRKVAEKDEEIENLRRNHQRAMESMQASLDAEAKARNEAIRLKKKMEGDLNEMEIQLNHANRQAAESQKMVRNLQSHIKDLQIELDDTLRHNDDLKEQAAALERRNNLLLAEVEELRAALEQAERGRKLAEQELLEATERVNLLHSQNTGLINQKKKLDADISQLTTEVEESVQECRNAEEKAKKAITDAAMMAEELKKEQDTTAHLERMKKNMEQTIKDLQMRLDEAEQIALKGGKKQIQKLEAKVRELEGELEIEQKKNAETQKGVRKYERRIKELTYQTEEDRKNLARMQDLIDKLQMKVKSYKRQSEEAETQANSNLVKYRKIQHELDDAEERADVAEGQVNKLRARTREAASS 1938          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: dtd2 (D-tyrosyl-tRNA deacylase 2 (putative) [Source:Xenbase;Acc:XB-GENE-971364])

HSP 1 Score: 1805.8 bits (4676), Expect = 0.000e+0
Identity = 1047/1900 (55.11%), Postives = 1405/1900 (73.95%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNN------TGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            FD K  C++P+ ++ ++ A I    G   T +T   +T TVK  ++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +A+   K+E         KGTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG SGK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      + LL++ +P  YS+I+QGE+T+  +DD +E+  TD AFD+LGF+A+EK+ ++K T +I++ G M+FKQ+ REEQAE DGT EA+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQN  QV YS+GALAKS+Y +MF W+V+R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN++GWLEKNKDPLNETV+ L   S   L++ LFA     ++       G +KKG + QT+S+ HRE+LNKLM NL++T PHF+RCI+PNE K PG +D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++ + K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG LMRR++KK+ ++R AL +IQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  +LKE  EK +  +KELEE+ V LL+ KNDL LQ+Q E D+L DAEE+  +L+  K  +E ++KE  + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L AEE+KV +L KAK+KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE V DLE  K++LEE+ K+KE E+   +SKIEDE  +  QLQ+K+KE QARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS QM+LNKKREAE +KL+RDLEES +Q +   A  RKK  D V E SEQ+D LQ+VK K+EKEK+E K +L+D+   +E + K+KAN +K  + +E Q +E + K EEA R +ND ++   K Q  N EL  RL+E E+ ++Q+ + KQ    QLE+ ++  EEES+AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ E EE  E   +K   LEK K RLQ EIED++VD++R+N  A+ L+KKQ+ FDKV++EW+QK+ ESQ ELE+SQ+++R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+GEGG+S+HE++K RK+LE EK ELQ ALEEAE +LE EE K  R+QLE +Q++ EIDR+LAEK+EE E  + N+QR +++++  LEAE R R EA ++KKK+E D+ E+E+ +  ANR  SE  K+ K     +++    ++D     D ++E T + ER+  ++ AELEE+R  LE +ER+RK  E E +E ++R+  L  Q++  +  K+K E+DLA +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK L KLE RVREL++EL+ EQKR+ ES KN RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE +  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   31 FDIKTECFVPEPQQEYVKAKIISREGGKVTAETQDGKTITVKDSDVHQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNSEVVTAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIASVGGKKEQANAN----KGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGASGKLASADIETYLLEKSRVIFQLKSERDYHIFYQILSNKKPELLDMLLVTNNPYDYSYISQGEVTVASIDDSDELMATDNAFDVLGFTADEKVGVYKLTGAIMHSGNMRFKQKQREEQAEPDGTEEADKAAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVNYSIGALAKSVYEKMFLWMVVRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDTTFKAKLYDNHLGKSNNF-QKPRNIKGKPEAHFALVHYAGTVDYNISGWLEKNKDPLNETVVGLYQKSSLKLLAVLFANYAGADSDTGGKGKGAKKKGSSFQTVSALHRENLNKLMTNLRTTHPHFVRCIIPNERKAPGEMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGSEKLLGSLDIDHTQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGLLMRREFKKILERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKTAETEKEMANMKEEFQRLKEALEKSETRRKELEEKMVSLLQEKNDLQLQVQAESDNLNDAEERCEQLIKNKIQLEAKLKEQTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKAKSKLEQQVDDLEGSLEQEKKLRMDMERAKRKLEGDLKLTQENVMDLENDKQQLEEKAKKKEFEISQLNSKIEDEQMMGMQLQKKMKEHQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQMELNKKREAEFLKLRRDLEESTLQSEATAAALRKKHADSVAELSEQIDNLQRVKQKLEKEKSEFKLELDDVASNMEQIVKSKANLEKMCRTLEDQMNENRSKYEEAQRTLNDISSQKAKLQTENGELNRRLDEKEALVSQMTRGKQTYSQQLEDLKRQLEEESKAKNALAHGLQSARHDCDLLREQYEEEQEAKAELQRILSKANAEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDLERSNAAAAALDKKQRNFDKVLAEWKQKFEESQTELESSQKDARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKSIHELEKIRKQLEQEKMELQTALEEAEASLEHEEGKILRAQLEFNQLKSEIDRKLAEKDEEMEQVKRNNQRLVDALQTQLEAEIRSRNEALRVKKKMEGDLNEMEIQLSQANRSASEAHKHLKAAHGSLKDTQMQLDDTMRANDDLKENTAIVERRNMLLQAELEELRSILEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKTESDLAQLQAEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQQRLDEAEQIAMKGGKKQLQKLESRVRELDSELENEQKRNAESIKNMRKYERRIKELTYQTEEDKKNMARLQDLVDKLQLKVKAYKRQAEEAEEQSNSNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1925          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: dtd2 (D-tyrosyl-tRNA deacylase 2 (putative) [Source:Xenbase;Acc:XB-GENE-971364])

HSP 1 Score: 1805.42 bits (4675), Expect = 0.000e+0
Identity = 1049/1898 (55.27%), Postives = 1405/1898 (74.03%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDK--SETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDP--NNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            FD K  C++P+ ++ ++ A I    G   T +T    SET TVK  ++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +A+           G+K +GTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG SGK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      + LL++ +P  YS+I+QGE+T+  +DD +E+  TD AFD+LGF+A+EK+ ++K T +I++ G M+FKQ+ REEQAE DGT EA+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQN  QV YS+GALAKS+Y +MF W+V+R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN++GWLEKNKDPLNETV+ L   S   L++ LFA   D      G +KKG + QT+S+ HRE+LNKLM NL++T PHF+RCI+PNE K PG +D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++ + K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG LMRR++KK+ ++R AL +IQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  +LKE  EK +  +KELEE+ V LL+ KNDL LQ+Q E D+L DAEE+  +L+  K  +E ++KE  + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L AEE+KV +L KAK+KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE V DLE  K++LEE+ K+KE E+   +SKIEDE  +  QLQ+K+KE QARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS QM+LNKKREAE +KL+RDLEES +Q +   A  RKK  D V E SEQ+D LQ+VK K+EKEK+E K +L+D+   +E + K+KAN +K  + +E Q +E + K EEA R +ND ++   K Q  N EL  RL+E E+ ++Q+ + KQ    QLE+ ++  EEES+AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ E EE  E   +K   LEK K RLQ EIED++VD++R+N  A+ L+KKQ+ FDKV++EW+QK+ ESQ ELE+SQ+++R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+GEGG+S+HE++K RK+LE EK ELQ ALEEAE +LE EE K  R+QLE +Q++ EIDR+LAEK+EE E  + N+QR +++++  LEAE R R EA ++KKK+E D+ E+E+ +  ANR  SE  K+ K     +++    ++D     D ++E T + ER+  ++ AELEE+R  LE +ER+RK  E E +E ++R+  L  Q++  +  K+K E+DLA +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK L KLE RVREL++EL+ EQKR+ ES KN RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE +  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   34 FDIKTECFVPEPQQEYVKAKIISREGGKVTAETQDADSETITVKDSDVHQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNSEVVTAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIASVG---------GKKEQGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGASGKLASADIETYLLEKSRVIFQLKSERDYHIFYQILSNKKPELLDMLLVTNNPYDYSYISQGEVTVASIDDSDELMATDNAFDVLGFTADEKVGVYKLTGAIMHSGNMRFKQKQREEQAEPDGTEEADKAAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVNYSIGALAKSVYEKMFLWMVVRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDTTFKAKLYDNHLGKSNNF-QKPRNIKGKPEAHFALVHYAGTVDYNISGWLEKNKDPLNETVVGLYQKSSLKLLAVLFANYADTGGKGKGAKKKGSSFQTVSALHRENLNKLMTNLRTTHPHFVRCIIPNERKAPGEMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGSEKLLGSLDIDHTQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGLLMRREFKKILERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKTAETEKEMANMKEEFQRLKEALEKSETRRKELEEKMVSLLQEKNDLQLQVQAESDNLNDAEERCEQLIKNKIQLEAKLKEQTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKAKSKLEQQVDDLEGSLEQEKKLRMDMERAKRKLEGDLKLTQENVMDLENDKQQLEEKAKKKEFEISQLNSKIEDEQMMGMQLQKKMKEHQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQMELNKKREAEFLKLRRDLEESTLQSEATAAALRKKHADSVAELSEQIDNLQRVKQKLEKEKSEFKLELDDVASNMEQIVKSKANLEKMCRTLEDQMNENRSKYEEAQRTLNDISSQKAKLQTENGELNRRLDEKEALVSQMTRGKQTYSQQLEDLKRQLEEESKAKNALAHGLQSARHDCDLLREQYEEEQEAKAELQRILSKANAEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDLERSNAAAAALDKKQRNFDKVLAEWKQKFEESQTELESSQKDARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKSIHELEKIRKQLEQEKMELQTALEEAEASLEHEEGKILRAQLEFNQLKSEIDRKLAEKDEEMEQVKRNNQRLVDALQTQLEAEIRSRNEALRVKKKMEGDLNEMEIQLSQANRSASEAHKHLKAAHGSLKDTQMQLDDTMRANDDLKENTAIVERRNMLLQAELEELRSILEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKTESDLAQLQAEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQQRLDEAEQIAMKGGKKQLQKLESRVRELDSELENEQKRNAESIKNMRKYERRIKELTYQTEEDKKNMARLQDLVDKLQLKVKAYKRQAEEAEEQSNSNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1921          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: dtd2 (D-tyrosyl-tRNA deacylase 2 (putative) [Source:Xenbase;Acc:XB-GENE-971364])

HSP 1 Score: 1805.03 bits (4674), Expect = 0.000e+0
Identity = 1047/1900 (55.11%), Postives = 1405/1900 (73.95%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNN------TGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            FD K  C++P+ ++ ++ A I    G   T +T   +T TVK  ++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +A+   K+E         KGTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG SGK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      + LL++ +P  YS+I+QGE+T+  +DD +E+  TD AFD+LGF+A+EK+ ++K T +I++ G M+FKQ+ REEQAE DGT EA+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQN  QV YS+GALAKS+Y +MF W+V+R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN++GWLEKNKDPLNETV+ L   S   L++ LFA     ++       G +KKG + QT+S+ HRE+LNKLM NL++T PHF+RCI+PNE K PG +D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++ + K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG LMRR++KK+ ++R AL +IQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  +LKE  EK +  +KELEE+ V LL+ KNDL LQ+Q E D+L DAEE+  +L+  K  +E ++KE  + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L AEE+KV +L KAK+KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE V DLE  K++LEE+ K+KE E+   +SKIEDE  +  QLQ+K+KE QARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS QM+LNKKREAE +KL+RDLEES +Q +   A  RKK  D V E SEQ+D LQ+VK K+EKEK+E K +L+D+   +E + K+KAN +K  + +E Q +E + K EEA R +ND ++   K Q  N EL  RL+E E+ ++Q+ + KQ    QLE+ ++  EEES+AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ E EE  E   +K   LEK K RLQ EIED++VD++R+N  A+ L+KKQ+ FDKV++EW+QK+ ESQ ELE+SQ+++R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+GEGG+S+HE++K RK+LE EK ELQ ALEEAE +LE EE K  R+QLE +Q++ EIDR+LAEK+EE E  + N+QR +++++  LEAE R R EA ++KKK+E D+ E+E+ +  ANR  SE  K+ K     +++    ++D     D ++E T + ER+  ++ AELEE+R  LE +ER+RK  E E +E ++R+  L  Q++  +  K+K E+DLA +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK L KLE RVREL++EL+ EQKR+ ES KN RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE +  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   31 FDIKTECFVPEPQQEYVKAKIISREGGKVTAETQDGKTITVKDSDVHQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNSEVVTAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIASVGGKKEQANAN----KGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGASGKLASADIETYLLEKSRVIFQLKSERDYHIFYQILSNKKPELLDMLLVTNNPYDYSYISQGEVTVASIDDSDELMATDNAFDVLGFTADEKVGVYKLTGAIMHSGNMRFKQKQREEQAEPDGTEEADKAAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVNYSIGALAKSVYEKMFLWMVVRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDTTFKAKLYDNHLGKSNNF-QKPRNIKGKPEAHFALVHYAGTVDYNISGWLEKNKDPLNETVVGLYQKSSLKLLAVLFANYAGADSDTGGKGKGAKKKGSSFQTVSALHRENLNKLMTNLRTTHPHFVRCIIPNERKAPGEMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGSEKLLGSLDIDHTQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGLLMRREFKKILERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKTAETEKEMANMKEEFQRLKEALEKSETRRKELEEKMVSLLQEKNDLQLQVQAESDNLNDAEERCEQLIKNKIQLEAKLKEQTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKAKSKLEQQVDDLEGSLEQEKKLRMDMERAKRKLEGDLKLTQENVMDLENDKQQLEEKAKKKEFEISQLNSKIEDEQMMGMQLQKKMKEHQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQMELNKKREAEFLKLRRDLEESTLQSEATAAALRKKHADSVAELSEQIDNLQRVKQKLEKEKSEFKLELDDVASNMEQIVKSKANLEKMCRTLEDQMNENRSKYEEAQRTLNDISSQKAKLQTENGELNRRLDEKEALVSQMTRGKQTYSQQLEDLKRQLEEESKAKNALAHGLQSARHDCDLLREQYEEEQEAKAELQRILSKANAEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDLERSNAAAAALDKKQRNFDKVLAEWKQKFEESQTELESSQKDARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKSIHELEKIRKQLEQEKMELQTALEEAEASLEHEEGKILRAQLEFNQLKSEIDRKLAEKDEEMEQVKRNNQRLVDALQTQLEAEIRSRNEALRVKKKMEGDLNEMEIQLSQANRSASEAHKHLKAAHGSLKDTQMQLDDTMRANDDLKENTAIVERRNMLLQAELEELRSILEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKTESDLAQLQAEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQQRLDEAEQIAMKGGKKQLQKLESRVRELDSELENEQKRNAESIKNMRKYERRIKELTYQTEEDKKNMARLQDLVDKLQLKVKAYKRQAEEAEEQSNSNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1925          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: pde1b (phosphodiesterase 1B [Source:Xenbase;Acc:XB-GENE-987197])

HSP 1 Score: 1803.49 bits (4670), Expect = 0.000e+0
Identity = 1050/1906 (55.09%), Postives = 1409/1906 (73.92%), Query Frame = 3
Query:  165 SKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKP-FHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVIN--------LLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVST 5852
            SKK  WIPD+KEA+I   I+D+SG    V+T   +T TVK+D+I+QMNPPKF MIEDMA LT LN+ASVL NL++RY   +IYTYSGLFCVT+NPYK  P+YT  V++ YKGKRR+E PPHI+SI+DNAY +M+ +R+NQS+LITGESGAGKT NTK+VI YFA VAA  +     +    K  GTLEDQI++ANP +EA+GNAKT+RN+NSSRFGKFIRIHFG +GK+A ADI+ YLLEKSRV  QQ GER+YHI+YQILS G KP   + LL+S +P  Y F +QG  T+D +DD EE+  TD A DILGFS EEK   +K   ++++ G MKFKQ+ REEQAE DGT  A+K A+L+G+++ DL++ +L P+VK+GNEYVTKGQN +QV+Y+VGALAK+ Y+RMF WLV R+N+TLDTK+ RQFFIGVLDIAGFEIF +N FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFG+DLQ CI+LIEKP+GILSILEEECMFPKASDMTFKAKLYDNHLGKSPNF KPK  K  + E HFEL HYAG VPYN+ GWL+KNKDPLNETV+         LLA+  E  +SS     + P    KRKK  + QT+S  H+E+LNKLM NL+ST PHF+RCI+PNE K PGV+D  +VLHQL CNGVLEGIRICRKG+PNR++Y++FKQRY IL PNAIP   FV+ ++ T K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRDE+L+ +I++ QA+ RG LMR +Y K+  ++ AL +IQ NIR +  ++ W W KL+ K+KPLL  A+ E+EM    EE  KLKE  EK +  +KELEE+ V L + KNDL LQLQ EQD+LADAEE+   L+  K  +E ++KEL + L +EE+  + L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + +L KEKKA  E  ++  + L AEE+KV  L KAKAKLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE+V DL+  K++LEE+LK+K+ E+   +S+IEDE  + AQLQ+KIKELQARI+ELEE+LEAER  RAK EK R ++  ELEELS+RLEE GGATS Q+++NKKREAE +KL+RDLEE+ + H+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+EMK +++D    +E L K K N++K  +  E Q SE + K++E  R + D +    + Q  N EL   LEE ES +NQL + K      +EE ++  EEE++AK  L+  ++    D D +RE  EEE E K ++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E A +K   LEK K RLQ EIED+++D++RAN+ A+ L+KKQ+ FD+++ EW+QKY E+QAELEASQ+ESR++S E+F++K   EES + LE++KRENKNL +EI DLT+QI   G+ +HE++K +K LE EK ++Q ALEEAE ALE EE+K+ R QLE+SQI+ ++DR++AEK+EE E  R NHQRAMESM+ASL+AE++ R EA ++KKK+E D+ E+E+ ++ ANR  +E +K  +  Q  +++L   ++D     D ++EQ    ER+  ++LAE+EE+R +LE +ER RK  E E +E T+R+N L  Q++G +  K+KL+AD++ + +++EE+  E R A E+AKKA+ D+A + +E+++EQ+    ++++KK +E   K+LQ +LDE+E  ALKGGKK + KLE +VRELE EL+ EQK++ E+QK  RK ERR+KEL  QT+ED+KN  R+QDL++KLQ K+K+YKRQ EEAE  A  NL KYRKIQ E++D+EERAD AE  + KLR + R + S+
Sbjct:   28 SKKKAWIPDDKEAYIEVEIKDSSGGKVNVETKDKKTLTVKEDDIQQMNPPKFDMIEDMAMLTHLNEASVLSNLKRRYANWMIYTYSGLFCVTVNPYKWLPVYTATVVAAYKGKRRSEAPPHIYSIADNAYNDMVRNRENQSMLITGESGAGKTVNTKRVIQYFAIVAALGEGLGKKSAPATKTGGTLEDQIIEANPAMEAFGNAKTLRNDNSSRFGKFIRIHFGPTGKLASADIDIYLLEKSRVIFQQPGERSYHIYYQILS-GKKPELQDMLLVSTNPYDYHFCSQGVTTVDNLDDGEELMATDHAMDILGFSQEEKTGSYKIVGAVMHFGNMKFKQKQREEQAETDGTESADKAAYLMGISSADLIKGLLHPRVKIGNEYVTKGQNVEQVVYAVGALAKATYDRMFKWLVSRINRTLDTKLARQFFIGVLDIAGFEIFEYNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWVFIDFGLDLQPCIDLIEKPLGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFQKPKLDKKRRYEPHFELMHYAGVVPYNIVGWLDKNKDPLNETVVTVFQKSSNKLLASLYEKYISSYSDEHQKPGVKEKRKKAASFQTVSQLHKENLNKLMTNLRSTQPHFVRCIIPNESKTPGVMDPFMVLHQLRCNGVLEGIRICRKGYPNRLLYADFKQRYRILNPNAIPDDKFVDSRKATEKLLGSLDIDHTQYKFGHTKVFFKAGLLGQLEEMRDERLAKIITMLQARSRGRLMRIEYHKIIARKDALMVIQWNIRAFNAVKNWSWMKLFFKIKPLLKSAQTEKEMANMKEEFLKLKEALEKSEAKRKELEERQVTLTQEKNDLGLQLQAEQDNLADAEERCDLLIKTKIQLEAKVKELTERLEDEEEMNSDLTSKKRKLEDECAELKKDIDDLEITLAKVEKEKHATENKVKNLIEEMAALDEIIARLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLTQESVMDLDNDKQQLEEKLKKKDFEISQLNSRIEDEQVMCAQLQKKIKELQARIEELEEELEAERATRAKVEKQRAEVAKELEELSERLEEAGGATSVQIEMNKKREAEFLKLRRDLEEATLHHEATAAGLRKKHADTVAELGEQIDSLQRVKQKLEKEKSEMKMEIDDFTSNIEQLTKNKGNAEKLCRTYEDQLSEAKSKVDELQRQLADISLHRARLQTENGELSRLLEEKESLVNQLSRGKASFTQTIEELKRQLEEETKAKNALAHALQASRHDCDLMREQYEEEQEAKGELQRSLSKANAEVAQWRNKYETDAIQRTEELEEAKKKLAARLQDAEEAVEVANAKCSSLEKTKHRLQTEIEDLVIDLERANSAAAALDKKQRNFDRILGEWKQKYEETQAELEASQKESRSLSTELFKLKNAYEESLDNLETMKRENKNLQEEIADLTDQISASGKMIHELEKVKKALESEKSDIQAALEEAEGALEHEESKTLRIQLELSQIKADVDRKVAEKDEEIENLRRNHQRAMESMQASLDAEAKARNEAIRLKKKMEGDLNEMEIQLNHANRQAAESQKMVRNLQSHIKDLQIELDDTLRHNDDLKEQAAALERRNNLLLAEVEELRAALEQAERGRKLAEQELLEATERVNLLHSQNTGLINQKKKLDADISQLTTEVEESVQECRNAEEKAKKAITDAAMMAEELKKEQDTTAHLERMKKNMEQTIKDLQMRLDEAEQIALKGGKKQIQKLEAKVRELEGELEIEQKKNAETQKGVRKYERRIKELTYQTEEDRKNLARMQDLIDKLQMKVKSYKRQSEEAETQANSNLVKYRKIQHELDDAEERADVAEGQVNKLRARTREAASS 1932          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh6 (myosin, heavy polypeptide 6, cardiac muscle, alpha [Source:MGI Symbol;Acc:MGI:97255])

HSP 1 Score: 1793.09 bits (4643), Expect = 0.000e+0
Identity = 1052/1921 (54.76%), Postives = 1415/1921 (73.66%), Query Frame = 3
Query:  108 QYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAA---TKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG-------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            QYL    K  ++     FD +  C++PD+KE ++ A +    G   T +T+  +T T+K+D++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA    +KKE  +       KGTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ERNYHIFYQILSN      + LL++ +P  Y+F++QGE+++  +DD EE+  TD AFD+L F+AEEK  ++K T +I++ G MKFKQ+ REEQAE DGT +A+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV YS+GALAKS+Y +MF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASDMTFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+ GWLEKNKDPLNETV+ L   S   L+++LF+      +TG        +KKG + QT+S+ HRE+LNKLM NL++T PHF+RCI+PNE K PGV+D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++   K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG LMR ++KK+ ++R AL +IQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  ++K+  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+L DAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L AEE+KV  L K+K KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K +LEE+LK+KE ++   +SKIEDE  L  QLQ+K+KE QARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + KLEEA R +ND      K Q  N EL  +LEE E+ I+QL + K     Q+E+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+GEGG++VHE++K RK+LE+EK ELQ ALEEAE +LE EE K  R+QLE +QI+ EI+R+LAEK+EE E  + NH R ++S++ SL+AE+R R EA ++KKK+E D+ E+E+ +  ANRI SE +K+ K  Q  +++    ++D  H  D ++E   + ER+  ++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K+E+DL  +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   14 QYLRKSEKERLEAQTRPFDIRTECFVPDDKEEYVKAKVVSREGGKVTAETENGKTVTIKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRSKKENPNAN-----KGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLDMLLVTNNPYDYAFVSQGEVSVASIDDSEELLATDSAFDVLSFTAEEKAGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYYSIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDMTFKAKLYDNHLGKSNNF-QKPRNVKGKQEAHFSLVHYAGTVDYNIMGWLEKNKDPLNETVVGLYQKSSLKLMATLFSTYASA-DTGDSGKGKGGKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMANMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDISQQNSKIEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSSRHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKIRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSQANRIASEAQKHLKNSQAHLKDTQLQLDDAVHANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLMRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1927          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh6 (myosin, heavy polypeptide 6, cardiac muscle, alpha [Source:MGI Symbol;Acc:MGI:97255])

HSP 1 Score: 1793.09 bits (4643), Expect = 0.000e+0
Identity = 1052/1921 (54.76%), Postives = 1415/1921 (73.66%), Query Frame = 3
Query:  108 QYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAA---TKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG-------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            QYL    K  ++     FD +  C++PD+KE ++ A +    G   T +T+  +T T+K+D++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA    +KKE  +       KGTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ERNYHIFYQILSN      + LL++ +P  Y+F++QGE+++  +DD EE+  TD AFD+L F+AEEK  ++K T +I++ G MKFKQ+ REEQAE DGT +A+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV YS+GALAKS+Y +MF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASDMTFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+ GWLEKNKDPLNETV+ L   S   L+++LF+      +TG        +KKG + QT+S+ HRE+LNKLM NL++T PHF+RCI+PNE K PGV+D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++   K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG LMR ++KK+ ++R AL +IQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  ++K+  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+L DAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L AEE+KV  L K+K KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K +LEE+LK+KE ++   +SKIEDE  L  QLQ+K+KE QARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + KLEEA R +ND      K Q  N EL  +LEE E+ I+QL + K     Q+E+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+GEGG++VHE++K RK+LE+EK ELQ ALEEAE +LE EE K  R+QLE +QI+ EI+R+LAEK+EE E  + NH R ++S++ SL+AE+R R EA ++KKK+E D+ E+E+ +  ANRI SE +K+ K  Q  +++    ++D  H  D ++E   + ER+  ++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K+E+DL  +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   14 QYLRKSEKERLEAQTRPFDIRTECFVPDDKEEYVKAKVVSREGGKVTAETENGKTVTIKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRSKKENPNAN-----KGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLDMLLVTNNPYDYAFVSQGEVSVASIDDSEELLATDSAFDVLSFTAEEKAGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYYSIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDMTFKAKLYDNHLGKSNNF-QKPRNVKGKQEAHFSLVHYAGTVDYNIMGWLEKNKDPLNETVVGLYQKSSLKLMATLFSTYASA-DTGDSGKGKGGKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMANMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDISQQNSKIEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSSRHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKIRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSQANRIASEAQKHLKNSQAHLKDTQLQLDDAVHANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLMRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1927          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh7 (myosin, heavy polypeptide 7, cardiac muscle, beta [Source:MGI Symbol;Acc:MGI:2155600])

HSP 1 Score: 1787.7 bits (4629), Expect = 0.000e+0
Identity = 1049/1899 (55.24%), Postives = 1408/1899 (74.14%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF---APAEDPNN--TGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            FD KK+ ++PD+KE F+ A I    G   T +T+  +T TVK+D++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA   + + D   G   KGTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      + LLI+ +P  Y+FI+QGE T+  +DD EE+  TD AFD+LGF+ EEK S++K T +I++ G MKFKQ+ REEQAE DGT EA+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQN  QV Y++GALAKS+Y +MF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+DMTFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+ GWL+KNKDPLNETV+ L   S   L+S+LF   A A+ P +   GK KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K PGV+D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++   K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG L R ++KKL ++R +L IIQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  ++K+  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+LADAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELK+D+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K++L+E+LK+K+ EL   +++IEDE  L +QLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + K EE  R +ND  +   K Q  N EL  +L+E E+ I+QL + K     QLE+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+G  G+S+HE++K RK+LE EK ELQ ALEEAE +LE EE K  R+QLE +QI+ EI+R+LAEK+EE E  + NH R ++S++ SL+AE+R R EA ++KKK+E D+ E+E+ +  ANR+ +E +K  K  Q  +++    ++D     D ++E   + ER+  ++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K++ADL+ +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   31 FDLKKDVFVPDDKEEFVKAKIVSREGGKVTAETENGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQTPG---KGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDSEELMATDSAFDVLGFTPEEKNSIYKLTGAIMHFGNMKFKQKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVSYAIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNF-QKPRNVKGKQEAHFSLVHYAGTVDYNILGWLQKNKDPLNETVVGLYQKSSLKLLSNLFANYAGADAPADKGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMATMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIVKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSTGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1925          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh7 (myosin, heavy polypeptide 7, cardiac muscle, beta [Source:MGI Symbol;Acc:MGI:2155600])

HSP 1 Score: 1787.7 bits (4629), Expect = 0.000e+0
Identity = 1049/1899 (55.24%), Postives = 1408/1899 (74.14%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF---APAEDPNN--TGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            FD KK+ ++PD+KE F+ A I    G   T +T+  +T TVK+D++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA   + + D   G   KGTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      + LLI+ +P  Y+FI+QGE T+  +DD EE+  TD AFD+LGF+ EEK S++K T +I++ G MKFKQ+ REEQAE DGT EA+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQN  QV Y++GALAKS+Y +MF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+DMTFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+ GWL+KNKDPLNETV+ L   S   L+S+LF   A A+ P +   GK KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K PGV+D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++   K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG L R ++KKL ++R +L IIQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  ++K+  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+LADAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELK+D+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K++L+E+LK+K+ EL   +++IEDE  L +QLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + K EE  R +ND  +   K Q  N EL  +L+E E+ I+QL + K     QLE+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+G  G+S+HE++K RK+LE EK ELQ ALEEAE +LE EE K  R+QLE +QI+ EI+R+LAEK+EE E  + NH R ++S++ SL+AE+R R EA ++KKK+E D+ E+E+ +  ANR+ +E +K  K  Q  +++    ++D     D ++E   + ER+  ++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K++ADL+ +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   31 FDLKKDVFVPDDKEEFVKAKIVSREGGKVTAETENGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQTPG---KGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDSEELMATDSAFDVLGFTPEEKNSIYKLTGAIMHFGNMKFKQKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVSYAIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNF-QKPRNVKGKQEAHFSLVHYAGTVDYNILGWLQKNKDPLNETVVGLYQKSSLKLLSNLFANYAGADAPADKGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMATMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIVKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSTGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1925          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh4 (myosin, heavy polypeptide 4, skeletal muscle [Source:MGI Symbol;Acc:MGI:1339713])

HSP 1 Score: 1765.74 bits (4572), Expect = 0.000e+0
Identity = 1019/1916 (53.18%), Postives = 1407/1916 (73.43%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDP------NNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            YL    K  ++     FD+K + ++ D KE+++ AT++   G   T KT+   T TVK D++  MNPPK+  IEDMA +T L++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y P+V++ Y+GK+R E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +A    K++++  +G K +GTLEDQI+ ANP+LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ER+YHIFYQI+SN      E LLI+ +P  +++++QGE+T+  +DD+EE+  TD A DILGFSA+EK++++K T ++++ G MKFKQ+ REEQAE DGT  A+K A+L  +N+ DL++++  P+VKVGNEYVTKGQ   QV  SVGALAKS+Y +MF W+V R+N+ LDTK  RQ+FIGVLDIAGFEIF+FN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE IDWEFIDFGMDL ACIELIEKPMGI SILEEECMFPKA+D +FK KLY+ HLGKS NF +   P  G+AEAHF L HYAG+V YN+ GWL+KNKDPLNETV+ L   S    ++ LF+  +           G +KKG + QT+S+  RE+LNKLM NL+ST PHF+RC++PNE K PG ++  LVLHQL CNGVLEGIRICRKGFP+R++Y++FKQRY +L  +AIP+G F++ K+ + K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRDEKL+ LI+  QA  RGYLMR ++KK+ ++R ++  IQ N+R ++ ++ WPW KLY K+KPLL  A  E+EM    E+  K KE+  K +  +KELEE+ V L++ KNDL LQ+Q E D LADAEE+  +L+  K  +E +IKEL +   +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK  QE+  D+E  K++L+E+LK+KE E+ N  SKIEDE  L  QLQ+KIKELQARI+ELEE++EAER +RAKAEK R  L  ELEE+S+RLEE GGATSAQ+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E+K +++DL   +E+++KAK N +K  + +E Q SE++ K EE  R IN+ +    +    + E   +L+E ++ ++QL + KQ    Q+EE ++  EEES+AK  L+  +++   D D LRE  EEE E K+++QR + KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   SK   LEK K RLQ E+ED+++DV+R+N   + L+KKQ+ FDKV++EW+QKY E+QAELEASQ+ESR++S E+F++K   EES +QLE++KRENKNL  EI DLTEQI EGG+ +HE++K +K+++ EK ELQ +LEEAE +LE EE K  R QLE++Q++ EIDR++AEK+EE +  + NH R +ESM+++L+AE R R +A ++KKK+E D+ E+E+ ++ ANR  +E  +N +  Q  +++    ++D    +D ++EQ  M ER+  ++ AE+EE+R SLE +ER+R+  E E ++ ++R+  L  Q++  + TK+KLE D++ +Q ++E+   EAR A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK + KLE RVRELE E++ EQKR++E+ K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKRQ EEAEE + VNLAK+RKIQ E+E++EERAD AE  + KLR K+R
Sbjct:   16 YLRKSEKERIEAQNKPFDAKSSVFVVDAKESYVKATVQSREGGKVTAKTEGGATVTVKDDQVFSMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGDKKKEEATSG-KMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKKPELIEMLLITTNPYDFAYVSQGEITVPSIDDQEELMATDTAVDILGFSADEKVAIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLTSLNSADLLKALCYPRVKVGNEYVTKGQTVQQVYNSVGALAKSMYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNTLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIDWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYEQHLGKSNNF-QKPKPAKGKAEAHFSLVHYAGTVDYNIIGWLDKNKDPLNETVVGLYQKSGLKTLAFLFSGGQAAEAEGGGGKKGGKKKGSSFQTVSALFRENLNKLMTNLKSTHPHFVRCLIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGTLEEMRDEKLAQLITRTQAVCRGYLMRVEFKKMMERRESIFCIQYNVRAFMNVKHWPWMKLYFKIKPLLKSAETEKEMANMKEDFEKAKEDLAKSEAKRKELEEKMVALMQEKNDLQLQVQAEADGLADAEERCDQLIKTKIQLEAKIKELTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDENIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALGMQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMETVSKAKGNLEKMCRTLEDQLSEVKTKEEEQQRLINELSTQKARLHTESGEFSRQLDEKDAMVSQLSRGKQAFTQQIEELKRQLEEESKAKNALAHALQSARHDCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNSKCASLEKTKQRLQNEVEDLMIDVERSNAACAALDKKQRNFDKVLAEWKQKYEETQAELEASQKESRSLSTELFKVKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKHIHELEKIKKQIDQEKSELQASLEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHLRVVESMQSTLDAEIRSRNDALRIKKKMEGDLNEMEIQLNHANRQAAEAIRNLRNTQGMLKDTQLHLDDALRGQDDLKEQLAMVERRANLMQAEIEELRASLEQTERSRRVAEQELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEMEDIVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELENEVENEQKRNIEAVKGLRKHERRVKELTYQTEEDRKNVLRLQDLVDKLQTKVKAYKRQAEEAEEQSNVNLAKFRKIQHELEEAEERADIAESQVNKLRVKSR 1929          
BLAST of Myosin heavy chain vs. UniProt
Match: sp|P24733|MYS_ARGIR (Myosin heavy chain, striated muscle OS=Argopecten irradians OX=31199 PE=1 SV=1)

HSP 1 Score: 2240.69 bits (5805), Expect = 0.000e+0
Identity = 1242/1921 (64.65%), Postives = 1556/1921 (81.00%), Query Frame = 3
Query:   81 NMNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVK-TDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXX-XXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDP--NNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTK 5831
            N++ SDPDFQYL VDRK LMK+   +FD KKNCW+PDEKE F +A I+ + GD  TVK    S T+TVKKD+I+ MNPPKF  +EDMAN+T+LN+ASVL NLR RY   LIYTYSGLFC+ +NPY+R PIYT  VI+KY+GKR+TE+PPH+FS++DNAY NM+ DR+NQS LITGESGAGKTENTKKVI Y A VA A KK+  D     K++G+LEDQI+QANPVLEAYGNAKT RNNNSSRFGKFIRIHFG +GKIAGADIE YLLEKSRV  QQ  ERNYHIFYQI SN     ++ +L++PD  LYSFINQG LT+D +DD EE K+ DEAFDILGF+ EEK S+FKCT SIL+MGEMKFKQRPREEQAE+DGTAEAEKVAFL G+NA DL++++LKPKVKVG E VTKGQN +QV+ SVGALAKSLY+RMF WLV RVNKTLDTK KR ++IGVLDIAGFEIF+FN FEQ+CINYTNERLQQFFNHHMF+LEQEEYKKE I WEFIDFGMDLQ CI+LIEKPMGILSILEEECMFPKA D +F+ KLY NH+GK+  F KP KP +P Q  AHFELHHYAG+VPY++TGWLEKNKDP+NE V+ LL ASKE LV+ LF   E+P      K+ K  A QTIS+ HRESLNKLMKNL ST PHF+RCI+PNE KQPG++DA LVLHQL CNGVLEGIRICRKGFP+R+IYSEFKQRYSILAPNAIPQGFV+GK V+ KIL  +Q+D   YRLG TKVFFKAG L +LE+MRDE+LS +IS+FQA IRGYL+R+ YKKLQDQR+ LS+IQRNIRK+L+LR W WWKLY+KVKPLL+IARQEEEMK+  +++ K+KE+  K ++ KKELEEQNV LLE KNDLFLQLQT +DS+ D EE+V KL+MQKAD E +IKELE+ LL+EED AA LE IKKKM+ +   LKKD+ DLE++LQKAEQ+K  KD QI +LQ ++++Q+E + KL KEKKA +E  KKT +SL AEE+K  +LNK KAKLEQ +DE+E+NL RE+K+R DVEK KRK+E +LK TQE V+DLERVKRELEE ++RKE E+ + +SK+EDE  LV+QLQRKIKELQARI+ELEE+LEAER ARAK EK R +L  ELEEL +RL+E GGATSAQ++LNKKREAEL+K++RDLEE+++QH+  I+  RKK QD  NE ++Q+DQLQKVK+K+EK+K ++K +++DL+ Q+    K K  S+K +K+ E+Q S+L  +LE++ R IN+  +   + Q  N++L  +LE+AE +++ L K K Q+ +QLE+AR+  EEE+RA++KL ++VRN++AD+D +RE LEEE E+KSD+QRQL KA  E+QQ ++KFE  G+ R+EEL++ KRK + ++ E E+  E A +K   LEK K+RLQ E+EDM ++VDRAN   +Q+EKKQ+ FDK  +EWQ K    Q+ELE SQ+ESR  SAE++R+KA IEE Q+ + +++RENKNLADEIHDLT+Q+ EGGRS HE+DKAR+RLEMEKEELQ ALEEAE ALEQEEAK  R+QLE++ +R EID+R+ EKEEEF+ TR NHQRA+ESM+ASLEAE++G+A+A ++KKKLE DI ELEVA+D +NR ++E EK  K++QQQ++E+ + +E+E+ Q+D+ RE   M ER+ T++  E+EE+R +LE +ER RK ++NE  +  DR+NEL+ Q S     KRKLE D+ AMQ+DL+E   E + A+E+ KKA+AD+ARL DE+R EQ+H+ Q++K++K LE+Q KE Q +LDE+E ++LKGGKK + KLE RV ELEAELD EQ+RH E+QKN RK +RRLKEL  Q DED+KNQERLQ+L++KL  KIKT+KRQVEEAEEIAA+NLAKYRK Q E+E++EERAD A+  LQK R K
Sbjct:    2 NIDFSDPDFQYLAVDRKKLMKEQTAAFDGKKNCWVPDEKEGFASAEIQSSKGDEITVKIVADSSTRTVKKDDIQSMNPPKFEKLEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAYQNMVTDRENQSCLITGESGAGKTENTKKVIMYLAKVACAVKKK--DEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVMLVTPDSGLYSFINQGCLTVDNIDDVEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGEMKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLKPKVKVGTEMVTKGQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCINYTNERLQQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFPKADDKSFQDKLYQNHMGKNRMFTKPGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKDPINENVVALLGASKEPLVAELFKAPEEPAGGGKKKKGKSSAFQTISAVHRESLNKLMKNLYSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFKQRYSILAPNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKKLQDQRIGLSVIQRNIRKWLVLRNWQWWKLYSKVKPLLSIARQEEEMKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFLQLQTLEDSMGDQEERVEKLIMQKADFESQIKELEERLLDEEDAAADLEGIKKKMEADNANLKKDIGDLENTLQKAEQDKAHKDNQISTLQGEISQQDEHIGKLNKEKKALEEANKKTSDSLQAEEDKCNHLNKLKAKLEQALDELEDNLEREKKVRGDVEKAKRKVEQDLKSTQENVEDLERVKRELEENVRRKEAEISSLNSKLEDEQNLVSQLQRKIKELQARIEELEEELEAERNARAKVEKQRAELNRELEELGERLDEAGGATSAQIELNKKREAELLKIRRDLEEASLQHEAQISALRKKHQDAANEMADQVDQLQKVKSKLEKDKKDLKREMDDLESQMTHNMKNKGCSEKVMKQFESQMSDLNARLEDSQRSINELQSQKSRLQAENSDLTRQLEDAEHRVSVLSKEKSQLSSQLEDARRSLEEETRARSKLQNEVRNMHADMDAIREQLEEEQESKSDVQRQLSKANNEIQQWRSKFESEGANRTEELEDQKRKLLGKLSEAEQTTEAANAKCSALEKAKSRLQQELEDMSIEVDRANASVNQMEKKQRAFDKTTAEWQAKVNSLQSELENSQKESRGYSAELYRIKASIEEYQDSIGALRRENKNLADEIHDLTDQLSEGGRSTHELDKARRRLEMEKEELQAALEEAEGALEQEEAKVMRAQLEIATVRNEIDKRIQEKEEEFDNTRRNHQRALESMQASLEAEAKGKADAMRIKKKLEQDINELEVALDASNRGKAEMEKTVKRYQQQIREMQTSIEEEQRQRDEARESYNMAERRCTLMSGEVEELRAALEQAERARKASDNELADANDRVNELTSQVSSVQGQKRKLEGDINAMQTDLDEMHGELKGADERCKKAMADAARLADELRAEQDHSNQVEKVRKNLESQVKEFQIRLDEAEASSLKGGKKMIQKLESRVHELEAELDNEQRRHAETQKNMRKADRRLKELAFQADEDRKNQERLQELIDKLNAKIKTFKRQVEEAEEIAAINLAKYRKAQHELEEAEERADTADSTLQKFRAK 1920          
BLAST of Myosin heavy chain vs. UniProt
Match: sp|F1PT61|MYH16_CANLF (Myosin-16 OS=Canis lupus familiaris OX=9615 GN=MYH16 PE=3 SV=2)

HSP 1 Score: 1866.28 bits (4833), Expect = 0.000e+0
Identity = 1063/1914 (55.54%), Postives = 1442/1914 (75.34%), Query Frame = 3
Query:   96 DPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            DP   +L    K  ++     +D KK+CW+ DEKE FIA  I+   GD  TVKT  ++T TVKKD+++QMNPPKF    DMA++TFLN+ASVL+NLRQRY    IYTYSGLFCVT+NPYK  PIY  +V + YKGK+RTEMPPH+FSISDNAY +ML +R+NQS+LITGESGAGKTENTKKVI YFA+V    K+  D  G GQ   G+LEDQI+QANPVLEA+GNAKT+RNNNSSRFGKFIRIHFGT+GK+AGADIE YLLEKSRV SQQ  ER YHIFYQILSN      E LL+ P+P  Y +++QG   ++ +DD EE++ITD AFD+LGFSAEEK+ ++K T  I++ G MKFKQ+PREEQAE D T  A+KV+ L+G+N+ +L + I +P+VKVGNE+V KGQN +Q   S+GAL K++Y++MF WLV+R+NKTLDTK++RQFFIGVLDIAGFEIF FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYK+E I+W FIDFG+DLQACI+L+EKPMGI SILEE+C+FPKA+D TFKA LYDNHLGKS NF KPK  K    EAHFEL HYAG+V YN+TGWLEKNKDPLNETV+ L   S   L++ LF   E P  + K+K+G +  T+S+ +RE LNKLM  L ST+PHF+RCIVPNEFKQ GV+DAHL++HQL CNGVLEGIRICRKGFPNRM Y EFKQRY +L PN IPQGFV+ K+ +  +L ++ LD N Y++G+TKVFF+AG LA LEDMRDE+L+ ++++ Q ++RG+LMR ++KK+ ++R+ L +IQRN RK+L LR W WWKLY KVKPLLN+ARQEEEMK   EEL     + +++    KELEE+   L + KNDL +QLQ EQ+++ DAEE++++++  K D+E +I ++ + L EEE  AA L   K+K++GE+ +LK+D+  LE++L K E+EK A D ++++L   ++ +E+ + KL+KEK+A +E+ +KT + L AEE+KV +L K  +KL   I E+E+N  +E+KIRA+VEK +RK E++LK T + ++D+ER K +LEE +K+++ME+ + +SK EDE  L + LQRK+KE QARI+ELEE+LEAER  RAK EK R  L  +LE+LSDRLEE GGATSAQ++ N+KREAEL+KL+R+LEE+ +Q +   +  RKK  D + E +E ++ LQ+VK+K+EK+K  MK +++DL   +E++ K+K N++  I+++E   SE   K+ E  R+  + N    + Q  N EL    EE++S++NQ+ ++K  + +Q+++ ++  +EES++++     + N   DLD ++E LEEE   KS++QR + K   E+   + K+E     R+EEL+E KRK   R+ E EE AE A+++A  LEK K RLQ E+ED+ +D+++AN  A+ L+KKQ+ FDK+++EWQQK  E Q E+++SQ+E R    E F++K   EES E LESVK+ENK L +EI +L +Q+GEGGRSVHE+ K +K+LE+EKEELQ ALEEAE +LE EE+K  R QLE++Q++ +IDRR+ EKEEEFEATR NHQRA+ES++ASLEAE++GRAEA ++KKK+E D+ E+E+ +D AN+  SE  K  K+ QQQ+++L   ++++  Q +++REQ  + ER+L+++  ELEEVR  LE SER+RK  E E +EIT+R NE+++Q+   +  KRKLE+D+  + S+ EE  +E R A+E+AKKA+ D+AR+ +E+RQEQ+H   ++KIKK  E   K+LQAK++E+E  ALKGGK+ + KLE R++ELE ELDGEQK+HVE+ K  RK ERRLKEL  QT+ED K  +R+Q+LVEKLQ K+K YKRQ+EEAEE A   LA+YRK   E++D+EERA  AE AL KLRT++R
Sbjct:   14 DP-MPFLAPPEKERIEAMNKPYDIKKSCWVKDEKEGFIAGEIQSEQGDQVTVKTVNNQTVTVKKDDVQQMNPPKFYQASDMADMTFLNEASVLNNLRQRYTNMRIYTYSGLFCVTVNPYKWLPIYGARVANMYKGKKRTEMPPHLFSISDNAYHDMLMNRENQSMLITGESGAGKTENTKKVIQYFANVGGTGKQSSD--GKGQ---GSLEDQIIQANPVLEAFGNAKTIRNNNSSRFGKFIRIHFGTTGKLAGADIESYLLEKSRVISQQAAERGYHIFYQILSNKKPELIESLLLVPNPKEYHWVSQGVTVVENMDDGEELQITDVAFDVLGFSAEEKIGIYKLTGGIMHFGNMKFKQKPREEQAEVDTTEVADKVSHLMGLNSGELQKGITRPRVKVGNEFVQKGQNVEQCNNSIGALGKAIYDKMFKWLVVRINKTLDTKMQRQFFIGVLDIAGFEIFEFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKREGIEWVFIDFGLDLQACIDLLEKPMGIFSILEEQCVFPKATDATFKAALYDNHLGKSNNFLKPKGGKGKGPEAHFELVHYAGTVAYNITGWLEKNKDPLNETVVGLFQKSSLGLLALLFKEEEAPAGSKKQKRGSSFMTVSNFYREQLNKLMATLHSTAPHFVRCIVPNEFKQSGVVDAHLIMHQLACNGVLEGIRICRKGFPNRMQYPEFKQRYQVLNPNVIPQGFVDNKKASELLLGSIDLDVNEYKIGHTKVFFRAGILAKLEDMRDERLAKIMTMLQCRLRGFLMRIEFKKMLERRIGLKVIQRNTRKFLELRFWGWWKLYNKVKPLLNVARQEEEMKAKEEELRNAMSKTQELLSRVKELEEKMATLSQEKNDLTIQLQAEQENVIDAEERLTQMMKTKMDLESQISDMRERLEEEEGTAASLSATKRKLEGEMSDLKRDLEGLETTLAKTEKEKQALDHRVRTLTGDLSLREDSIAKLQKEKRALEELHQKTLDDLQAEEDKVNHLTKTNSKLSTQIHELEDNWEQEKKIRAEVEKARRKAESDLKMTIDNLNDMERSKLDLEEVVKKRDMEINSVNSKYEDEQSLNSTLQRKLKEHQARIEELEEELEAERSMRAKVEKQRSDLSRDLEDLSDRLEEAGGATSAQIEQNRKREAELLKLRRELEEAALQSEAAASTLRKKHTDSMAELTEHVENLQRVKSKLEKDKQVMKAEIDDLNASMETVQKSKMNAEAHIRKLEDSLSEANAKVAELERNQAEINAVRTRLQAENGELSREYEESQSRLNQILRIKTSLTSQVDDYKRQLDEESKSRSAAMVSLANTKHDLDLVKEQLEEEQGGKSELQRLVSKLNTEVTTWRTKYETDAIQRTEELEETKRKLAARLQEAEETAEAAQARAASLEKNKQRLQAEVEDLTIDLEKANAAAAALDKKQRVFDKMLAEWQQKCEELQVEVDSSQKECRMYMTESFKIKTAYEESLEHLESVKKENKTLQEEIKELIDQLGEGGRSVHELQKLKKKLEIEKEELQVALEEAESSLEVEESKVIRIQLELAQVKADIDRRIHEKEEEFEATRKNHQRAIESLQASLEAEAKGRAEALRLKKKMETDLNEMEIQLDHANKNNSELVKTLKRLQQQIKDLQVQMDEDARQHEELREQYNLQERRLSLLQTELEEVRSGLEGSERSRKLLEQEVVEITERHNEVNIQNQSLLVVKRKLESDVQRISSEHEELISEFRSADERAKKAMTDAARMAEELRQEQDHCMHLEKIKKNYEITIKDLQAKMEEAEQLALKGGKRTIMKLEARIKELETELDGEQKQHVETVKTLRKNERRLKELVFQTEEDHKTNQRMQELVEKLQNKLKVYKRQIEEAEEQANQTLARYRKTVHELDDAEERAGMAETALNKLRTRHR 1921          
BLAST of Myosin heavy chain vs. UniProt
Match: sp|P05661|MYSA_DROME (Myosin heavy chain, muscle OS=Drosophila melanogaster OX=7227 GN=Mhc PE=1 SV=4)

HSP 1 Score: 1854.72 bits (4803), Expect = 0.000e+0
Identity = 1104/1917 (57.59%), Postives = 1440/1917 (75.12%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKR------KKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKIL-EAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 5888
            +DSKK+CWIPDEKE ++   I+   GD+ +V     E + +K +++E++NPPKF  IEDMA++T LN   VL NLRQRYY  LIYTYSGLFCV INPYKR+P+YT +    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K +E       K KG+LEDQ+VQ NPVLEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RV SQQ  ER+YHIFYQI+S       +  L++ +   Y  ++QG++T+  +DD EE  +TD+AFDILGF+ +EK  +++ T ++++MG MKFKQR REEQAE DG  E  +V+ L G +  +L +++LKP++KVGNE+VT+G+N  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF +NGFEQ+CIN+TNE+LQQFFNH MFV+EQEEYKKE I+W+FIDFGMDL ACI+LIEKPMGILSILEEE MFPKA+D TF  KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YN+TGWLEKNKDPLN+TV++    S+  L+  +FA     +  G++      KKGG   T+SS ++E LN LM  L+ST PHF+RCI+PNE KQPGV+DAHLV+HQL CNGVLEGIRICRKGFPNRM+Y +FK RY IL P  I    ++  +  SK+L E+ +L+ +LYRLG+TKVFF+AG L  +E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTWPW+KL+ KVKPLLN++R E+E+ +  E+  K +E      K +KELE  N KLL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L +EED    L   KKK   EI  LKKD+ DLE ++QKAEQ+K  KD QI++L D++A Q+E +NKL KEKK   E  +KT E L A E+K+ +LNK KAKLEQT+DE+E++L RE+K+R DVEK KRK+E +LK TQE V DLER K+ELE+ ++RK+ EL + ++K+EDE  +V + QR+IKELQARI+ELEE++EAERQARAKAEK R  L  ELEEL +RLEE GGATSAQ++LNKKREAEL KL+RDLEE+N+QH+  +A  RKK  D V E +EQ+DQL K+KAK E ++     +LN  +   + L + KA  +K  K+++   +E+Q KL+E NR +ND + +  K    N++L  +LEEAESQ++QL K+K  + TQLE+ +++A+EESR +A L    RNL  DLDNLRE +EEE E K+D+QRQL KA  E Q  ++K+E  G  RSEEL+EAKRK   R+ E EE  E+   K   LEK K RL  E+ED+ ++VDRAN +A+  EKKQK FDK++ EW+ K  +  AEL+ASQ+E R  S E+FR+K   EE QEQLE+V+RENKNLADE+ DL +QIGEGGR++HEI+KARKRLE EK+ELQ ALEEAE ALEQEE K  R+QLE+SQ+RQEIDRR+ EKEEEFE TR NHQRA++SM+ASLEAE++G+AEA +MKKKLE DI ELE+A+D AN+  +E +KN K++QQQ++++ + +E+E+  +D  REQ  ++ER+   +  ELEE R  LE ++R R+  E E  +  ++LNE+S Q++   A KRKLE++L  + SDL+E   EA+ + E+AKKA+ D+ARL DE+R EQ+HAQ  +K++K LE Q KELQ +LDE+E NALKGGKKA+ KLEQRVRELE ELDGEQ+RH ++QKN RK ERR+KEL  Q++ED+KN ER+QDLV+KLQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K R K R+  S  RG S AP  T+
Sbjct:   32 YDSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGEVRDIKSEKVEKVNPPKFEKIEDMADMTVLNTPCVLHNLRQRYYAKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDE-----AAKSKGSLEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHIMFVMEQEEYKKEGINWDFIDFGMDLLACIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYQILNPRGIKD--LDCPKKASKVLIESTELNEDLYRLGHTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEHDRQTCHNELNQTRTACDQLGRDKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAG-SVGRGASPAPRATS 1940          
BLAST of Myosin heavy chain vs. UniProt
Match: sp|P02563|MYH6_RAT (Myosin-6 OS=Rattus norvegicus OX=10116 GN=Myh6 PE=1 SV=2)

HSP 1 Score: 1796.17 bits (4651), Expect = 0.000e+0
Identity = 1052/1918 (54.85%), Postives = 1414/1918 (73.72%), Query Frame = 3
Query:  108 QYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG-------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            +YL    K  ++     FD +  C++PD+KE ++ A I    G   T +T+  +T TVK+D++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA   + + D     K  GTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ERNYHIFYQILSN      + LL++ +P  Y+F++QGE+++  +DD EE+  TD AFD+LGF+AEEK  ++K T +I++ G MKFKQ+ REEQAE DGT +A+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV YS+GALAKS+Y +MF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+DMTFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+ GWLEKNKDPLNETV+ L   S   L+++LF+      +TG        +KKG + QT+S+ HRE+LNKLM NL++T PHF+RCI+PNE K PGV+D  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++  +   K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG LMR ++KK+ ++R AL +IQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  ++K+  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+LADAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L AEE+KV  L K+K KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K +LEE+LK+KE ++   +SKIEDE  L  QLQ+K+KE QARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E  EQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + KLEEA R +ND      K Q  N EL  +LEE E+ I QL + K     Q+E+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+GEGG++VHE++K RK+LE+EK ELQ ALEEAE +LE EE K  R+QLE +QI+ EI+R+LAEK+EE E  + NH R ++S++ SL+AE+R R EA ++KKK+E D+ E+E+ +  ANRI SE +K+ K  Q  +++    ++D     D ++E   + ER+ T++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K++ADL+ +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   13 RYLRKSEKERLEAQTRPFDIRTECFVPDDKEEYVKAKIVSREGGKVTAETENGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRSKKDNPNANK--GTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLDMLLVTNNPYDYAFVSQGEVSVASIDDSEELLATDSAFDVLGFTAEEKAGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYYSIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNF-QKPRNVKGKQEAHFSLVHYAGTVDYNILGWLEKNKDPLNETVVGLYQKSSLKLMATLFSTYASA-DTGDSGKGKGGKKKGSSFQTVSALHRENLNKLMTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSGKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQARGQLMRIEFKKMVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMANMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDISQQNSKIEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLTRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSHMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALIWQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSARHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKIRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSQANRIASEAQKHLKNAQAHLKDTQLQLDDAVRANDDLKENIAIVERRNTLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLVRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1926          
BLAST of Myosin heavy chain vs. UniProt
Match: sp|Q9BE39|MYH7_BOVIN (Myosin-7 OS=Bos taurus OX=9913 GN=MYH7 PE=1 SV=1)

HSP 1 Score: 1794.25 bits (4646), Expect = 0.000e+0
Identity = 1056/1917 (55.09%), Postives = 1416/1917 (73.87%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFA-------PAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            YL    K  ++     FD KK+ ++PD+KE F+ ATI    G   T +T+  +T TVK+D++ Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVTINPYK  P+Y  +V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA   + + +  TG   KGTLEDQI+QANP LEA+GNAKTVRN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      + LLI+ +P  Y+FI+QGE T+  +DD EE+  TD AFD+LGF+ EEK S++K T +I++ G MKFK + REEQAE DGT EA+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQN  QV+Y+ GALAK++Y RMF W+V R+N TL+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+DMTFKAKL+DNHLGKS NF +      G+ EAHF L HYAG+V YN+ GWL+KNKDPLNETV++L   S   ++SSLFA       P E     GK KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K PGVID  LV+HQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++   K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QAQ RG L R ++KKL ++R +L IIQ NIR ++ ++ WPW KLY K+KPLL  A  E+E+    EE  +LKE  EK +  +KELEE+ V LL+ KNDL LQ+Q EQD+LADAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELK+D+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K++L+E+LK+K+ EL   +++IEDE  L +QLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGATS Q+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V E SEQ+D LQ+VK K+EKEK+E K +L+D+   +E + KAKAN +K  + +E Q +E + K EE  R +ND  +   K Q  N EL  +L+E E+ I+QL + K     QLE+ ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EES E LE+ KRENKNL +EI DLTEQ+G  G+++HE++K RK+LE EK ELQ ALEEAE +LEQEE K  R+QLE +QI+ E++R+LAEK+EE E  + NH R ++S++ SL+AE+R R EA ++KKK+E D+ E+E+ +  ANR+ +E +K  K  Q  +++    ++D     D ++E   + ER+  ++ AELEE+R  +E +ER+RK  E E +E ++R+  L  Q++  +  K+K+EADL+ +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQKR+ ES K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   15 YLRKSEKERLEAQTRPFDLKKDVFVPDDKEEFVKATILSREGGKVTAETEHGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGLFCVTINPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKEQATG---KGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTTEEKNSMYKLTGAIMHFGNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVVYAKGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLFDNHLGKSSNF-QKPRNIKGKPEAHFSLIHYAGTVDYNIIGWLQKNKDPLNETVVDLYKKSSLKMLSSLFANYAGFDTPIE--KGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVIDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEIALMKEEFGRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKVKLEQHVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELSEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKLELQSALEEAEASLEQEEGKILRAQLEFNQIKAEMERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSHANRLAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMEADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSR 1925          
BLAST of Myosin heavy chain vs. TrEMBL
Match: gnl|BL_ORD_ID|19611856 (tr|O96062|O96062_DUGJA Myosin heavy chain OS=Dugesia japonica OX=6161 GN=DjMHC-A PE=2 SV=1)

HSP 1 Score: 3306.15 bits (8571), Expect = 0.000e+0
Identity = 1807/1935 (93.39%), Postives = 1887/1935 (97.52%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 5888
            MNP+DPDFQYLGVDRKAL+KQYGDSFDSKKNCWIPDEKE FI+ATIED+SGDV+T+KT+K ETKTVKKDEI+QMNPPKF+MIEDMANLTFLNDASVLDNLRQR+YKNLIYTYSGLFCVTINPYKRFPIYT QVI+KYKGKRRTEMPPHIFSISDNAY+NML DRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKE+D++G+G KRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILS GGK FHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFS++EKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQ+KDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGKPKPPKPGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF PAED +++GKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVT KILEAVQLD NLYRLGNTK+FFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMR+QYKKLQDQRVALSIIQRNIRKYL+LRTW WWKLYTKVKPLLNIARQEEEMKKAAEEL KLKEEFEKVDKFKKELEEQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADME RIKELEDHLLEEED +AGLE++KKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIK+LQDQ+A+QEEEMNK+KKEKKAADE+QKKTEESL AEEEKVKNLNKAKAKLEQTIDEMEENLSREQK+RADVEKVKRKIETELKQTQETVDDLERVKRELEEQLKRKEMEL NASSKIEDESGLVAQLQ+KIKELQARIQELEEDLEAERQARAKAEKSRHQLEGELEELSDRLEEQGGATSAQ++LNKKREAEL+KLKRDLEE+NMQHDQ+IAQ+RKKQQDV NEFS+QLDQLQK KAK+EKEKNEMKEDLNDLQ QLE+LNKAKANSDK+IKE+E+QN+ELQGKLEE NRHINDANNTSGKNQQ NAELQARLEEAESQINQL KVKQQMQTQLEEARQ  ++ESR KAKLSSDVRNLNADLDNLREALEEENENKSD+QRQLVKAQ EMQQ+K+KFEG+GS+RSEELDEAKRKFM RIHELEEE+E+AKSK GQLEK+KARLQGEIEDMLVDVDRAN LASQLEKKQKTFDKVVSEWQQKYAESQAE+EASQRESR +SAEVFR+KAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHE +KARKRLEMEKEELQHALEEAEQALEQEEAK+QRSQLEMSQ+RQEIDRR+AEKEEEFEATRVNHQRAMESMEASLEAESRGR E+TKMKKKLEHDIGELEVAVDTANR RSE EKNAKKFQQQVQEL +MVEDEKHQKDQIREQT M ERK+ M+L ELEEVR SLENSERNRKNTE+EK+E+TDRLNELSVQSS FMATKRKLEADLAAMQSDLEEA+ EARQANEQAKKAVADS+RLFDEIRQEQEHAQQ+DKIKKQLEAQNKELQ KLDESENNA+KGGKK L KLEQRVRELEAELD EQKRHVE+QKN+RK+ERRLKE+GLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPG TT
Sbjct:    1 MNPTDPDFQYLGVDRKALLKQYGDSFDSKKNCWIPDEKEGFISATIEDSSGDVFTIKTEKLETKTVKKDEIQQMNPPKFMMIEDMANLTFLNDASVLDNLRQRFYKNLIYTYSGLFCVTINPYKRFPIYTAQVIAKYKGKRRTEMPPHIFSISDNAYSNMLTDRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEDDESGSGGKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSAGGKQFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSSDEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQSKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGKPKPPKPGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFVPAEDASSSGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTGKILEAVQLDKNLYRLGNTKIFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRKQYKKLQDQRVALSIIQRNIRKYLMLRTWAWWKLYTKVKPLLNIARQEEEMKKAAEELAKLKEEFEKVDKFKKELEEQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMESRIKELEDHLLEEEDASAGLEEMKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKALQDQIARQEEEMNKMKKEKKAADELQKKTEESLQAEEEKVKNLNKAKAKLEQTIDEMEENLSREQKVRADVEKVKRKIETELKQTQETVDDLERVKRELEEQLKRKEMELSNASSKIEDESGLVAQLQKKIKELQARIQELEEDLEAERQARAKAEKSRHQLEGELEELSDRLEEQGGATSAQLELNKKREAELLKLKRDLEEANMQHDQMIAQSRKKQQDVANEFSDQLDQLQKAKAKIEKEKNEMKEDLNDLQSQLEALNKAKANSDKKIKELESQNAELQGKLEELNRHINDANNTSGKNQQLNAELQARLEEAESQINQLTKVKQQMQTQLEEARQNLDDESRTKAKLSSDVRNLNADLDNLREALEEENENKSDLQRQLVKAQSEMQQMKSKFEGTGSVRSEELDEAKRKFMARIHELEEESESAKSKVGQLEKIKARLQGEIEDMLVDVDRANALASQLEKKQKTFDKVVSEWQQKYAESQAEVEASQRESRAVSAEVFRLKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHETEKARKRLEMEKEELQHALEEAEQALEQEEAKAQRSQLEMSQVRQEIDRRIAEKEEEFEATRVNHQRAMESMEASLEAESRGRTESTKMKKKLEHDIGELEVAVDTANRFRSEAEKNAKKFQQQVQELQAMVEDEKHQKDQIREQTMMNERKMAMILGELEEVRSSLENSERNRKNTESEKVELTDRLNELSVQSSSFMATKRKLEADLAAMQSDLEEASNEARQANEQAKKAVADSSRLFDEIRQEQEHAQQLDKIKKQLEAQNKELQVKLDESENNAMKGGKKVLGKLEQRVRELEAELDAEQKRHVETQKNTRKIERRLKEIGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGTTT 1935          
BLAST of Myosin heavy chain vs. TrEMBL
Match: gnl|BL_ORD_ID|22830191 (tr|A0A3Q0KIL4|A0A3Q0KIL4_SCHMA Myosin heavy chain OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 2586.99 bits (6704), Expect = 0.000e+0
Identity = 1425/1932 (73.76%), Postives = 1657/1932 (85.77%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPG 5879
            M+PSDPDF+YLGVDRKAL+K+  + FDSK   W+ DEKE ++ A I+D +GD  TV       K VKKD+ +Q+NPPKF +IEDMANLT LNDASVL+NLR RYY+ LIYTYSGLFCV +NPYKRFPIYT QV  KYKGKRR EMPPHIFSISDNAY NML DR+NQS+LITGESGAGKTENTKKVI+YFA VAAA+KKE+DD+     +KGTLEDQIVQANPVLEAYGNAKT RNNNSSRFGKFIRIHFGT+GKIAGADIE YLLEKSRV SQ KGERNYHIFYQ+LS  G  +H+KLL+  DPALYSFINQGELTIDGVDD EEMK+ DEAF++LGF+ +EK+SLFKCT SI NMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDL+ S LKPKVKVG E+VTKGQN +QV Y+V ALAKSLYNRMF WLV RVNKTLDTKVKRQFFIGVLDIAGFEIF  NGFEQICINYTNERLQQFFNHHMFVLEQEEYK+E I W FIDFGMDLQACI+LIEKPMGILSILEEEC+ PKASD TF +KLYDNHLGKSPNF KPKPPKPG  EAHFELHHYAGSVPY +TGWLEKNKDPLN++V+ LL  SK+ LVS+LF P  D    GKRKKGGAMQTIS+ HRESLNKLMKNLQSTSP FIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPN IP GFV+G+QVT KILEA QLD NLY+ GNTKVFFKAGTLA LED+RD+KL+ +ISLFQA+IRGYLMR+QYKKLQDQRVAL+++QRNIRKYL+LR WPWW+LYTKVKP+LNIARQEEEMKKAAEEL KLKEE+EK++K KKELEEQNV +L+ KNDLFLQLQTEQDSLADAEEK+SKLV+Q+ DME RIKELE+ L +EED AA L ++KKKM  EIEELKKDV DLESSLQKAEQEK  KD QI++LQ +MA+Q+E + KL K+KK  +E  K+T+E+L AEE+KV +LNK KAKLE T+DEMEENL+REQKIR DVEK KRK+E +LK TQETVDDLERVKR+LEEQL+RKE E+   S K EDE GLVAQLQRKIKELQ RIQELEEDLEAER AR+KAEKSR QLE ELEE+ DRLEEQ GAT+AQ DL KKREAELMKLKRDLE++ +Q++Q IA  RKKQ D +NE ++QLDQ  K KAK EKE+++ K +L+D   Q++S+ KAK NS+K +K +E+Q  E+  KL+EA R++N+  +T  ++ Q  +ELQ +LEEAESQ++QL K+KQQ+  QLEEAR   E+ESR KAKL+ +VRNL +DLD+LRE LEEE   K D+QRQL K QGE+QQL+++  G G +RSEE++E KRK   +I ELE EAE+AKSK GQLEK KARLQGE+ED++VDV+RAN LASQLE+KQ  F++ ++EWQ+KYA+SQAELE +QR++R  S E+FR+KAQ+EE  EQ+E ++RENKNL+DEIHDLTEQ+GEGGRSVHEIDK R+RLEMEKEELQ ALEEAE ALEQEEAK QR+QLEMSQIRQEIDRRLAEKEEEFEATR NHQRAMES +ASLEAE++G+AEA ++KKKLE DI ELEV++D ANR R+EQEKN KKFQQQV+EL S +ED++ Q+D +REQ    ER+ T++  EL+E+R +L+ +ER+RK  E E+ E +DR  E+S Q++   A KRKLEADLAAMQ+DLEEAA EA+QA+E+AKKA+ADSAR+F+EIRQEQEH Q ++K +KQLE Q KEL A+L++SE+ A+K G+KA+ KLEQRVRELE EL+ EQ+RH E+QKN RKV+RR+KE+ LQ +EDKK+ +R+Q+LVEKLQGKIKTYKRQVEEAEEIAA+NLAKYRKIQ EIED+EERADQAEQALQKLR KNRSSVSTARG S AP 
Sbjct:    1 MDPSDPDFKYLGVDRKALLKELAN-FDSKNVIWVEDEKEGYVLADIKDTTGDTITVALKDGSEKKVKKDDAQQVNPPKFFLIEDMANLTHLNDASVLENLRARYYRQLIYTYSGLFCVAVNPYKRFPIYTEQVALKYKGKRRGEMPPHIFSISDNAYHNMLQDRENQSILITGESGAGKTENTKKVISYFAVVAAASKKEDDDSS----KKGTLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTTGKIAGADIEHYLLEKSRVVSQMKGERNYHIFYQLLSTYGSKYHDKLLVQTDPALYSFINQGELTIDGVDDSEEMKLCDEAFEVLGFNDDEKLSLFKCTTSICNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLLTSFLKPKVKVGTEFVTKGQNLNQVTYAVSALAKSLYNRMFGWLVARVNKTLDTKVKRQFFIGVLDIAGFEIFTENGFEQICINYTNERLQQFFNHHMFVLEQEEYKREKIQWTFIDFGMDLQACIDLIEKPMGILSILEEECIVPKASDQTFLSKLYDNHLGKSPNFTKPKPPKPGHVEAHFELHHYAGSVPYTITGWLEKNKDPLNDSVVALLGDSKDPLVSNLFTPVVDEG--GKRKKGGAMQTISAVHRESLNKLMKNLQSTSPSFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNVIPDGFVDGRQVTEKILEATQLDKNLYQCGNTKVFFKAGTLAHLEDLRDDKLNGIISLFQAEIRGYLMRKQYKKLQDQRVALTLMQRNIRKYLVLRNWPWWRLYTKVKPMLNIARQEEEMKKAAEELAKLKEEYEKLEKLKKELEEQNVTVLQQKNDLFLQLQTEQDSLADAEEKISKLVLQRGDMEQRIKELEERLADEEDQAANLTEVKKKMSAEIEELKKDVEDLESSLQKAEQEKQTKDNQIRTLQSEMAQQDEMIGKLNKDKKNLEEQNKRTQEALQAEEDKVNHLNKLKAKLESTLDEMEENLAREQKIRGDVEKSKRKLEGDLKATQETVDDLERVKRDLEEQLRRKEAEIGGLSGKFEDEQGLVAQLQRKIKELQTRIQELEEDLEAERAARSKAEKSRQQLESELEEVVDRLEEQDGATAAQSDLTKKREAELMKLKRDLEDTRLQNEQAIATMRKKQSDAINELADQLDQANKAKAKAEKERSQFKAELDDAHNQVDSIMKAKLNSEKTVKALESQLQEVSVKLDEATRNLNEQASTKARSSQEVSELQRQLEEAESQLSQLNKIKQQLSAQLEEARHSLEDESRMKAKLNGEVRNLTSDLDSLRETLEEEQSAKGDLQRQLQKLQGELQQLRSRGGGGGDVRSEEVEELKRKMNAKIQELESEAESAKSKCGQLEKTKARLQGELEDLMVDVERANGLASQLERKQNNFNRTLAEWQKKYADSQAELENAQRDARGQSTEIFRLKAQLEEVHEQMEGLRRENKNLSDEIHDLTEQLGEGGRSVHEIDKNRRRLEMEKEELQAALEEAESALEQEEAKVQRAQLEMSQIRQEIDRRLAEKEEEFEATRKNHQRAMESQQASLEAEAKGKAEAMRVKKKLEQDINELEVSLDGANRARAEQEKNVKKFQQQVRELQSQLEDDQRQRDDLREQFQAAERRATVLAGELDELRIALDQAERSRKIAEAERAEASDRATEMSTQTASLAAQKRKLEADLAAMQADLEEAANEAKQADERAKKAMADSARVFEEIRQEQEHTQHVEKARKQLEIQVKELMARLEDSESGAMKNGRKAMGKLEQRVRELETELEAEQRRHGETQKNLRKVDRRMKEISLQAEEDKKSHDRMQELVEKLQGKIKTYKRQVEEAEEIAAINLAKYRKIQHEIEDAEERADQAEQALQKLRAKNRSSVSTARGVSAAPA 1925          
BLAST of Myosin heavy chain vs. TrEMBL
Match: gnl|BL_ORD_ID|17189691 (tr|A0A4Z2CPI5|A0A4Z2CPI5_SCHJA Myosin heavy chain, striated muscle OS=Schistosoma japonicum OX=6182 GN=EWB00_008791 PE=3 SV=1)

HSP 1 Score: 2571.58 bits (6664), Expect = 0.000e+0
Identity = 1416/1932 (73.29%), Postives = 1655/1932 (85.66%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPG 5879
            M+PSDPDF+YLGVDRKAL+K+  D FDSK   W+ DEK+ ++ A I+D +GD  TV       K +KKD+ +Q+NPPKF +IEDMANLT LNDASVL+NLR RYY+ LIYTYSGLFCV +NPYKRFPIYT QV  KYKGKRR EMPPHIFSISDNAY NML DR+NQS+LITGESGAGKTENTKKVI+YFA VAAATKKEED+      +KGTLEDQIVQANPVLEAYGNAKT RNNNSSRFGKFIRIHFGT+GKIAGADIE YLLEKSRV SQ KGERNYHIFYQ+LS  G  +H+KLL+  DPALYSFINQGEL+IDGVDD EEMK+ DEAF++LGF+ +EK+SLFKCT SI NMGEMKFKQRPREEQAE+DGTAEAEKVAFLLGVNAKDL+   LKPKVKVG E+VTKGQN +QV Y+V ALAKSLYNRMF WLV RVNKTLDTKVKRQFFIGVLDIAGFEIFN NGFEQICINYTNERLQQFFNHHMFVLEQEEYK+E I W FIDFGMDLQACI+LIEKPMGILSILEEEC+ PKASD TF +KLYDNHLGKSPNF KPKPPKPG +EAHFELHHYAGSVPY +TGWLEKNKDPLN++V+ LL  SK+ LVS+LF P       GK+ KGG+  T++  HRESLNKLMKNLQSTSP FIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIP GFV+G+QVT K+LEA QLD +LY+ GNTKVFFKAGTLA LED+RDEKL+ +ISLFQA+IRGYLM++QYKKLQDQRVAL+++QRNIRKYL+LR WPWW+LYTKVKP+LNIARQEEEMKKAAEEL KLKEEFEK++K KKELEEQNV +L+ KNDLFLQLQTEQDSLADAEEK+SKLV+Q+ DME RIKELE+ L +EED AA L ++KKKM  EIEELKKDV DLESSLQKAEQEK  KD QI++LQ +MA+Q+E + KL K+KK  +E  K+T+E+L AEE+KV +LNK KAKLE T+DEMEENL+REQKIR DVEK KRK+E +LK TQETVDDLERVKR+LEEQL+RKE E+   S K EDE GLVAQLQRKIKELQ RIQELEEDLEAER AR+KAEKSR QLE ELEE+ DRLEEQ G T+AQ DL KKREAELMKLKRDLE++ +Q++Q IA  RKKQ D VNE ++QLDQ  K KAK EKE+++ K +L+D   Q++S+ KAK NS+K +K +E Q  E+  KL+EANR++++ ++T  ++ Q  +ELQ +LEEAESQ++QL KVKQQ+  QLEEAR   E+ESR KAKL+ +VRNL++DLD+LRE LEEE   K D+QRQL K QGE+QQL+++  G G +RSEE++E KRK   +I ELE EAE+AKSK GQLEK KARLQGE+ED++VDV+RAN LASQLE+KQ  F++ ++EWQ+KYA+SQAELE +QR++R  S E+FR+KAQ+EE  EQ+E ++RENKNL+DEIHDLTEQ+GEGGRSVHEIDK R+RLEMEKEELQ ALEEAE ALEQEEAK QR+QLEMSQIRQEIDRRLAEKEEEFEATR NHQRAMES +ASLEAE++G+AEA ++KKKLE DI ELEV++D ANR R+EQEKN KKFQQQV+EL S +ED++ Q+D +REQ    ER+ T++  EL+E+R +L+ +ER+RK  E E+ E +DR  E+S Q++   A KRKLEADLAAMQ+DLEEAA EA+QA+E+AKKA+ADSAR+F+EIRQEQEH Q ++K +KQLE Q KEL A+L++SE+ A+K G+KA+ KLEQRVRELE EL+ EQ+RH E+QKN RKV+RR+KE+ LQ +EDKK+ +R+Q+LVEKLQGKIKTYKRQVEEAEEIAA+NLAKYRKIQ EIED+EERADQAEQALQKLR KNRSSVST RG S+APG
Sbjct:    1 MDPSDPDFKYLGVDRKALLKELAD-FDSKNVIWVEDEKDGYVLANIKDTTGDTITVSLKDGSEKKIKKDDAQQVNPPKFFLIEDMANLTHLNDASVLENLRARYYRQLIYTYSGLFCVAVNPYKRFPIYTEQVALKYKGKRRGEMPPHIFSISDNAYHNMLQDRENQSILITGESGAGKTENTKKVISYFAVVAAATKKEEDEGS----KKGTLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTTGKIAGADIEHYLLEKSRVVSQMKGERNYHIFYQLLSTYGSKYHDKLLVQTDPALYSFINQGELSIDGVDDSEEMKLCDEAFEVLGFNDDEKLSLFKCTTSICNMGEMKFKQRPREEQAESDGTAEAEKVAFLLGVNAKDLLTCFLKPKVKVGTEFVTKGQNLNQVSYAVSALAKSLYNRMFGWLVARVNKTLDTKVKRQFFIGVLDIAGFEIFNENGFEQICINYTNERLQQFFNHHMFVLEQEEYKREKIQWTFIDFGMDLQACIDLIEKPMGILSILEEECIVPKASDQTFLSKLYDNHLGKSPNFTKPKPPKPGHSEAHFELHHYAGSVPYTITGWLEKNKDPLNDSVVALLGGSKDPLVSNLFTPV--VGEPGKKMKGGSFMTVTYMHRESLNKLMKNLQSTSPSFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPDGFVDGRQVTEKLLEATQLDKSLYQCGNTKVFFKAGTLASLEDLRDEKLNGIISLFQAEIRGYLMQKQYKKLQDQRVALTLMQRNIRKYLVLRNWPWWRLYTKVKPMLNIARQEEEMKKAAEELAKLKEEFEKLEKLKKELEEQNVTVLQQKNDLFLQLQTEQDSLADAEEKISKLVLQRGDMEQRIKELEERLADEEDQAANLSEVKKKMSAEIEELKKDVEDLESSLQKAEQEKQTKDNQIRTLQAEMAQQDETIGKLNKDKKNLEEQNKRTQEALQAEEDKVNHLNKLKAKLESTLDEMEENLAREQKIRGDVEKSKRKLEGDLKATQETVDDLERVKRDLEEQLRRKEAEISGLSGKFEDEQGLVAQLQRKIKELQTRIQELEEDLEAERAARSKAEKSRQQLESELEEVVDRLEEQDGVTAAQSDLTKKREAELMKLKRDLEDARLQNEQAIAAMRKKQNDAVNELADQLDQANKAKAKAEKERSQFKAELDDAHNQVDSIMKAKLNSEKTVKALEVQLQEVSVKLDEANRNLSEQSSTKARSSQEVSELQRQLEEAESQLSQLSKVKQQLSAQLEEARHNLEDESRMKAKLNGEVRNLSSDLDSLRETLEEEQSAKGDLQRQLQKLQGELQQLRSRGGGGGDVRSEEVEELKRKMNAKIQELESEAESAKSKCGQLEKTKARLQGELEDLMVDVERANGLASQLERKQNNFNRTLAEWQKKYADSQAELENAQRDARGQSTEIFRLKAQLEEVHEQMEGLRRENKNLSDEIHDLTEQLGEGGRSVHEIDKNRRRLEMEKEELQAALEEAESALEQEEAKVQRAQLEMSQIRQEIDRRLAEKEEEFEATRKNHQRAMESQQASLEAEAKGKAEAMRVKKKLEQDINELEVSLDGANRARAEQEKNVKKFQQQVRELQSQLEDDQRQRDDLREQFQAAERRATVLAGELDELRIALDQAERSRKIAEAERAEASDRATEMSTQTASLAAQKRKLEADLAAMQADLEEAANEAKQADERAKKAMADSARVFEEIRQEQEHTQHVEKARKQLEVQVKELMARLEDSESGAMKNGRKAMGKLEQRVRELETELEAEQRRHGETQKNFRKVDRRMKEITLQAEEDKKSHDRMQELVEKLQGKIKTYKRQVEEAEEIAAINLAKYRKIQHEIEDAEERADQAEQALQKLRAKNRSSVSTTRGVSVAPG 1925          
BLAST of Myosin heavy chain vs. TrEMBL
Match: gnl|BL_ORD_ID|22837268 (tr|A0A3Q0KIP4|A0A3Q0KIP4_SCHMA Myosin heavy chain OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 2570.42 bits (6661), Expect = 0.000e+0
Identity = 1417/1932 (73.34%), Postives = 1652/1932 (85.51%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPG 5879
            M+PSDPDF+YLGVDRKAL+K+  + FDSK   W+ DEKE ++ A I+D +GD  TV       K VKKD+ +Q+NPPKF +IEDMANLT LNDASVL+NLR RYY+ LIYTYSGLFCV +NPYKRFPIYT QV  KYKGKRR EMPPHIFSISDNAY NML DR+NQS+LITGESGAGKTENTKKVI+YFA VAAA+KKE+DD+     +KGTLEDQIVQANPVLEAYGNAKT RNNNSSRFGKFIRIHFGT+GKIAGADIE YLLEKSRV SQ KGERNYHIFYQ+LS  G  +H+KLL+  DPALYSFINQGELTIDGVDD EEMK+ DEAF++LGF+ +EK+SLFKCT SI NMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDL+ S LKPKVKVG E+VTKGQN +QV Y+V ALAKSLYNRMF WLV RVNKTLDTKVKRQFFIGVLDIAGFEIF  NGFEQICINYTNERLQQFFNHHMFVLEQEEYK+E I W FIDFGMDLQACI+LIEKPMGILSILEEEC+ PKASD TF +KLYDNHLGKSPNF KPKPPKPG  EAHFELHHYAGSVPY +TGWLEKNKDPLN++V+ LL  SK+ LVS+LF P       GK+ KGG+  T++  HRESLNKLMKNLQSTSP FIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPN IP GFV+G+QVT KILEA QLD NLY+ GNTKVFFKAGTLA LED+RD+KL+ +ISLFQA+IRGYLMR+QYKKLQDQRVAL+++QRNIRKYL+LR WPWW+LYTKVKP+LNIARQEEEMKKAAEEL KLKEE+EK++K KKELEEQNV +L+ KNDLFLQLQTEQDSLADAEEK+SKLV+Q+ DME RIKELE+ L +EED AA L ++KKKM  EIEELKKDV DLESSLQKAEQEK  KD QI++LQ +MA+Q+E + KL K+KK  +E  K+T+E+L AEE+KV +LNK KAKLE T+DEMEENL+REQKIR DVEK KRK+E +LK TQETVDDLERVKR+LEEQL+RKE E+   S K EDE GLVAQLQRKIKELQ RIQELEEDLEAER AR+KAEKSR QLE ELEE+ DRLEEQ GAT+AQ DL KKREAELMKLKRDLE++ +Q++Q IA  RKKQ D +NE ++QLDQ  K KAK EKE+++ K +L+D   Q++S+ KAK NS+K +K +E+Q  E+  KL+EA R++N+  +T  ++ Q  +ELQ +LEEAESQ++QL K+KQQ+  QLEEAR   E+ESR KAKL+ +VRNL +DLD+LRE LEEE   K D+QRQL K QGE+QQL+++  G G +RSEE++E KRK   +I ELE EAE+AKSK GQLEK KARLQGE+ED++VDV+RAN LASQLE+KQ  F++ ++EWQ+KYA+SQAELE +QR++R  S E+FR+KAQ+EE  EQ+E ++RENKNL+DEIHDLTEQ+GEGGRSVHEIDK R+RLEMEKEELQ ALEEAE ALEQEEAK QR+QLEMSQIRQEIDRRLAEKEEEFEATR NHQRAMES +ASLEAE++G+AEA ++KKKLE DI ELEV++D ANR R+EQEKN KKFQQQV+EL S +ED++ Q+D +REQ    ER+ T++  EL+E+R +L+ +ER+RK  E E+ E +DR  E+S Q++   A KRKLEADLAAMQ+DLEEAA EA+QA+E+AKKA+ADSAR+F+EIRQEQEH Q ++K +KQLE Q KEL A+L++SE+ A+K G+KA+ KLEQRVRELE EL+ EQ+RH E+QKN RKV+RR+KE+ LQ +EDKK+ +R+Q+LVEKLQGKIKTYKRQVEEAEEIAA+NLAKYRKIQ EIED+EERADQAEQALQKLR KNRSSVSTARG S AP 
Sbjct:    1 MDPSDPDFKYLGVDRKALLKELAN-FDSKNVIWVEDEKEGYVLADIKDTTGDTITVALKDGSEKKVKKDDAQQVNPPKFFLIEDMANLTHLNDASVLENLRARYYRQLIYTYSGLFCVAVNPYKRFPIYTEQVALKYKGKRRGEMPPHIFSISDNAYHNMLQDRENQSILITGESGAGKTENTKKVISYFAVVAAASKKEDDDSS----KKGTLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTTGKIAGADIEHYLLEKSRVVSQMKGERNYHIFYQLLSTYGSKYHDKLLVQTDPALYSFINQGELTIDGVDDSEEMKLCDEAFEVLGFNDDEKLSLFKCTTSICNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLLTSFLKPKVKVGTEFVTKGQNLNQVTYAVSALAKSLYNRMFGWLVARVNKTLDTKVKRQFFIGVLDIAGFEIFTENGFEQICINYTNERLQQFFNHHMFVLEQEEYKREKIQWTFIDFGMDLQACIDLIEKPMGILSILEEECIVPKASDQTFLSKLYDNHLGKSPNFTKPKPPKPGHVEAHFELHHYAGSVPYTITGWLEKNKDPLNDSVVALLGDSKDPLVSNLFTPV--VGEPGKKTKGGSFLTVTYMHRESLNKLMKNLQSTSPSFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNVIPDGFVDGRQVTEKILEATQLDKNLYQCGNTKVFFKAGTLAHLEDLRDDKLNGIISLFQAEIRGYLMRKQYKKLQDQRVALTLMQRNIRKYLVLRNWPWWRLYTKVKPMLNIARQEEEMKKAAEELAKLKEEYEKLEKLKKELEEQNVTVLQQKNDLFLQLQTEQDSLADAEEKISKLVLQRGDMEQRIKELEERLADEEDQAANLTEVKKKMSAEIEELKKDVEDLESSLQKAEQEKQTKDNQIRTLQSEMAQQDEMIGKLNKDKKNLEEQNKRTQEALQAEEDKVNHLNKLKAKLESTLDEMEENLAREQKIRGDVEKSKRKLEGDLKATQETVDDLERVKRDLEEQLRRKEAEIGGLSGKFEDEQGLVAQLQRKIKELQTRIQELEEDLEAERAARSKAEKSRQQLESELEEVVDRLEEQDGATAAQSDLTKKREAELMKLKRDLEDTRLQNEQAIATMRKKQSDAINELADQLDQANKAKAKAEKERSQFKAELDDAHNQVDSIMKAKLNSEKTVKALESQLQEVSVKLDEATRNLNEQASTKARSSQEVSELQRQLEEAESQLSQLNKIKQQLSAQLEEARHSLEDESRMKAKLNGEVRNLTSDLDSLRETLEEEQSAKGDLQRQLQKLQGELQQLRSRGGGGGDVRSEEVEELKRKMNAKIQELESEAESAKSKCGQLEKTKARLQGELEDLMVDVERANGLASQLERKQNNFNRTLAEWQKKYADSQAELENAQRDARGQSTEIFRLKAQLEEVHEQMEGLRRENKNLSDEIHDLTEQLGEGGRSVHEIDKNRRRLEMEKEELQAALEEAESALEQEEAKVQRAQLEMSQIRQEIDRRLAEKEEEFEATRKNHQRAMESQQASLEAEAKGKAEAMRVKKKLEQDINELEVSLDGANRARAEQEKNVKKFQQQVRELQSQLEDDQRQRDDLREQFQAAERRATVLAGELDELRIALDQAERSRKIAEAERAEASDRATEMSTQTASLAAQKRKLEADLAAMQADLEEAANEAKQADERAKKAMADSARVFEEIRQEQEHTQHVEKARKQLEIQVKELMARLEDSESGAMKNGRKAMGKLEQRVRELETELEAEQRRHGETQKNLRKVDRRMKEISLQAEEDKKSHDRMQELVEKLQGKIKTYKRQVEEAEEIAAINLAKYRKIQHEIEDAEERADQAEQALQKLRAKNRSSVSTARGVSAAPA 1925          
BLAST of Myosin heavy chain vs. TrEMBL
Match: gnl|BL_ORD_ID|22824559 (tr|Q02456|Q02456_SCHMA Myosin heavy chain OS=Schistosoma mansoni OX=6183 GN=MYH PE=2 SV=1)

HSP 1 Score: 2561.56 bits (6638), Expect = 0.000e+0
Identity = 1414/1931 (73.23%), Postives = 1649/1931 (85.40%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAP 5876
            M+PSDPDF+YLGVDRKAL+K+  + FDSK   W+ DEKE ++ A I+D +GD  TV       K VKKD+ +Q+NPPKF +IEDMANLT LNDASVL+NLR RYY+ LIYTYSGLFCV +NPYKRFPIYT QV  KYKGKRR EMPPHIFSISDNAY NML DR+NQS+LITGESGAGKTENTKKVI+YFA VAAA+KKE+DD+     +KGTLEDQIVQANPVLEAYGNAKT RNNNSSRFGKFIRIHFGT+GKIAGADIE YLLEKSRV SQ KGERNYHIFYQ+LS  G  +H+KLL+  DPALYSFINQGELTIDGVDD EEMK+ DEAF++LGF+ +EK+SLFKCT SI NMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDL+ S LKPKVKVG E+VTKGQN +QV Y+V ALAKSLYNRMF WLV RVNKTLDTKVKRQFFIGVLDIAGFEIF  NGFEQICINYTNERLQQFFNHHMFVLEQEEYK+E I W FIDFGMDLQACI+LIEKPMGILSILEEEC+ PKASD TF +KLYDNHLGKSPNF KPKPPKPG  EAHFELHHYAGSVPY +TGWLEKNKDPLN++V+ LL  SK+ LVS+LF P       GK+ KGG+  T++  HRESLNKLMKNLQSTSP FIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPN IP GFV+G+QVT KILEA QLD NLY+ GNTKVFFKAGTLA LED+RD+KL+ +ISLFQA+IRGYLMR+QYKKLQDQRVAL+++QRNIRKYL+LR WPWW+LYTKVKP+LNIARQEEEMKKAAEEL KLKEE+EK++K KKELEEQNV +L+ KNDLFLQLQTEQDSLADAEEK+SKLV+Q+ DME RIKELE+ L +EED AA L ++KKKM  EIEELKKDV DLESSLQKAEQEK  KD QI++LQ +MA+Q+E + KL K+KK  +E  K+T+E+L AEE+KV +LNK KAKLE T+DEMEENL+REQKIR DVEK KRK+E +LK TQETVDDLERVKR+LEEQL+RKE E+   S K EDE GLVAQLQRKIKELQ RIQELEEDLEAER AR+KAEKSR QLE ELEE+ DRLEEQ GAT+AQ DL KKREAELMKLKRDLE++ +Q++Q IA  RKKQ D +NE ++QLDQ  K KAK EKE+++ K +L+D   Q++S+ KAK NS+K +K +E+Q  E+  KL+EA R++N+  +T  ++ Q  +ELQ +LEEAESQ++QL K+KQQ+  QLEEAR   E+ESR KAKL+ +VRNL +DLD+LRE LEEE   K D+QRQL K QGE+QQL+++  G G +RSEE++E KRK   +I  LE EAE+AKSK GQLEK KARLQGE+ED++VDV+RAN LASQLE+KQ  F++ ++EWQ+KYA+SQAELE +QR++R  S E+FR+KAQ+EE  EQ+E ++RENKNL+DEIHDLTEQ+GEGGRSVHEIDK R+RLEMEKEELQ ALEEAE ALEQEEAK QR+QLEMSQIRQEIDRRLAEKEEEFEATR NHQRAMES +ASLEAE +G+AEA ++KKKLE DI ELEV++D ANR R+EQE+N KKFQQQV+EL S +ED++ Q+D +REQ    ER+ T++  EL+E+R +L+ +ER+RK  E E+ E +DR  E+S Q++   A KRKLEADLAAMQ+DLEEAA EA+QA+E+AKKA+ADSAR+F+EIRQEQEH Q ++K +KQLE Q KEL A+L++SE+ A+K G+KA+ KLEQRVRELE EL  EQ+RH E+QKN RKV+RR+KE+ LQ +EDKK+ +R+Q+LVEKLQGKIKTYKRQV+EAEEIAA+NLAKYRKIQ EIED+EERADQAEQALQKLR KNRSSVSTARG S AP
Sbjct:    1 MDPSDPDFKYLGVDRKALLKELAN-FDSKNVIWVEDEKEGYVLADIKDTTGDTITVALKDGSEKKVKKDDAQQVNPPKFFLIEDMANLTHLNDASVLENLRARYYRQLIYTYSGLFCVAVNPYKRFPIYTEQVALKYKGKRRGEMPPHIFSISDNAYHNMLQDRENQSILITGESGAGKTENTKKVISYFAVVAAASKKEDDDSS----KKGTLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTTGKIAGADIEHYLLEKSRVVSQMKGERNYHIFYQLLSTYGSKYHDKLLVQTDPALYSFINQGELTIDGVDDSEEMKLCDEAFEVLGFNDDEKLSLFKCTTSICNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLLTSFLKPKVKVGTEFVTKGQNLNQVTYAVSALAKSLYNRMFGWLVARVNKTLDTKVKRQFFIGVLDIAGFEIFTENGFEQICINYTNERLQQFFNHHMFVLEQEEYKREKIQWTFIDFGMDLQACIDLIEKPMGILSILEEECIVPKASDQTFLSKLYDNHLGKSPNFTKPKPPKPGHVEAHFELHHYAGSVPYTITGWLEKNKDPLNDSVVALLGDSKDPLVSNLFTPV--VGEPGKKTKGGSFLTVTYMHRESLNKLMKNLQSTSPSFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNVIPDGFVDGRQVTEKILEATQLDKNLYQCGNTKVFFKAGTLAHLEDLRDDKLNGIISLFQAEIRGYLMRKQYKKLQDQRVALTLMQRNIRKYLVLRNWPWWRLYTKVKPMLNIARQEEEMKKAAEELAKLKEEYEKLEKLKKELEEQNVTVLQQKNDLFLQLQTEQDSLADAEEKISKLVLQRGDMEQRIKELEERLADEEDQAANLTEVKKKMSAEIEELKKDVEDLESSLQKAEQEKQTKDNQIRTLQSEMAQQDEMIGKLNKDKKNLEEQNKRTQEALQAEEDKVNHLNKLKAKLESTLDEMEENLAREQKIRGDVEKSKRKLEGDLKATQETVDDLERVKRDLEEQLRRKEAEIGGLSGKFEDEQGLVAQLQRKIKELQTRIQELEEDLEAERAARSKAEKSRQQLESELEEVVDRLEEQDGATAAQSDLTKKREAELMKLKRDLEDTRLQNEQAIATMRKKQSDAINELADQLDQANKAKAKAEKERSQFKAELDDAHNQVDSIMKAKLNSEKTVKALESQLQEVSVKLDEATRNLNEQASTKARSSQEVSELQRQLEEAESQLSQLNKIKQQLSAQLEEARHSLEDESRMKAKLNGEVRNLTSDLDSLRETLEEEQSAKGDLQRQLQKLQGELQQLRSRGGGGGDVRSEEVEELKRKMNAKIPALESEAESAKSKCGQLEKTKARLQGELEDLMVDVERANGLASQLERKQNNFNRTLAEWQKKYADSQAELENAQRDARGQSTEIFRLKAQLEEVHEQMEGLRRENKNLSDEIHDLTEQLGEGGRSVHEIDKNRRRLEMEKEELQAALEEAESALEQEEAKVQRAQLEMSQIRQEIDRRLAEKEEEFEATRKNHQRAMESQQASLEAEGKGKAEAMRVKKKLEQDINELEVSLDGANRARAEQEENVKKFQQQVRELQSQLEDDQRQRDDLREQFQAAERRATVLAGELDELRIALDQAERSRKIAEAERAEASDRATEMSTQTASLAAQKRKLEADLAAMQADLEEAANEAKQADERAKKAMADSARVFEEIRQEQEHTQHVEKARKQLEIQVKELMARLEDSESGAMKNGRKAMGKLEQRVRELETELAAEQRRHGETQKNLRKVDRRMKEISLQAEEDKKSHDRMQELVEKLQGKIKTYKRQVQEAEEIAAINLAKYRKIQHEIEDAEERADQAEQALQKLRAKNRSSVSTARGVSPAP 1924          
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Match: ENSAMXT00000010358.2 (pep primary_assembly:Astyanax_mexicanus-2.0:23:34206862:34242580:1 gene:ENSAMXG00000010027.2 transcript:ENSAMXT00000010358.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1788.85 bits (4632), Expect = 0.000e+0
Identity = 1035/1919 (53.93%), Postives = 1413/1919 (73.63%), Query Frame = 3
Query:   96 DPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISP-DPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVS 5849
            DP   +L    K  ++     +D KK+CW+  EKE FIA  I+   GD  TVKT K+ T T+KKD+I+QMNPPKF    DMANLTFLN+ASVL+NLR RY    IYTYSGLF                             PPH+FSISDNAY +M+ + +NQS+LITGESGAGKTENTKKVI YFA+V A   K   D+      KG+LEDQI+QANPVLEA+GNAKT RNNNSSRFGKFIRIHFG + K+AGADIE YLLEKSRV SQQ  ER+YHIFYQ+LS G KP   + L+   DP  Y +I QG   +D +DD+EE+ +TD AFD+LGF+AEEKMS++K T  I++ G MKFKQ+ REEQA+ D T  A+KVA L+G+N+ DL + I +P+VKVGNE+VTKGQN+DQ +YS+GALAK++Y+RMF W+V R+NKTLDTK++RQFFIGVLDIAGFEIF FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE IDW FIDFG+DLQACIEL+EKPMGI SILEE+C+FPKA+D+TFK  LYDNHLGKS NF KPK  K G  E HFEL HYAG+V YN+ GWLEKNKDPLNETV+ L   S  +L++ LF   E      K+KKG + QT+S+ +RE LNKLM  L+ST+PHF+RCIVPNEFKQ GV DA+L+LHQL CNGVLEGIRICRKGFPNR+ Y EFKQRY IL PN IP+GFV+ K+ +  IL ++ LD   YR+G+TKVFF+AG LA LEDMRDE+L+ ++++ Q ++RG LMR ++KK+ ++R+AL  +QRN+RK+L LR W WWKLYTKVKPLL++ARQE+E+K   EEL    E+  ++ +  KEL+E+ V L + K+DL L L  EQDS+ADAEE+ S+L+ QK +ME +I+++++ L EEE +A  L   K+K++GE+ +LK+D+  LES+L K+E+EK   D +++SL  ++ ++++ + + +KE+KA +E+Q+KT + L AEE+KV +L K  +KL   + E+E+N  +E+KIR +VEK +RK E +LK T + ++++ER K +LEE +K+++ME+ + ++K+EDE  L + L RK+KE QARI+ELEE+LEAER  RAK EK R  L  +LE+L DRLEE GGAT AQ++ NKKREAELMKL+R+LEE+ +Q +   +  RKK  D + E  EQ++ LQ+V+ K+EK+K  MK +++DL   +E++ K+K N++  ++++E   +E   +L E  R   + N         N++L   L EA+S++NQ+ ++K  + TQ +E ++  +EES+A++     + N   DLD ++E L+EE E KS++QR + K   E+   + K+E     ++EEL+E KRK   R+ E EE  E A+++A  LEKVK RLQGE+ED+ +D++++N  A+ L+KKQ++FDK+ +EW QK  E Q ELE SQ+E RT   EV+++K   EES + LE+VK++NK L+DEI DL EQ+GEGG+SVHE+ KA+++LE+E++ELQ ALEEAE +LE EE K  R QLE++Q++ +IDRR+ EKEEEFE TR NHQRA+ES++ASLEAE++GRAEA +MKKK+E D+ E+E+ ++ AN+  SE  K+ K+ QQQ++++   ++++    +++RE  ++ ER++ ++  E+EE+R  LE SER+RK  E E +++T+R NEL  Q+   +  KRK+EADL  + ++ EE  +E R A+E+AKKA+ D+ R+ +E+RQEQ+H   ++KIKK  E   K+LQ K++E+E  ALK GK+ + KLE RVRELE+ELD EQKRHVE+ K  RK ERRLKEL  QT+ED K  +R+Q+LVEKLQ K+K+YKRQ+EEAEE A  +L+KYRK   E++D+EERA  AE AL KLRT+NR+SV+
Sbjct:   14 DP-MPFLAPPEKERLEAMNRPYDIKKSCWVKHEKEGFIAGEIQSDDGDKVTVKTVKNATVTIKKDDIQQMNPPKFYQASDMANLTFLNEASVLENLRSRYVYMRIYTYSGLF----------------------------FPPHLFSISDNAYHDMMMEHENQSMLITGESGAGKTENTKKVIQYFANVGATGGKPSSDS------KGSLEDQIIQANPVLEAFGNAKTTRNNNSSRFGKFIRIHFGPTAKLAGADIESYLLEKSRVISQQAAERSYHIFYQLLS-GKKPELLEALLLVADPKQYVWICQGVTVVDNMDDKEELMLTDMAFDVLGFTAEEKMSIYKLTGGIMHFGNMKFKQKAREEQADVDTTEVADKVAHLMGINSGDLQKGITRPRVKVGNEFVTKGQNQDQCIYSIGALAKAIYDRMFKWMVNRINKTLDTKMQRQFFIGVLDIAGFEIFEFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIDWVFIDFGLDLQACIELLEKPMGIFSILEEQCVFPKATDVTFKTALYDNHLGKSANFQKPKGGKKG-PEVHFELIHYAGTVGYNIAGWLEKNKDPLNETVVGLYQKSSMSLLAHLFKEEEAAAGVKKQKKGSSFQTVSAFYREQLNKLMSTLRSTAPHFVRCIVPNEFKQSGVCDANLILHQLACNGVLEGIRICRKGFPNRLQYPEFKQRYYILNPNVIPKGFVDNKKASELILGSIGLDDMEYRIGHTKVFFRAGVLAKLEDMRDERLAKIMTMLQGRLRGTLMRVEFKKMLERRIALIALQRNVRKFLQLRYWGWWKLYTKVKPLLHVARQEDELKAKEEELRVALEKTAEMTEKIKELDEKLVTLSKEKSDLALALAAEQDSIADAEERCSQLMKQKMNMEEQIQDMKERLEEEEGSAMALSAQKRKLEGELMDLKRDLEGLESTLAKSEKEKQGLDSKVRSLTAELGQRDDTITRSQKERKALEELQQKTLDDLQAEEDKVNHLTKTNSKLTSQVHELEDNWEQEKKIRGEVEKARRKAEADLKMTIDNLNEMERAKIDLEEVVKKRDMEINHLNAKLEDEQSLSSTLHRKLKEHQARIEELEEELEAERAVRAKVEKQRADLSRDLEDLGDRLEEAGGATFAQIEQNKKREAELMKLRRELEEAALQSEATASALRKKHSDAMAELGEQVENLQRVRIKLEKDKQVMKAEIDDLNATVEAVQKSKLNAEAHVRKLEDSLAEANSRLAEMERSQTELNTIKIHLTAENSDLSRELGEAQSKLNQITRIKTSLTTQNDELKRQVDEESKARSAAVIGLANAQHDLDLMKEQLDEEQEGKSEMQRLISKLNAEVTTWRTKYETDAIHKTEELEETKRKLTVRLQEAEEATEAAQARAASLEKVKQRLQGEVEDLTIDLEKSNAAAAALDKKQRSFDKMTAEWSQKCEEMQLELENSQKECRTYMTEVYKLKTSYEESLDHLETVKKDNKTLSDEIRDLMEQLGEGGKSVHELQKAKRKLEVERDELQIALEEAETSLEVEEGKVVRVQLELAQVKADIDRRIHEKEEEFEITRKNHQRAIESLQASLEAEAKGRAEALRMKKKMECDLNEMEIQLEHANKNNSELVKSLKRLQQQIKDMQMQMDEDARVHEELREHYSLQERRVCLLQTEIEELRSGLEASERSRKLMEQELVDVTERHNELYSQNQSLIIIKRKMEADLTRVSNENEELISEFRSADERAKKAITDATRMAEELRQEQDHCIHLEKIKKNNELMIKDLQLKVEEAEELALKSGKRTIQKLEVRVRELESELDVEQKRHVETVKVLRKNERRLKELIFQTEEDHKTNQRMQELVEKLQNKLKSYKRQIEEAEEQANTSLSKYRKTVHELDDAEERAGNAEMALNKLRTRNRASVT 1895          
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Match: MYH6 (myosin heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:7576])

HSP 1 Score: 1775.76 bits (4598), Expect = 0.000e+0
Identity = 1032/1938 (53.25%), Postives = 1409/1938 (72.70%), Query Frame = 3
Query:   78 ENMNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG---------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARG 5861
            E   P+ P   YL    K  ++     FD KK C++PD +E ++ ATI    GD  T +T K  T TVK+ ++   NPPKF  IEDMA  TFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V+  Y+GK+RTE PPHIFSISDNAY  MLADR+NQS+LITGESGAGKT NTK+VI YFA +AA   K+  DT     +KGTLEDQI+Q NP LEA+GNAKT+RN+NSSRFGKFIRIHF  SGK+A ADIE YLLEKSRV  Q K ER+YHIFYQILS       E LLI+ +P  Y++I+QGE  +  +DD +E+  TDEAFD+LGF+ EEK S++K T +I++ G MKFKQ+ REEQAEADGT + +K A+L+G+N+ DL++++  P+VKVGNE+VTKGQN  QV Y++GAL+KS+Y +MF W+V+R+N++LDTK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+  WL KNKDPLNETV+ L   S   L+S+LFA     ++           K+KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K PG ++  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P AIP+G F++ ++   K+L ++ +D N Y+ G+TKVFFKAG L  LE+MRD++L+ +I+  Q++ RG L R +++K+ ++R AL +IQ N+R ++ ++ WPW KLY K+KPLL  A  E+EM    EE  KLKE + K +  +KELEE+ V LL+ KNDL LQ+Q EQD+L DAEE+   L+  K  +E + KEL + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++T + L +EE+KV  L KAKAKLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE V DLE  K++LEE++K+K+ E+   +SKIEDE  L AQLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  K++RDLEE+ +QH+   A  RKK  D V +  EQ+D LQ+VK K+EKEK+E++ +L+D+   +E + K+K N +K  + +E Q SE + K EE  R IND +    K Q  N EL  +LEE +S ++QL + KQ    Q+E+ ++  EEE +AK  L+  V++   D + LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL++AK+K   R+ + EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDK+++EW+QKY ESQ ELE++Q+E+R++S E+F++K   EES + LE++KRENKNL +EI DLTEQIGE G+S+HE++K RK+LE EK E+Q ALEEAE +LE EE K  R+QLE +Q++ +I+R+LAEK+EE E  + N QR ++++++SLE+E+R R EA ++KKK+E D+ E+E+ +  ANR  SE +K  K     +++    ++D     D ++E   + ER+  ++ AEL+E+R  +E +ER RK  E E +++++R+  L  Q++  +  K+KLE D + +Q+++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE RVRELE E++ EQ++  +S K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K+YKR  EEAEE A  NL K+RK+Q E++++EERAD AE  + KLR K+R + S   G
Sbjct:    7 EEFGPAAP---YLRKSDKERLEAQTRPFDMKKECFVPDAEEEYLKATITSRDGDKCTCETSKGTTVTVKECDVHPQNPPKFDKIEDMAMFTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVVAYRGKKRTEAPPHIFSISDNAYQYMLADRENQSILITGESGAGKTVNTKRVIQYFASIAAGGPKK--DTSD---KKGTLEDQIIQCNPALEAFGNAKTIRNDNSSRFGKFIRIHFAASGKLASADIETYLLEKSRVTFQLKAERDYHIFYQILSQRKPELLEMLLITANPYDYAYISQGETQVASIDDRDELMATDEAFDVLGFTQEEKNSIYKLTGAIMHYGNMKFKQKQREEQAEADGTEDTDKSAYLMGLNSADLVKALCHPRVKVGNEWVTKGQNVQQVYYAIGALSKSVYEKMFLWMVVRINQSLDTKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDSTFKAKLYDNHLGKSNNF-QKPRIVKGKPEAHFSLVHYAGTVDYNIMNWLVKNKDPLNETVVGLYQKSTMKLLSNLFANYASADSAAEGGGGKGKEKKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPAAIPEGTFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGTLEEMRDDRLALIITGIQSRSRGLLSRLEFQKIVERRDALLVIQWNVRAFMGVKNWPWMKLYFKIKPLLRSAEAEKEMANMKEEFLKLKEAYAKSEARRKELEEKMVTLLQEKNDLQLQVQAEQDNLCDAEERCEGLIKNKIQLEAKTKELTERLEDEEEMNAELVAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDEIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLTQENVMDLENDKQQLEERIKKKDFEISQLNSKIEDEQALAAQLQKKLKELQARIEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKVRRDLEEATLQHEATAATLRKKHADSVADLGEQIDNLQRVKQKLEKEKSELRLELDDVVSNMEQIVKSKTNLEKMCRTLEDQMSEYRTKYEEGQRSINDFSMQKAKLQTENGELSRQLEEKDSLVSQLTRGKQSYTQQIEDLKRQLEEEVKAKNALAHAVQSARHDSELLREQYEEEQEAKAELQRSLSKANSEVAQWRTKYETDAIQRTEELEDAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQTELESAQKEARSLSTELFKLKNSYEESLDHLETMKRENKNLQEEISDLTEQIGESGKSIHELEKIRKQLEQEKSEIQSALEEAEASLEHEEGKILRAQLEFNQVKADIERKLAEKDEEMEQAKRNQQRVVDTLQSSLESETRSRNEALRIKKKMEGDLNEMEIQLSQANRQASEAQKQLKGLHGHMKDAQLQLDDALRGNDDLKENIAIVERRNNLLQAELDELRSLVEQTERGRKLAEQELLDVSERVQLLHSQNTSLLNQKKKLEGDTSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELETEVEIEQRKASDSVKGVRKYERRIKELTYQTEEDRKNLARLQDLVDKLQLKVKSYKRSAEEAEEQANSNLGKFRKLQHELDEAEERADIAESQVNKLRAKSRDTGSKVSG 1935          
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Match: ENSAMXT00000001735.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:30825677:30852786:-1 gene:ENSAMXG00000001635.2 transcript:ENSAMXT00000001735.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1769.59 bits (4582), Expect = 0.000e+0
Identity = 1026/1900 (54.00%), Postives = 1397/1900 (73.53%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF---APAEDPNNTG---KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            FD KK C++PD ++ F+ A++    GD  TV+T+  +T T K  +I Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V+  Y+GK+R+E PPHIFSISDNAY  MLA + +  +   GESGAGKT NTK+VI YFA +AA+  K+E      +  +GTLEDQI+QANP LEA+GNAKT+RN+NSSRFGKFIRIHF T GK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      E LL++ +P  YSFI+QGE T+  +DD EE+  TD AFD+LGF+ +EK S++K T +I++ G MKFKQ+ REEQAEADGT +A+K A+L+G+N+ DL++ +  P+VKVGNE+VTKGQN  QV Y+VGAL+K++Y +MF W+V+R+N++L+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+D TFKAKLYDNHLGKS NF +      G+AEAHF L HYAG+V YN+  WL KNKDPLNETV+ L   S   L+S+LF   A A+     G   K+KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K PG +D  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P+AIP+G F++ ++   K+L ++ +D   YR G+TKVFFKAG L  LE+MRDE+LS +I+  QA+ RG L R +Y+K+ ++R AL +IQ N+R ++ ++ WPW KL+ K+KPLL  A  E+EM    EE  KLKE + K +  +KELEE+ V LL+ KNDL LQ+Q EQD+L DAEE+   L+  K  ME + KEL + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E + KL KEKKA  E  ++  + L +EE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE++ DLE  K++LEE+LK+K+ E+   +SKIEDE  ++AQLQ+K+KELQAR++ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEE+ + H+   A  RKKQ D V E  EQ+D LQ+VK K+EKEK+E+K +L+D+   +E + K+K N +K  + +E Q +E + K EE  R +ND +    K Q  N EL  +LEE ES I QL + KQ    QLE+ ++  EEE +AK  L+  V+++  D D LRE  EEE E K+++QR L KA  E+ Q + K+E     R+EEL+EAK+K   R+ + EE  E   +K   LEK K RLQ EIED++VD++R+N  A+ L+KKQ+ FDKV+SEW+QKY ESQ ELE+SQ+E+R++S E+F++K   EES + LE++KRENK L +EI DLTEQ+GE G++VHE++K RK+LE EK E+Q ALEEAE +LE EE K  R+QLE +QI+ +I+R+L EK+EE E ++ N  R ++++++SLE+E+R R EA ++KKK+E D+ E+E+ +  ANR  +E +K  K     +++    ++D +   D ++E T + ER+  ++ AELEE+R  LE +ER RK  E E +++++R+  L  Q++  +  K+KLEAD   +Q+++E+A  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE RVRELE+E++ EQKR  ES K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K YKR  E+AEE A+V+L K+RK+Q E++++ ERAD AE  + K+R K+R
Sbjct:   31 FDMKKECFVPDPEKEFVKASVTSREGDKVTVQTETGKTLTFKDSQILQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVIAYRGKKRSEAPPHIFSISDNAYQYMLAGKSDNEITALGESGAGKTVNTKRVIQYFASIAASGSKKEA-INQNKVMQGTLEDQIIQANPALEAFGNAKTIRNDNSSRFGKFIRIHFDTRGKLASADIETYLLEKSRVTFQLKAERDYHIFYQILSNKKPEILEMLLVTQNPYDYSFISQGETTVPSIDDAEELMATDSAFDVLGFTQDEKNSVYKLTGAIMHYGNMKFKQKQREEQAEADGTEDADKSAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVQQVYYAVGALSKAVYEKMFLWMVVRINQSLETKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDATFKAKLYDNHLGKSSNF-QKPRIVKGKAEAHFALVHYAGTVDYNINNWLVKNKDPLNETVVGLYQKSSLKLLSNLFANYASADSAMGDGKKEKKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPSAIPEGQFIDSRKGAEKLLGSLDIDIQQYRFGHTKVFFKAGLLGQLEEMRDERLSKIITGIQARSRGLLSRIEYQKMVERRDALLVIQWNVRAFMSVKNWPWMKLFFKIKPLLRSAEAEKEMANMKEEFLKLKEAYAKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLCDAEERCEGLIKNKIQMEAKTKELTERLEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDEIIAKLTKEKKALQEAHQQALDDLQSEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLEERLKKKDFEISQLNSKIEDEQAMIAQLQKKLKELQARVEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLHHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSELKLELDDVVSSMEHIVKSKTNLEKMSRTLEDQMNEYRNKCEENQRSLNDFSTQKAKLQAENDELSRQLEEKESLIFQLTRGKQSYSQQLEDLKRQLEEEVKAKNALAHAVQSVRHDSDLLREQYEEEQEAKAELQRSLSKANAEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDMERSNAAAAALDKKQRNFDKVLSEWKQKYEESQCELESSQKEARSLSTELFKLKNSYEESLDHLETLKRENKILQEEITDLTEQLGESGKTVHELEKVRKQLEQEKAEIQAALEEAEGSLEHEEGKILRAQLEFNQIKADIERKLTEKDEEMEQSKRNLLRTIDTLQSSLESETRSRNEALRVKKKMEGDLNEMEIQLSQANRQAAEAQKQLKSLHANLKDCQLQLDDSQRANDDLKENTAIVERRNVLLQAELEELRNVLEQTERGRKLAEQELLDVSERVQLLHSQNTSLLNQKKKLEADTCQLQTEVEDAIQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELESEIEAEQKRSSESVKGIRKYERRIKELTYQTEEDRKNIARLQDLVDKLQLKVKAYKRAAEDAEEQASVHLGKFRKLQHELDEASERADIAESQVNKMRAKSR 1928          
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Match: ENSAMXT00000042907.1 (myosin heavy chain, fast skeletal muscle-like [Source:NCBI gene;Acc:103033118])

HSP 1 Score: 1768.44 bits (4579), Expect = 0.000e+0
Identity = 1030/1915 (53.79%), Postives = 1410/1915 (73.63%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKT-DKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAP-AEDP-NNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSS 5843
            YL    K  ++     FD+K  C++ D KE ++  TI+   G    V+  D  E +TVK+D++  MNPPKF  IEDMA +T LN+ASVL NL++RY   +IYTYSGLFC T+NPYK  P+Y  +V++ Y+GK+R E PPHIFS+SDNAY  ML DR+NQSVLITGESGAGKT NTK+VI YFA VA    K+++ +    K +G+LEDQI+ ANP+LEAYGNAKTVRN+NSSRFGKFIRIHFGT+GK+A ADIE YLLEKSRV+ Q   ER YHIFYQ+++N      E  LI+ +P  +   +QG++T+  +DD+EE+  TD A DILGFS +EKMS++K T ++L+ G MKFKQ+ REEQAE DGT +A+KVA+LLG+N+ D+++++  P+VKVGNE+VTKGQ   QV  +V ALAKS+Y RMF W+V+R+N+ LDTK +R FFIGVLDIAGFEIF+FN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I WEFIDFGMDL +CIELIEKPMGI SILEEECMFPKA+D +FK KLYD HLGK   F +   P  G+AEAHF L HYAG+V YN++GWL+KNKDPLNE+V+ L   S   L+++L+ P  E+P    G +KKGG+MQT+SS  RE+L KLM NL+ST PHF+RC++PNE K PG+++  LV+HQL CNGVLEGIRICRKGFP+R++Y +FKQRY +L  + IP+G F++ K+ + K+L ++ +D + YR G+TKVFFKAG L  LE+MRDEKL+SL+++ QA  RGYLMRR+Y K+ ++R ++  IQ NIR ++ ++ WPW K+Y K+KPLL  A  E+E+    E+  K KE+  K +  KKELEE+ V LL+ KNDL LQ+ +E ++L+DAEE+   L+  K  +E ++KE  + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA Q+E ++KL KEKKA  E  ++T + L AEE+KV  L K+K KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK  QE++ DLE  K++ EE++K+K+ E+    SKIEDE  L AQLQ+KIKELQARI+ELEE++EAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEES +QH+   A  RKKQ D V E  EQ+D LQ+VK K+EKEK+E K +++DL   +E++ KAKAN +K  + +E Q SE++ K +E  R IND      + Q  N E   +LEE ES ++QL + KQ    Q+EE ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR + KA  E+ Q ++K+E     R+EEL+EAK+K   R+ E EE+ E   SK   LEK K RLQGE+ED+++DV+RAN LA+ L+KKQ+ FDKV++EW+QK+ E QAELE +Q+E+R +S E+F+MK   EE+ +QLE++KRENKNL  EI DLTEQIGE G+S+HE++KA+K +E EK E+Q ALEEAE  LE EE+K  R QLE++Q++ E+DR+LAEK+EE E  + N QR +ESM+++L++E R R +A ++KKK+E D+ E+E+ +  ANR  SE +K  +  Q Q+++    ++D    ++ ++EQ  M ER+ T++LAE+EE+R +LE +ER RK  E E ++ ++R+  L  Q++  + TK+KLEADL  +Q ++++   EAR A ++AKKA+ D+A + +E+++EQ+ +  ++++KK LE   K+LQ +LDE+EN A+KGGKK L KLE RVRELEAE++ EQ+R V++ K  RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE A  +L+K RK Q ++E++EERAD AE  + KLR K+R S
Sbjct:   16 YLRKPEKERIEAQSKPFDAKSACYVADAKELYLKGTIKSRDGGKVVVEVLDTKEERTVKEDDVSPMNPPKFDKIEDMAMMTHLNEASVLYNLKERYAAWMIYTYSGLFCATVNPYKWLPVYDAEVVAAYRGKKRMEAPPHIFSVSDNAYQFMLTDRENQSVLITGESGAGKTVNTKRVIQYFATVAVQGDKKKESSS---KMQGSLEDQIIAANPLLEAYGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVSFQLSDERGYHIFYQMMTNHKPELIEMTLITTNPYDFPMCSQGQITVASIDDKEELIATDTAIDILGFSNDEKMSIYKFTGAVLHHGNMKFKQKQREEQAEPDGTEDADKVAYLLGLNSADMLKALCYPRVKVGNEFVTKGQTVPQVYNAVNALAKSIYERMFLWMVIRINQMLDTKQQRNFFIGVLDIAGFEIFDFNSMEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIVWEFIDFGMDLASCIELIEKPMGIFSILEEECMFPKATDTSFKNKLYDQHLGKCNAF-QKPKPAKGKAEAHFSLVHYAGTVDYNISGWLDKNKDPLNESVLQLYQKSAVKLLATLYPPVVEEPKGGKGGKKKGGSMQTVSSQFRENLGKLMTNLRSTHPHFVRCLIPNESKTPGLMENFLVIHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYKVLNASVIPEGQFIDNKKASEKLLGSIDIDHDQYRFGHTKVFFKAGLLGTLEEMRDEKLASLVTMTQALCRGYLMRREYVKMTERRDSIYTIQYNIRSFMNVKHWPWMKVYYKIKPLLKSAETEKELATMKEDFAKCKEDLAKAEAKKKELEEKMVSLLQEKNDLQLQVASESENLSDAEERCEGLIKSKIQLEAKLKETTERLEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAAQDESISKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKSKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDLENDKQQSEEKIKKKDFEISQLLSKIEDEQSLGAQLQKKIKELQARIEELEEEIEAERAARAKVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEAVAKAKANLEKMCRTLEDQLSEIKTKNDENVRQINDIGAQKARLQTENGEFGRQLEEKESLVSQLTRGKQAFTQQIEELKRQIEEEVKAKNALAHGLQSARHDCDLLREQFEEEQEAKAELQRSMSKANSEVAQWRSKYETDAIQRTEELEEAKKKLAQRLQEAEEQIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANALAANLDKKQRNFDKVLAEWKQKFEEGQAELEGAQKEARGLSTELFKMKNSYEEALDQLETLKRENKNLQQEISDLTEQIGETGKSIHELEKAKKTVETEKAEIQTALEEAEGTLEHEESKILRVQLELNQVKGEVDRKLAEKDEEMEQIKRNSQRVIESMQSTLDSEVRSRNDALRIKKKMEGDLNEMEIQLSHANRQASEAQKQLRNVQGQLKDAQLHLDDAVRGQEDMKEQVAMVERRNTLMLAEIEELRAALEQTERGRKVAEQELVDASERVALLHSQNTSLLNTKKKLEADLVQVQGEVDDTVQEARNAEDKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELEAEVEAEQRRGVDAVKGVRKYERRVKELTYQTEEDKKNLTRLQDLVDKLQLKVKAYKRQAEEAEEQANGHLSKLRKAQHDLEEAEERADIAESQVNKLRAKSRDS 1926          
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Match: ENSAMXT00000039595.1 (myosin heavy chain, fast skeletal muscle-like [Source:NCBI gene;Acc:103043084])

HSP 1 Score: 1765.74 bits (4572), Expect = 0.000e+0
Identity = 1027/1915 (53.63%), Postives = 1405/1915 (73.37%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKT-DKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPA--EDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSS 5843
            YL    K  ++     FD+K  C++ D KE ++  TI+   G    V+  D  E +TVK+D++  MNPPKF  IEDMA +T LN+ASVL NL++RY   +IYTYSGLFC T+NPYK  P+Y  +V++ Y+GK+R E PPHIFS+SDNAY  ML DR+NQSVLITGESGAGKT NTK+VI YFA VA    K+++   +  K +G+LEDQI+ ANP+LEAYGNAKTVRN+NSSRFGKFIRIHFGTSGK+A ADIE YLLEKSRV  Q   ER YHIFYQ+++N      E  LI+ +P  +   +QG++T+  +DD+EE+  TD A DILGF+ EEKMS++K T ++L+ G MKFKQ+ REEQAE DGT +A+KVA+LLG+N+ D+++++  P+VKVGNE+VTKGQ   QV  +V ALAKS+Y RMF W+V+R+N+ LDTK +R FFIGVLDIAGFEIF+FN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I WEFIDFGMDL ACIELIEKPMGI SILEEECMFPKA+D +FK KLYD HLGK   F +   P  G+AEAHF L HYAG+V YN+ GWL+KNKDPLNE+V+ L   S   L+++L+ P   E     G +KKGG+MQT+SS  RE+L KLM NL+ST PHF+RC++PNE K PG+++  LV+HQL CNGVLEGIRICRKGFP+R++Y +FKQRY +L  + IP+G F++ K+   K+L ++ +D + YR G+TKVFFKAG L  LE+MRDEKL++L+++ QA  RGYLMRR++ K+ ++R ++  IQ NIR ++ ++ WPW K+Y K+KPLL  A  E+E+    E+  K KE+  K +  KKELEE+ V LL+ +NDL LQ+ +E ++L+DAEE+   L+  K  +E ++KE  + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA Q+E + KL KEKKA  E  ++T + L AEE+KV  L K+K KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK  QE++ DLE  K++ EE++K+K+ E+    SKIEDE  L AQLQ+KIKELQARI+ELEE++EAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEES +QH+   A  RKKQ D V E  EQ+D LQ+VK K+EKEK+E K +++DL   +E++ KAKAN +K  + +E Q SE++ K +E  R IND +    + Q  N E   +LEE ES ++QL + KQ    Q++E ++  EEE +AK  L+  +++   D D LRE  EEE E K+++QR + KA  E+ Q ++K+E     R+EEL+EAK+K   R+ E EE+ E   SK   LEK K RLQGE+ED+++DV+RAN LA+ L+KKQ+ FDKV++EW+QK+ E QAELE +Q+E+R +S E+F+MK   EE+ +QLE++KRENKNL  EI DLTEQIGE G+S+HE++KA+K +E EK E+Q ALEEAE  LE EE+K  R QLE++Q++ E+DR+LAEK+EE E  + N QR +ESM+++L++E R R +A ++KKK+E D+ E+E+ +  ANR  SE +K  +  Q Q+++    ++D    ++ ++EQ  M ER+ T++LAE+EE+R +LE +ER RK  E E ++ ++R+  L  Q++  + TK+KLEADL  +Q ++++   EAR A ++AKKA+ D+A + +E+++EQ+ +  ++++KK LE   K+LQ +LDE+EN A+KGGKK L KLE RVRELEAE++ EQ+R V++ K  RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE A  +L+K RK Q ++E++EERAD AE  + KLR K+R S
Sbjct:   16 YLRKPEKERIEAQSKPFDAKSACYVADVKELYLKGTIKSRDGGKVVVEVLDTKEERTVKEDDVSPMNPPKFDKIEDMAMMTHLNEASVLYNLKERYAAWMIYTYSGLFCATVNPYKWLPVYDAEVVAAYRGKKRMEAPPHIFSVSDNAYQFMLTDRENQSVLITGESGAGKTVNTKRVIQYFATVAVQGDKKKE---SASKMQGSLEDQIIAANPLLEAYGNAKTVRNDNSSRFGKFIRIHFGTSGKLASADIETYLLEKSRVTFQLSDERGYHIFYQMMTNHKPELIEMTLITTNPYDFPMCSQGQITVASIDDKEELVATDTAIDILGFTNEEKMSIYKFTGAVLHHGNMKFKQKQREEQAEPDGTEDADKVAYLLGLNSADMLKALCYPRVKVGNEFVTKGQTVPQVYNAVSALAKSIYERMFLWMVIRINQMLDTKQQRNFFIGVLDIAGFEIFDFNSMEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIIWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYDQHLGKCNAF-QKPKPAKGKAEAHFSLVHYAGTVDYNIAGWLDKNKDPLNESVVQLYQKSAVKLLATLYPPVVEETGGKKGGKKKGGSMQTVSSQFRENLGKLMTNLRSTHPHFVRCLIPNESKTPGLMENFLVIHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYKVLNASVIPEGQFIDNKKACEKLLGSIDIDHDQYRFGHTKVFFKAGLLGTLEEMRDEKLAALVTMTQAVCRGYLMRREFVKMMERRESIYTIQYNIRSFMNVKHWPWMKVYYKIKPLLKSAETEKELATMKEDFAKCKEDLAKAEAKKKELEEKMVSLLQERNDLQLQVASESENLSDAEERCEGLIKSKIQLEAKLKETTERLEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAAQDESIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKSKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDLENDKQQSEEKMKKKDFEISQLLSKIEDEQSLGAQLQKKIKELQARIEELEEEIEAERAARAKVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEAVAKAKANLEKMCRTLEDQLSEIKSKNDENVRQINDLSAQKARLQTENGEFGRQLEEKESLVSQLTRGKQAFTQQIDELKRQIEEEVKAKNALAHGLQSARHDCDLLREQFEEEQEAKAELQRSMSKANSEVAQWRSKYETDAIQRTEELEEAKKKLAQRLQEAEEQIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANALAANLDKKQRNFDKVLAEWKQKFEEGQAELEGAQKEARGLSTELFKMKNSYEEALDQLETLKRENKNLQQEISDLTEQIGETGKSIHELEKAKKTVETEKAEIQTALEEAEGTLEHEESKILRVQLELNQVKSEVDRKLAEKDEEMEQIKRNSQRVIESMQSTLDSEVRSRNDALRIKKKMEGDLNEMEIQLSHANRQASEAQKQLRNVQGQLKDAQLHLDDAVRGQEDMKEQVAMVERRNTLMLAEIEELRAALEQTERGRKVAEQELVDASERVALLHSQNTSLLNTKKKLEADLVQVQGEVDDTVQEARNAEDKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELEAEVEAEQRRGVDAVKGVRKYERRVKELTYQTEEDKKNLTRLQDLVDKLQLKVKAYKRQAEEAEEQANGHLSKLRKAQHDLEEAEERADIAESQVNKLRAKSRDS 1926          
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002731.1 (pep scaffold:Pmarinus_7.0:GL478284:11062:40470:1 gene:ENSPMAG00000002428.1 transcript:ENSPMAT00000002731.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1700.26 bits (4402), Expect = 0.000e+0
Identity = 1026/1912 (53.66%), Postives = 1378/1912 (72.07%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKR---KGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFA-----PAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQR-YSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTN---AELQARLEEAESQIN-QLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNL---ADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSS 5843
            FD KKN ++   K  FI A ++   G  YTV+T + ET  VK  ++ QMNPPKF  IEDMA LTFLN+ SVL NL++RY   +IYTYSGLFCVT+NPYK  P+Y+ Q ++ Y+GK+R E PPHIFSISDNAY  ML+DR+NQSVLITGESGAGKT NTK+VI YFA +AAA          G KR   KGTLEDQIV ANP LEA+GNAKT+RN+NSSRF  ++   F  S       +  +LLEKSRV  Q K ERNYHIFYQILS       E LL++ +P  YSFI+QG++T+ G+DD +E+  TD AFDILGF+AEEK S++K T +I++ G M FKQ+ REEQAEADGT +A+K ++L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV YS+GALAKS+Y +MF W+V+R+N++L+TK  RQ FIGVLDIAGFEIF+FN FEQICIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACIELIEKPMGI+SILEEECMFPKASD +FKAKLYDNHLGKS NF +      G+ EAHF L HYAG V YN++GWL KNKDPLNETV+ L   S   L+S LFA      A+     G +KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K+PG +D  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQR Y IL PNA+P+G F++ ++   K+L  + +D   Y+ G+TKVFFKAG L  LE++RD++LS +I+L Q+Q RG+L R+++ K+ ++R AL +IQ NIR ++ ++ WPW KL+ K+KPLL  A  E+EM+   E+  KLKE + K +  +KELEE++V LL+ KNDL +Q+Q EQD++ADAEE+  +L+  K   EG+IKEL + L EEE+  A +   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  ++ + KL KEKKA  E  ++T + L AEE+KV +L K+KAKLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQET+ DLE  K++LEE+ K ++      +S+IEDE  L AQLQ+KIKELQARI+ELEE+LEAER ARAK EK R  +  ELEE+S+RLEE GGAT+AQ++ NKKREAE  KL+RDLEES +QH+   +  RKK  D V E  EQLD LQ+VK K+EKEK+E+K +L+D+   +ES+ K K ++ +   +    +  L    +   R I+D      K Q  N   +         E+ I    G   +Q  +Q    R I   E +AK+ L+  V+    D D LRE  EEE E K+++QR L +A  E+ Q + K+E     R+EEL+EAK+K + R+ E EE  E A +K   LEK K RLQ E+EDM+VDV+RAN  A+ L+KKQ+TFDKV+SEW+QK+ ESQAELE +Q+E+R++S E+F++K   EES + LE++KRENKNL    +EI DLTEQ+ EG ++VHE++K RK+LE EK +LQ ALEEAE +LE EE+K  R+QLE++Q++ +I+R+L+EK+EE E  + N+QRA+E+++ +LEAE+R R EA ++KKK+E D+ E+E+ +  ANR  SE +K  K  Q Q +E    ++D     D+ +EQ  M ER+ T++LAE+EE+R +LE +ER RK  E E +E ++R+  L  Q++  +  K+KLE D+  +Q+++EE+  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQ+R+ E+ K +RK ERR KEL  QT+EDKKN  RLQDLV+KLQ K+K YKR  EEAEE A  NL++YRK+Q E+E++EERAD AE    KLR K R +
Sbjct:   29 FDMKKNVYVNHPKCEFIKALVQSVDGGKYTVETAEGETIVVKDVDVMQMNPPKFDKIEDMAMLTFLNEPSVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYSSQCVNAYRGKKRQEAPPHIFSISDNAYQYMLSDRENQSVLITGESGAGKTVNTKRVIQYFASIAAA----------GTKRDASKGTLEDQIVSANPALEAFGNAKTLRNDNSSRFTTYV---FVLSNVCLSVHLSLHLLEKSRVTFQLKAERNYHIFYQILSQRKPELLEMLLVTTNPYDYSFISQGQVTVAGMDDGDELMATDSAFDILGFTAEEKASVYKLTGAIMHFGNMHFKQKQREEQAEADGTEDADKASYLMGLNSADLIKGLCHPRVKVGNEYVTKGQDVQQVSYSIGALAKSVYEKMFNWMVVRINQSLETKAPRQHFIGVLDIAGFEIFDFNSFEQICINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWVFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDQSFKAKLYDNHLGKSNNF-QKPRIVKGRPEAHFALMHYAGVVDYNISGWLIKNKDPLNETVVGLYQKSSLKLLSVLFANYAAADADAAKKGGAKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNEEKKPGAMDNALVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRQYRILNPNAVPEGQFMDSRKSAEKLLSTLDIDHTQYKFGHTKVFFKAGLLGTLEELRDDRLSKIITLMQSQCRGFLSRKEFAKIIERRDALLVIQYNIRAFMGVKNWPWMKLFFKIKPLLKSAETEKEMQNMKEDFLKLKEAYAKSEARRKELEEKSVSLLQEKNDLAMQVQAEQDNIADAEERCEQLIKSKISQEGKIKELTERLEEEEEMNAEVTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKSKAKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQETIMDLENDKQQLEEKSKNRDFMTNTLNSRIEDEQALAAQLQKKIKELQARIEELEEELEAERAARAKVEKQRADVARELEEISERLEEAGGATAAQVEFNKKREAEFQKLRRDLEESTLQHEATASALRKKHADSVAELGEQLDNLQRVKQKLEKEKSELKMELDDVLSNMESVVKTKVSAWRDASDAARAHRHLHLSCQ---RLISDFTAQKAKLQTENGAPSSTHTPQYAIETIITMHTGTFIEQRLSQ----RHIKHNEVKAKSALAHAVQAARHDCDLLREQYEEEQEAKAELQRALSRANAEVAQWRTKYETDAIQRTEELEEAKKKLVQRLQEAEESVEAANAKCSSLEKTKQRLQNELEDMMVDVERANAAAAALDKKQRTFDKVLSEWKQKFEESQAELEGAQKEARSLSTELFKLKNAYEESLDHLETMKRENKNLQACTEEISDLTEQMSEGAKTVHELEKLRKQLEQEKVDLQAALEEAEASLEHEESKILRAQLELNQMKADIERKLSEKDEELEQAKRNNQRAVETLQTALEAETRSRNEALRIKKKMEGDLNEMEIQLSHANRSASEAQKQLKMVQSQFKEAQLQLDDALRLGDEYKEQAAMAERRSTLMLAEVEELRSALEQTERARKLAEQELIEASERVQLLHSQNTSLINQKKKLEGDMGVLQNEVEESVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQRRNAETVKGARKYERRAKELSYQTEEDKKNLARLQDLVDKLQMKVKAYKRPAEEAEEQANGNLSRYRKLQHELEEAEERADIAESQANKLRAKTRDA 1919          
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005582.1 (pep scaffold:Pmarinus_7.0:GL481917:38212:72095:-1 gene:ENSPMAG00000004862.1 transcript:ENSPMAT00000005582.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1654.42 bits (4283), Expect = 0.000e+0
Identity = 1015/1931 (52.56%), Postives = 1365/1931 (70.69%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLL----AASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQR-YSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNT-----------SGKNQQTNAELQARLEEAESQIN-QLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNL---ADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTT----MTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATK-----RKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARG 5861
            FD KKN ++   K  FI A ++   G  YTV+T + +T  VK  ++ QMNPPKF  IEDMA LTFLN+ SVL NL++RY   +IYTYSGLFCVT+NPYK  P+Y+ Q ++ Y+GK+R E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AAA  K   DT      KGTLEDQIV ANP LEA+GNAKT+RN+NSSRFGKFIRIHFGT+GK+A ADIE   LEKSRV  Q K ERNYHIFYQILS       + LL++ +P  YSFI+QG++T+ G+DD +E+  TD A+DILGF+ EEK S++K T +I++ G M FKQ+ REEQAEADGT +A+K ++L+G+N+ DL++ +  P+VKVGNEYVTKGQN  QV YS+GALAKS+Y +MF W+V+R+N +L+TK  RQ FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACIELIEKPMGI+SILEEECMFPKASD +FKAKLYDNHLGKS NF +      G+ EA F L HYAG V YN++GWL KNKDPLNETV+ L           L ++  A   D    G +KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K+PG +D  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQR Y IL PNA+P+G F++ ++   K+L  + +D   Y+ G+TKVFFKAG L  LE+MRD++LS +I+L QA++RG L R+++ K+ ++R AL +IQ NIR ++ ++ WPW KL+ K+KPLL  A  E+EM+   E+  KLKE + K +  +KELEE++V LL+ KNDL +Q+Q EQD++ADAEE+  +L+  K   EG+IKEL + L EEE+  A +   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  ++ + KL KEKKA  E  ++T + L AEE+KV +L K+KAKLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQET+ DLE  K++LEE+ K+ + E+   +S+IEDE  L AQLQ+KIKELQARI+ELEE+LEAER ARAK EK R  +  ELEE+S+RLEE GGAT+AQ++ NKKREAE  KL+RDLEES +QH+   +  RKK  D V E  EQLD LQ+VK K+EKEK+E+K +L+D+   +ES+ K K  S KR++ ++    E +  L E+   ++  N             SG +  T A +Q R+++   + N Q   +   +Q       + A   +   A+   D+         LRE  EEE E K+++QR L +A  E+ Q + K+E     R+EEL+EAK+K + R+ + EE  E A +K   LEK K RLQ E+EDM+VDV+RAN  A+ L+KKQ+TFDKV++EW+QKY ESQAELE +Q+E+R++S E+F++K   EES + LE++KRENKNL    +EI DLTEQ+ EG ++VHE++K RK+LE EK +LQ ALEEAE +LE EE+K  R+QLE++Q++ +IDR+L+EK+EE E  + N+ RA+E+++ +LEAE+R R EA ++KKK+E D+ E+E+ +  ANR  SE +K  K  Q Q +               +R + T    ++  K+ +++               + K+TE         L+  S++    M        + LE D+ ++QS++EEA  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  ALKGGKK L KLE RVRELE EL+ EQ+R+ E+ K +RK ERR KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE A  NL++YRK+Q E+E++EERAD AE    KLR K R  V   RG
Sbjct:   29 FDMKKNVYVNHPKCEFIKALVQSVEGGKYTVETAEGQTVVVKDVDVMQMNPPKFDKIEDMAMLTFLNEPSVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYSSQCVNAYRGKKRQEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAAGTKR--DTS-----KGTLEDQIVSANPALEAFGNAKTLRNDNSSRFGKFIRIHFGTTGKLASADIE--TLEKSRVTFQLKAERNYHIFYQILSQRKPELLDMLLVTTNPYDYSFISQGQVTVAGLDDGDELMATDSAYDILGFTGEEKASVYKLTGAIMHFGNMHFKQKQREEQAEADGTEDADKASYLMGLNSADLIKGLCHPRVKVGNEYVTKGQNVQQVSYSIGALAKSVYEKMFNWMVVRIN-SLETKAPRQHFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDQSFKAKLYDNHLGKSNNF-QKPRIVKGKLEADFALVHYAGVVDYNISGWLVKNKDPLNETVVGLYQKSSLKLLALLFANYAAVDADTTKKGTKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNEEKKPGAMDNALVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRQYRILNPNAVPEGQFMDSRKSAEKLLSTLDIDHTQYKFGHTKVFFKAGLLGTLEEMRDDRLSKIITLLQARLRGLLSRKEFAKIIERRDALLVIQYNIRAFMGVKNWPWMKLFFKIKPLLKSAETEKEMQNMKEDFLKLKEAYAKSEARRKELEEKSVSLLQEKNDLAMQVQAEQDNIADAEERCEQLIKSKISQEGKIKELTERLEEEEEMNAEVTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKSKAKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQETIMDLENDKQQLEEKSKKFDFEMNTLNSRIEDEQALAAQLQKKIKELQARIEELEEELEAERAARAKVEKQRADVARELEEISERLEEAGGATAAQIEFNKKREAEFQKLRRDLEESTLQHEATASALRKKHADSVAELGEQLDNLQRVKQKLEKEKSELKMELDDIVSNMESVVKTKEISQKRLRVLDFCVIESRMSLIESQESVDSWNRVALKLQTENGAPSGTHTDTGALIQQRVQQRHIKNNEQFAHLPHPVQAS--AKAKSALAHAVQAARHDCDL---------LREQYEEEQEAKAELQRALSRANAEVAQWRTKYETDAIQRTEELEEAKKKLVQRLQDAEESVEAANAKCSSLEKTKQRLQNELEDMMVDVERANAAAAALDKKQRTFDKVLAEWKQKYEESQAELEGAQKEARSLSTELFKLKNAYEESLDHLETMKRENKNLQACTEEISDLTEQMSEGAKTVHELEKLRKQLEQEKVDLQAALEEAEASLEHEESKILRAQLELNQMKADIDRKLSEKDEELEQAKRNNLRAVETLQTALEAETRSRNEALRIKKKMEGDLNEMEIQLSHANRSASEAQKQLKIVQAQFK---------------VRGRPTGMMELSYDKIIIIIV-------------NHDKSTE------VAFLSHYSMRMHVIMPPLQIIIIKXLEGDMGSLQSEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQRRNAETVKGARKYERRAKELSYQTEEDKKNMARLQDLVDKLQMKVKAYKRQSEEAEEQANGNLSRYRKLQHELEEAEERADIAESQANKLRAKTR-DVGIKRG 1902          
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003821.1 (pep scaffold:Pmarinus_7.0:GL477325:10535:35195:1 gene:ENSPMAG00000003267.1 transcript:ENSPMAT00000003821.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1162.52 bits (3006), Expect = 0.000e+0
Identity = 597/1047 (57.02%), Postives = 795/1047 (75.93%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAA---ATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITD--EAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAP-----AEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDD 3266
            FD KK C++ D K  F+ A I+ + G   TV T+  +T TVK+ ++ QMNPPKF  IEDMA LTFLN+ SVL NL++RY   +IYTYSGLFCVTINPYK  P+Y P V++ Y+GK+R E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA    TKK+E+       +KGTLEDQIV+ANP++EA+GNAKTVRN+NSSRFGKFIRIHFG +GK++ ADIE YLLEKSRV  Q   ERNYHIFYQI S       E LLI+ +P  Y FI+QGE+T+  +DD +E+  TD   A DILGF+ +EK+S++K T ++++ G MKFKQ+ REEQAE DG  +A+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQ   QV  SVGALA+S++ +MF W+V+R+N+TL TK+ RQ FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE IDW FIDFGMDLQACI+LIEKPMGI+SILEE+CMFPKA+D TFK KLYD HLGK+  F +   P  G+ EAHF L HYAG+V YN++GWLEKNKDPLN++V+ L   S   ++++++A      ++  +  GK+KKG + QT+S+ HRE+LNKLM NL++T PHF+RCI+PNE K PG +D +LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY +L PNAIP+G F++ K+   K++ +++LD   Y+ G+TKVFF+AG L  LE+MRD++LS L++  QA  RGYL R ++KK+ ++R +L IIQ NIR ++ ++ WPW  LY K+KPLL  A  E+EM    EE  K KE  EK +  +KELEE+ + +++ KNDL +Q+Q+ +++L DAEE+  +L+  K  +EG+IKE+++ + EEE+  A +   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  +E ++KL KEKKA  E  ++T + L AEE+KV +L KAKAKLEQ +D++E +L +E+K+R DVE+ KRK+E +LK  QE++ D
Sbjct:   29 FDMKKECYVDDPKVEFVKAIIKSSEGGKVTVDTENGQTVTVKESQVHQMNPPKFDKIEDMAMLTFLNEPSVLFNLKERYAAWMIYTYSGLFCVTINPYKWLPVYDPIVVAGYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAALGDVTKKKEES------KKGTLEDQIVEANPLMEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLSSADIETYLLEKSRVTFQLPTERNYHIFYQIESQKKPELLEMLLITNNPYDYVFISQGEITVPSIDDGDELMATDVQSAIDILGFTNDEKLSIYKVTGALMHYGNMKFKQKQREEQAEPDGNEDADKAAYLMGLNSADLLKGLCYPRVKVGNEYVTKGQTVQQVHNSVGALARSVFEKMFLWMVIRINETLATKLARQHFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIDWVFIDFGMDLQACIDLIEKPMGIMSILEEQCMFPKANDQTFKEKLYDQHLGKN-QFFQKPKPSKGKHEAHFSLGHYAGNVDYNISGWLEKNKDPLNDSVVQLYQKSSLKMLAAVYATYAGADSDSGSKGGKKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCIIPNETKTPGTMDNNLVMHQLRCNGVLEGIRICRKGFPNRIVYGDFKQRYRVLNPNAIPEGQFMDSKKACEKLMASLELDDTQYKFGHTKVFFRAGLLGTLEEMRDDRLSLLLTRTQALARGYLSRVEFKKMLERRESLIIIQYNIRAFMGVKNWPWMNLYFKIKPLLKSAESEKEMANMKEEFIKTKEALEKSEARRKELEEKMISVVQDKNDLLIQVQSSEETLNDAEERCDQLIKTKIQLEGKIKEIQERVEEEEEMNAEITAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAVLDENVSKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKAKAKLEQQVDDLEGSLEQEKKVRMDVERTKRKMEGDLKLAQESLMD 1068          
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004078.1 (pep scaffold:Pmarinus_7.0:GL478761:5289:25008:-1 gene:ENSPMAG00000003722.1 transcript:ENSPMAT00000004078.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1160.98 bits (3002), Expect = 0.000e+0
Identity = 606/1043 (58.10%), Postives = 788/1043 (75.55%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFA------PAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDD 3266
            FD KKN ++   K  F+ A ++   G  YTV+T++ ET TVK  ++ QMNPPKF  IEDMA LTFLN+ SVL NL++RY   +IYTYSGLFCVT+NPYK  P+Y+ Q ++ Y+GK+R E PPHIFSIS        ADR+NQS+LITGESGAGKT NTK+VI YFA +AAA  K +         KGTLEDQIV ANP LEA+GNAKT+RN+NSSRFGKFIRIHFGT+GK+A ADIE   LEKSRV  Q K ERNYHIFYQILS       E LL++ +P  Y+FI+QG++T+ G+DD +E+  TD A+DILGF  EEK S++K T +I++ G M FKQ+ REEQAEADGT +A+K ++L+G+N+ DL++ +  P+VKVGNEYVTKGQN  QV YS+GALAKS+Y +MF W+V+R+N++L+TK  RQ FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACIELIEKPMGI+SILEEECMFPKASD +FKAKLYDNHLGKS NF +      G+ EAHF L HYAG V YN++GWL KNKDPLNETV+ L   S   L++SLFA       A D +  G +KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K+PG +D  LV+HQL CNGVLEGIRICRKGFP+R++Y +F  RY IL PNA+P+G F++ ++   K+L  + +D   Y+ G+TKVFFKAG L  LE+MRD++LS +I+L QA+ RG L R+++ K+ ++R AL +IQ NIR ++ ++ WPW KL+ K+KPLL  A  E+EM+   E+  KLKE + K +  +KELEE++V LL+ KNDL +Q+Q EQD++ADAEE+  +L+  K   EG+IKEL + L EEE+  A +   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  ++ + KL KEKKA  E  ++T + L AEE+KV +L K+KAKLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQET+ D
Sbjct:   29 FDMKKNVYVTHPKCEFVKALVQSVEGGKYTVETEEGETVTVKDADVMQMNPPKFDKIEDMAMLTFLNEPSVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYSSQCVNAYRGKKRQEAPPHIFSISLYISDLHSADRENQSILITGESGAGKTVNTKRVIQYFASIAAAGTKRD-------ASKGTLEDQIVSANPALEAFGNAKTLRNDNSSRFGKFIRIHFGTTGKLASADIE--TLEKSRVTFQLKAERNYHIFYQILSQRKPELLEMLLVTSNPYDYAFISQGQVTVAGLDDGDELMATDSAYDILGFVPEEKASVYKLTGAIMHFGNMHFKQKQREEQAEADGTEDADKASYLMGLNSADLIKGLCHPRVKVGNEYVTKGQNVQQVSYSIGALAKSVYEKMFNWMVVRINQSLETKAPRQHFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDQSFKAKLYDNHLGKSNNF-QKPRIVKGKPEAHFALVHYAGVVDYNISGWLVKNKDPLNETVVGLYQKSSLKLLASLFANYAGADSAADTSKKGAKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNEEKKPGAMDNALVMHQLRCNGVLEGIRICRKGFPSRILYGDFTHRYRILNPNAVPEGQFMDSRKSAEKLLSTLDIDHTQYKFGHTKVFFKAGLLGTLEEMRDDRLSKIITLLQARCRGLLSRKEFAKIIERRDALLVIQYNIRAFMGVKNWPWMKLFFKIKPLLKSAETEKEMQNMKEDFLKLKEAYAKSEARRKELEEKSVSLLQEKNDLAMQVQAEQDNIADAEERCEQLIKSKISQEGKIKELTERLEEEEEMNAEVTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKSKAKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQETIMD 1061          
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005411.1 (pep scaffold:Pmarinus_7.0:GL476612:1285:44967:1 gene:ENSPMAG00000004885.1 transcript:ENSPMAT00000005411.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1115.91 bits (2885), Expect = 0.000e+0
Identity = 587/1053 (55.75%), Postives = 765/1053 (72.65%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGD-VYTVK-TDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNML--ADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLY-------SVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFA--PAEDPNNTG---KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEA-KNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDD 3266
            FD KKNCW+ DEKE F+ A I+D  GD   +VK T  +E   VKKD +++MNPPKF  IEDMANLTFLN+ASVL+NL++RY K  IYTYSGLFCVTINPYK  PIY  +V   Y+GK+R E+PPH+FSISDNAY++ML  AD+ NQS+LITGESGAGKTENTKKVI YFA++   TK+        Q ++G+LEDQI+QANPVLEA+GNAKT RNNNSSRFGKFIRIHF  SGK++GADIE YLLEKSRV SQQ  ER YHIFYQ+LS       E++ +  +P  Y+ I+QG  +++ +DD EEM +TDEAFD+LGF+ EEKMSL+K T  I++ G MKF+Q+PREEQAE DGT  A++VA L G+++ +L + I +PKVKVGNEYV K QN DQV +       S+GALAK++Y+RMF WLV RVNKTLDT   RQ+FIGVLDIAGFEIF FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFG+DL ACI+L+EKPMGI SILEE+C+FPKA+D TFKA +YDNHLGKS  F KPK  K    EA FEL HYAG+V YN  GWLEKNKDPLNETV++L   S   L+S LF    A D ++ G   K+KKG A QT+S  +RE LNKLM  L STSPHF+RCIVPNEFK+ GV+DAHL+LHQL CNGVLEGIRICRKGFPNR +Y EF QRYSI+   A  +   + K +T K+L++  L  + YR+G TKVFF+AG L  LED RD+ +   I+  QA  RG + RR ++K+ D+R A+ IIQ N+R +L LR WPW++LYTKV+P+  I  +EEE +K  EE  K   +  +      +   + V  LE  +N L  QL  E+    DA+ +V+ L  Q+ ++EGR+ EL   L +EE     L   +++++ E+++LK +V  LE S+ K E+EK A + ++++  +++  ++E + KL+KEKK  +E  + T + L  E++K+ +L ++  K +  I E+E+ L +E+K+R +VEK KRK+E++L+ T +++++
Sbjct:   29 FDIKKNCWVKDEKEGFLQALIQDDHGDNTVSVKFTVNNEIAKVKKDIVQEMNPPKFEQIEDMANLTFLNEASVLNNLKERYVKMRIYTYSGLFCVTINPYKWLPIYGSRVAKMYRGKKRNEVPPHLFSISDNAYSDMLITADKANQSMLITGESGAGKTENTKKVIQYFANIGGGTKQ------IDQSKQGSLEDQIIQANPVLEAFGNAKTTRNNNSSRFGKFIRIHFAVSGKLSGADIETYLLEKSRVISQQPAERGYHIFYQLLSGKVPNLLEEIGLVNNPKEYASISQGVTSVENMDDAEEMMLTDEAFDVLGFTPEEKMSLYKLTGGIMHFGNMKFRQKPREEQAEVDGTEVADRVASLAGIDSSELQKGITRPKVKVGNEYVQKNQNMDQVYHLPQKCMSSIGALAKAIYDRMFKWLVARVNKTLDTTKPRQYFIGVLDIAGFEIFEFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGINWVFIDFGLDLAACIDLLEKPMGIFSILEEQCVFPKATDATFKAAMYDNHLGKSAPFQKPKAGKKAGQEATFELVHYAGTVGYNTQGWLEKNKDPLNETVVSLFQNSSMPLLSVLFKEEEAADASSAGAKQKQKKGSAFQTVSVFYREQLNKLMATLHSTSPHFVRCIVPNEFKKSGVVDAHLILHQLACNGVLEGIRICRKGFPNRTLYPEFVQRYSIINLLA-GKTETDPKAITEKVLKSTNLVEDEYRIGFTKVFFRAGVLGKLEDFRDDCICRFITKLQASCRGKVFRRDFQKVLDKRDAMVIIQSNVRSFLQLRHWPWFRLYTKVRPMC-IQLKEEEERKKKEEEMKRALQDAEKMVEDLKELTERVATLETERNALQEQLDAERGKKGDAQGRVTSLDRQRKELEGRVAELNARLEDEERTTTELTGRRRRLENEVQDLKIEVESLEGSVAKLEKEKKALENKVRTQTEEVNLRDETIVKLQKEKKQLEEANQATLDDLQIEQDKLAHLQRSNNKSQNKIAELEDLLDQEKKLRVEVEKAKRKLESDLRSTVDSLNE 1073          
BLAST of Myosin heavy chain vs. Ensembl Yeast
Match: MYO1 (Type II myosin heavy chain; required for wild-type cytokinesis and cell separation; localizes to the actomyosin ring; binds to myosin light chains Mlc1p and Mlc2p through its IQ1 and IQ2 motifs respectively [Source:SGD;Acc:S000001065])

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 369/865 (42.66%), Postives = 520/865 (60.12%), Query Frame = 3
Query:  150 GDSFDSKKNCWIPDEKEAFIAATI-------------EDASGDVYTV-KTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKR------------RTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKL-LISPDPALYSFI-NQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEK---PMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAP-AEDPNNTG-----------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAP-NAIPQGFVEGKQVTSK-----ILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQ----YKKLQDQRVALSIIQRNIRKY-LLLRTWPWWKLYTKVKPLL 2582
            G S  S    WIPDEKE F+   +             E+  G V+ +  T+ S    V+  ++  +NP  F  +E+M+ LT LN+ SVL NL +RY  +LIYTYSGLF V INPY    +Y+   I+ Y  K               ++PPHIF+I++ AY N+L++  +QS+L+TGESGAGKTENTKK++ Y A + + +        +G     + E +I+Q+NP+LE++GNA+TVRNNNSSRFGKFI+I F   G I GA IE+YLLEKSR+  Q   ERNYHIFYQ+LS       + L L S +   Y  + N  +  I G++D E  K    A +I+GFS ++   +F+    IL +G ++F    R EQA       A  +   LGV+ KD   +IL+P+ K G E+V++ +N  Q  + + AL+++LY R+F ++V  +NK LD       +IG+LDIAGFEIF  N FEQ+CINYTNE+LQQFFN+HMFVLEQ EY KE I W++ID+G DLQ  I+LIE    P G+L +L+EE + PK++D +F +KL       S  F      K  + +  F L HYAG V Y V GWL KNKDPLN+ +++LL++S+  ++S LF P  E  ++ G           K  +    +T SS HRE    L+  L ST PHF+RCI+PN  K+    +  L+L QL CNGVLEGIR+ R+G+PNR+ + EF QRY IL P N+    F    + ++K     +L ++QLDT +Y++GNTK+FFKAG LADLE  +D KL++++    A IRGY +R++     +KL+  RV    I    R Y  L++  PW+ L+ ++KPLL
Sbjct:    4 GQSCSSNMIVWIPDEKEVFVKGELMSTDINKNKFTGQEEQIGIVHPLDSTEVSNLVQVRISDVFPVNPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLNLYSEDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAGKTENTKKILQYLASITSGSPSNIAPV-SGSSIVESFEMKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKNLRLKSRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILLIGNIEFVS-DRAEQASFKNDVSA--ICSNLGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQAKFILNALSRNLYERLFGYIVDMINKNLDHGSATLNYIGLLDIAGFEIFENNSFEQLCINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPLLDEEAVLPKSTDESFYSKLISTWDQNSSKF------KRSRLKNGFILKHYAGDVEYTVEGWLSKNKDPLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEVKKSARTSTFKTTSSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLAREGYPNRIAFQEFFQRYRILYPENSTTTTFSSKLKASTKQNCEFLLTSLQLDTKVYKIGNTKLFFKAGVLADLEKQKDVKLNNIMIKLTATIRGYTVRKEITYHLQKLKKTRV----IGNTFRLYNRLVKEDPWFNLFIRIKPLL 854          
BLAST of Myosin heavy chain vs. Ensembl Yeast
Match: MYO2 (Type V myosin motor involved in actin-based transport of cargos; required for the polarized delivery of secretory vesicles, the vacuole, late Golgi elements, peroxisomes, and the mitotic spindle; MYO2 has a paralog, MYO4, that arose from the whole genome duplication [Source:SGD;Acc:S000005853])

HSP 1 Score: 528.865 bits (1361), Expect = 1.751e-158
Identity = 320/843 (37.96%), Postives = 475/843 (56.35%), Query Frame = 3
Query:  156 SFDSKKNCWIPDEKEAFIAATI-------------------EDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFP-IYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKR--KGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQ-GELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTL-DTKVKRQF--FIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPL------------NETVINLLAASKEALVSSLFAPAEDPNNTGKRKKG-----GAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSK--------ILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLL 2531
            SF+    CW P ++  +I A +                   E  S D   +  DK ++  + +      NPP     ED+ +L++LN+ +VL  ++QRY +  IYTYSG+  +  NP+ R   +YT  +I  Y GKRR E+ PH+F+I++ AY  M  D+ NQ+++++GESGAGKT + K ++ YFA V      EE+++ T Q +      E +I+  NP++EA+GNAKT RN+NSSRFGK++ I F     I GA I  YLLE+SR+  Q   ERNYHIFYQ+++       E+L ++ D + Y ++NQ G+  I+G+DD +E KIT +A  ++G + E +  +FK   ++L++G ++ K+   +    AD     +    LLG++A +  + + K ++   +E +    N  Q L +  ++AK +Y+ +F WLV  +N  L +  V  Q   FIGVLDI GFE F  N FEQ CINY NE+LQQ FN H+F LEQEEY KE I+W FI+F  D Q CI+LIE  +GILS+L+EE   P  SD ++  KLY   L KSP       P+ GQ +  F + HYA  V Y+V G++EKN+D +            NET+IN+L   ++A      A   +    G +K G         T+ S  ++SL +LM  + ST+ H+IRCI PN  K+    D  +VL QL   GVLE IRI   GFP+R  + EF  RY IL P+       + K+ T +        IL+A   D + Y++GNTK+FFKAG LA LE +R  K+ + I + Q +IR    R+QY ++     A+  +Q NI+ +++
Sbjct:    2 SFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSLPLLR------NPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASV------EEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLT-DASDYFYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSAD-EPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFN-DNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQT-LDKSPTNKVFSKPRFGQTK--FIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLINILEGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQ---AIKYLQNNIKGFII 823          
BLAST of Myosin heavy chain vs. Ensembl Yeast
Match: MYO4 (Type V myosin motor involved in actin-based transport of cargos; required for mRNA transport, including ASH1 mRNA, and facilitating the growth and movement of ER tubules into the growing bud along with She3p; MYO4 has a paralog, MYO2, that arose from the whole genome duplication [Source:SGD;Acc:S000000027])

HSP 1 Score: 520.39 bits (1339), Expect = 2.971e-156
Identity = 313/861 (36.35%), Postives = 480/861 (55.75%), Query Frame = 3
Query:  156 SFDSKKNCWIPDEKEAFIAATIEDASGDVYT------VKTDKSETKTVKKDEIEQ----------MNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFP-IYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQ-GELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTL-DTKVKRQ----FFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLY-------DNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLF---------APAEDPNNTGKR-----KKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQV--------TSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLL 2582
            SF+    CW P +++ +I    E    D +       +K +  ET +++ +  E            NPP     +D+  L++LN+ +VL  +++RY    IYTYSG+  +  NP+ +   +Y+ ++I  Y  KR+ E+ PH+F+I++ AY  M+ ++ NQ+V+++GESGAGKT + K ++ YFA V  +  +E      G+     +E QI+  NP++EA+GNAKT RN+NSSRFGK+++I F  +  I G+ I  YLLEKSR+  Q + ERNYHIFYQIL    +P  ++L +S  P  Y + NQ G+  I G+D+  E KIT +A  ++G + E ++ +FK    +L++G ++ K   R + + +      +    LLG++  +  + I+K ++   +E +    N +Q L +  ++AK +Y+ +F WLV  +NKTL D ++ +Q     FIG+LDI GFE F  N FEQ CINY NE+LQQ FN H+F LEQEEY KE I+W FI+F  D Q CI+LIE  +GILS+L+EE   P  SD ++ +KLY        N +   P FG          +  F + HYA  V Y V G++EKN+D ++   +++  A+   +   +          AP E   NT K+     +      T+ S  ++SL +LM  + ST+ H+IRCI PN  K+P   D  +VL QL   GVLE IRI   GFP+R  + EF QRY +L   ++  G +    +           IL+A   D+  Y++GNTK+FFKAG LA LE +R  K++ +  + Q +IR    R QY +  +   ++   Q  IR  LL+RT    +L T+   LL
Sbjct:    2 SFEVGTKCWYPHKEQGWIGG--EVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPTLPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNRE------GEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLS-SPKDYHYTNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKM-TRNDASLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFS-DNQPCIDLIENKLGILSLLDEESRLPSGSDESWASKLYSAFNKPPSNEVFSKPRFG----------QTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNPIFKQILDNRELRSDDAPEEQ--NTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKLRTNKMNEICIIIQKKIRARYYRLQYLQTME---SIKKCQSQIRS-LLVRTRVDHELKTRAAILL 835          
BLAST of Myosin heavy chain vs. Ensembl Yeast
Match: MYO3 (One of two type I myosins; localizes to actin cortical patches; deletion of MYO3 has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO3 has a paralog, MYO5, that arose from the whole genome duplication [Source:SGD;Acc:S000001612])

HSP 1 Score: 412.149 bits (1058), Expect = 2.789e-120
Identity = 277/792 (34.97%), Postives = 420/792 (53.03%), Query Frame = 3
Query:  249 VKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLIS-PDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNA----KDLMQSILKPK--VKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIE--KPMGILSILEEECMFP----KASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQL---DTNL----YRLGNTKVFFKAG-TLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIR------KYLLLRTW 2543
            VK  K  +  +KK   +  N  K + I D+  L+ ++D S+ +NL++R+   +IYTY G   +++NP++   IYT  V+  YKGK R E+PPH+F+I+++ Y N+ +  +NQ V+I+GESGAGKTE  K+++ Y   +AAA+    +         G ++D ++  NP+LE++G AKT+RNNNSSR GK++ I F +  +    +I  YLLEK RV  Q K ERN+HIFYQ        + +   +  P+  +Y+    G  T D +DD ++ + T EA   +G   EE+  +F+   +IL +G + F +   E  A+   T+  + VA+LL V+A    K L++ I++    +K G+ Y     N  Q      ALAK++YN +F W+V RVN +L         IG+LDI GFEIF  N FEQICINY NE+LQQ F       EQE Y++E I W  I +  D +   +LIE   P GIL+ + +          A+D  F  +L  N    +P F              F + HYAG V Y++ G  +KNKD L + +I L+  +    +S++F   +D +   KR+   A   I     +S N+L++ L    P +IR I PN+ K P   D H VLHQ+   G+ E +RI R GF  R  + +F +R+ +L+P+     +          LEAV+L   D  +    ++LG T VF K   +L  LEDMRD+   ++ +  Q   R +L RR    ++        IQR IR      KY+ LR +
Sbjct:   13 VKEPKKRSAKIKKATFD-ANKKKEVGISDLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPFRDLGIYTNAVLESYKGKNRLEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQY---IAAASNSHSESI-------GKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLLEKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIYT-AAAGCTTADTIDDVKDYEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISFIEN-EEGNAQVGDTSVTDFVAYLLQVDASLLVKCLVERIMQTSHGMKRGSVYHVP-LNPVQATAVRDALAKAIYNNLFDWIVDRVNVSLQAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQETYEREKIKWTPIKY-FDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFAQRL--NLFNSNPYFELRAN--------KFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFLSTIF--PDDVDKDSKRRPPTAGDKII----KSANELVETLSKAEPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPDC---SYAGDYTWDGDTLEAVKLILRDAMIPEKEFQLGVTSVFIKTPESLFALEDMRDKYWYNMAARIQRAWRRFLQRRIDAAIK--------IQRTIREKKGGNKYVKLRDY 762          
BLAST of Myosin heavy chain vs. Ensembl Yeast
Match: MYO5 (One of two type I myosin motors; contains proline-rich tail homology 2 (TH2) and SH3 domains; MYO5 deletion has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO5 has a paralog, MYO3, that arose from the whole genome duplication [Source:SGD;Acc:S000004715])

HSP 1 Score: 408.297 bits (1048), Expect = 2.266e-119
Identity = 257/750 (34.27%), Postives = 408/750 (54.40%), Query Frame = 3
Query:  327 IEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLIS-PDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQ------NKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIE--KPMGILSILEEECMFP----KASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNL----YRLGNTKVFFKAG-TLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRK 2522
            + D+  L+ ++D ++ +NL++R+    IYTY G   +++NP++   IYT  V+++YKGK R E+PPH+F+I+++ Y NM +  +NQ V+I+GESGAGKTE  K+++ Y A  A++T  E           G ++D ++  NP+LE++G AKT+RNNNSSR GK++ I F    +    +I  YLLEK RV SQ K ERN+HIFYQ        + +   +  P+  +Y+    G ++ + +DD ++ + T +A  ++G   EE+  +F+   +IL +G + F +   E  A+   T+  + VA+LL ++++ L++S+++ ++   N  + +G       N  Q      ALAK++YN +F W+V RVNK+L      +  IG+LDI GFEIF  N FEQICINY NE+LQQ F       EQE Y++E I W  I +  D +   +LIE  +P GI + + +          A+D  F  +L  N    +P+F              F + HYAG V Y++ G  +KNKD L + ++ L+  +    ++++F    D     KR+   A   I     +S N L++ L    P +IR I PNE K P   D   VLHQ+   G+ E +RI R GF  R ++ +F +R+ +L+P+    G    +  T   ++ +  D+++    Y+LG T VF K   TL  LE MRD    ++ +  Q   R +L RR          A + IQR IR+
Sbjct:   38 VSDLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPFRDLGIYTDAVMNEYKGKNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIA-AASSTHTES---------IGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITNYLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYT-AAAGCISAETIDDLQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIEN-EEGNAQVRDTSVTDFVAYLLQIDSQLLIKSLVE-RIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVSRVNKSLQAFPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQETYEREKIQWTPIKY-FDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRL--NLFTTNPHFDLRSNK--------FVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLATIFPDTVD--RESKRRPPTAGDKII----KSANDLVETLSKAQPSYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSPHCSYAGDYTWQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDRYWHNMAARIQRAWRRFLQRRI--------DAATKIQRTIRE 749          
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Match: MYHC-ST (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUG0])

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 315/525 (60.00%), Postives = 389/525 (74.10%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKK--EEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLI-SPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELI 1649
             +P+DP    L +D+  +M Q    F+SKK  WIPD KE + AA ++   GD + V+T+  +   + K++ EQMNPPK+   EDM+NLT+LN+ASV+ NL+QRY+  LIYTYSGLFCV INPY+R PIYT +++  Y+GKR+TE PPH+F I DNAY NML DR+NQS+LITGESGAGKTENTKKVI Y AHV+    K  EE    TG    G+LEDQ++Q NP+LEAYGNAKT+RNNNSSRFGKFIR HFG  GK+AGADIE YLLEKSRV  QQ+ ERNYHIFYQIL    K  H++LL+ S   A Y++  +G    DG+DD EE   T+ A D LGFSAEEK+S++K   + L+ G  KFKQRPREEQAE     + +K +FL+ +   D +++I+KP++KVG EYV +G+N  QV YS+GAL KSLY RMF WLV R N+TL TK +R FFIGVLDIAGFEIF FN FEQ+CIN TNE+LQQFFNHHMF+LEQEEYK+E I WEFIDFG DL+  I LI
Sbjct:    3 FDPNDP-LAILRIDKSQIMAQ-AKEFESKKWVWIPDPKEGYKAAEVKSTKGDNFLVETNDGQEVEINKNDTEQMNPPKYEKTEDMSNLTYLNEASVVHNLKQRYFSGLIYTYSGLFCVAINPYRRLPIYTDKIVFAYRGKRKTEAPPHVFCICDNAYQNMLQDRENQSMLITGESGAGKTENTKKVIQYLAHVSGGISKADEEHKKQTG----GSLEDQVIQTNPILEAYGNAKTIRNNNSSRFGKFIRCHFGPQGKLAGADIESYLLEKSRVIYQQEIERNYHIFYQILYGAPKDLHDQLLLESNKTADYAYTAKGCERADGIDDVEEWANTELAADTLGFSAEEKLSMYKICAACLHWGNSKFKQRPREEQAEVADPKDLDKTSFLMKLPGADFVKNIVKPRIKVGREYVNQGRNLQQVNYSIGALTKSLYERMFLWLVDRANQTLMTKDRRAFFIGVLDIAGFEIFQFNSFEQLCINVTNEKLQQFFNHHMFILEQEEYKREGIHWEFIDFGHDLEPTINLI 521          
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Match: EDO41819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3A8])

HSP 1 Score: 523.857 bits (1348), Expect = 2.229e-159
Identity = 291/798 (36.47%), Postives = 456/798 (57.14%), Query Frame = 3
Query:  180 WIPDEKEAFIAATI-EDASGDVYTVKTDKSETKTV--KKDEIEQMNPPKFLMIE-DMANLTFLNDASVLDNLRQRYYK-NLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGEL-TIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGA------------MQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIR 2519
            WIP     +I   + +D    +  +  +      +  +K  +  +  P+ L+ E D+  L++L++ +VL NL  R+ + N IYTY G+  V INPY+  P+Y P +++ Y+G+   +M PHIF+++++A+ +M+ D  NQSV+++GESGAGKT + K  + YF+ V  A+ + +            +E +++  NP++EA GNAKT+RN+NSSRFGK++ I F  +  I GA +  YLLEKSRV  Q   ERNYH+FYQ+ +    P  +   ++  P  +S++NQG+   +D +DD +  +   EA  ++G + +E++ LF+   +IL++G ++  Q   +E    +     E  A LLG++   L + +   K+    E + K  +  +  Y   A++K +Y+++F W+V  +N TL +  K   FIGVLDI GFE F  N FEQ CINY NE+LQQ F  H+F LEQ+EY +E I W FI+F  D Q CI+LIE  +GIL +L+EEC  PK SD  +  KLY  HL KS +F KP+          F +HH+A  V Y V+G++EKN+D +N+  + LL AS++ +V  +F   E+  ++  RK+  +             +++ S    SL+KLM+ L ST+PH++RCI PN+ K P        + QL   GVLE IRI   G+P+R  Y EF  RY +L P+       + ++    ILE    D +++++G TK+FF+AG +A LE +R +KL     + Q   R Y   R++K     R A  +IQ  +R
Sbjct:    4 WIPHPDLVWIGGELTKDIEDKILEILLEDGREIIIDTRKSRLPPLRNPEILVGENDLTTLSYLHEPAVLHNLNVRFIQSNAIYTYCGIVLVAINPYEELPLYGPDIVAAYRGRSMGDMDPHIFAVAEDAFQSMIRDERNQSVIVSGESGAGKTVSAKYAMRYFSAVGGASTETQ------------IEKKVIATNPIMEAIGNAKTIRNDNSSRFGKYLEISFDRNHHIIGAHMRTYLLEKSRVVFQAAEERNYHVFYQMCAACELPEMKDFRLA-HPDNFSYLNQGDAPVVDSIDDADCFEELREALSMVGINDDEQLMLFRILSAILHLGNVEILQAGDDECTVEENDFHLEMTAVLLGIDKNQLRKWLCNRKIVTVGEVLIKPLSITEANYGREAISKRIYSQLFKWVVNTINCTLTSTSKPHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFTQHVFKLEQDEYVREEIQWSFINF-YDNQPCIDLIEAKLGILDLLDEECKMPKGSDSQWAQKLYKQHLQKSKHFSKPRMSNLA-----FVIHHFADHVEYFVSGFVEKNRDTVNDEHLALLRASEDEMVGEMF--TENDAHSAPRKRAASRAGKQGGKGGKMFKSVGSQFSVSLSKLMETLNSTTPHYVRCIKPNDTKAPFEFHPKRSIQQLRACGVLETIRISAAGYPSRWTYREFFARYIMLLPSK-KINRKKPRETIKLILETFIKDEDMFQMGKTKIFFRAGQVAYLEKLRGDKLRRSCVMIQKNYRCY---REHKLYLRMRKAAILIQAWVR 776          
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Match: EDO49515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF6])

HSP 1 Score: 472.626 bits (1215), Expect = 1.657e-142
Identity = 277/747 (37.08%), Postives = 424/747 (56.76%), Query Frame = 3
Query:  327 IEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGE-LTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEA--------EKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVK-RQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEK-PMGILSILEEECMFP-KASDMTFKAKL---YDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFK-AGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIR 2519
            + DM  L  L + ++++NL  RY    IYTY G   V+INPY++FP+YT +VI++Y+ +   E+PPHI++I+D+AY +M     +Q ++ITGESG+GKTE +K ++ Y A  A   K  E D          +++Q++Q+NP+LEA+GNAKT+RN+NSSRFGK++ I F   G   G  I  YLLEKSR+  Q KGERN+HIFY +L        + L ++ D   Y ++NQ E +++   DD+E+  + ++A +++GF+ +E  +++K   +ILN+G  +      EE   +DGT           +    +L  + + L+ S+ +  V+   E V    N  Q  Y+  ALAK++Y R+FAW+V RVN ++  + + ++  IGVLDI GFEIF  N FEQ  INY NE+LQQ F       EQEEY +E I+W  I++  +   C ELIEK   GIL++L+EEC+ P + SD+TF  KL   + +H        K           +F L HYAG V Y+V G+L+KN D L   +   + +    L   LF P   P  + KR+     +T ++  +ES+ +LMKNL+S +P++IRCI PNE K  GV D  L+ HQ+   G++E IR+ R GF  R  Y    QRY +L P   P      +    ++L+ + +    Y  G TK+F +   TL  LE+ R + +  L  + Q   RG+  ++QY+ ++   + ++   R  R
Sbjct:   23 VSDMVLLEPLTEDAIMENLWDRYNAKAIYTYIGNVVVSINPYRKFPLYTREVIAEYRSRNIYELPPHIYAIADDAYRSMRDHNKDQCIIITGESGSGKTEASKVIMQYVA--AVCGKGREVD---------RVKEQLLQSNPILEAFGNAKTLRNDNSSRFGKYMDIEFDFKGDPVGGVITKYLLEKSRLVYQNKGERNFHIFYHLLRGASDNLLDDLRLTRDFDGYHYLNQSECVSVPTKDDKEDFSVVEKAMEVVGFTEDEISAVYKLLSAILNLGNTEL-----EEFTTSDGTEAVTVLNEQVLKNTCEMLQCDVELLLNSLRERTVETKTERVHTPLNVAQASYARDALAKAVYQRLFAWIVDRVNDSIQVRKRGKRKVIGVLDIYGFEIFVDNSFEQFIINYCNEKLQQIFIELTLKSEQEEYVREGIEWTTIEYFNNAVIC-ELIEKNHSGILALLDEECLRPGEVSDLTFLEKLDKQWIHHEHYESRKDKKYLSDKTLPHGYFRLKHYAGKVTYDVDGFLDKNNDLLFRGLSQCMYSCNHPLTKKLF-PEGCPTKSSKRRP----KTTATQFKESVAELMKNLKSKNPNYIRCIKPNERKAAGVFDERLIKHQVRYLGLMENIRVRRAGFAFRQEYPVALQRYKMLCPRTWPNWLGAPRDGIVELLKHLNVKPTEYAYGRTKIFIRNPRTLFALEEKRKDGMEDLAVIIQKIFRGWRRKKQYQNMRRSEITIAKYYRRFR 747          
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Match: EDO45563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSH2])

HSP 1 Score: 445.662 bits (1145), Expect = 4.777e-136
Identity = 268/761 (35.22%), Postives = 422/761 (55.45%), Query Frame = 3
Query:  192 EKEAFIAATIEDASGDVYTVKTDKSETKTVKK---DEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKY-KGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGE-LTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAF---LLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTL------DTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELI-EKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQ 2429
            E +  I A +++  G    +  D+ +   + +   + ++ M+P     +E+M  L  L++A +L NL  RY  N IYTY G   V +NPY  FPIY    IS+Y K    T++PPHI++  + ++  M  ++ NQ V+I+GESGAGKTE+TK ++ Y   V+               R  T+E+QI+ ANP+LEA+GNAKT+RN+NSSRFGK+I +HF  S  I GA I+ YLLE+SR+ +Q   ERNYHIFY++L+ G  P  +K L       Y +++QG  LT +G+DD  E  +  +A   L F+ EE   +F+   ++L++G + F+ +  E+  EA      E VA    LL V  + + ++  +       E +    + ++      A  K LY+++F W+V ++N ++      D    RQ  IGVLDI GFE F+ N FEQ+CINY NE LQQFF   +F  EQEEY +E I+W F+ F +D Q  ++++ EKPM  +++++EE  FP+ +D +F  KL  NH   + +F         + ++ F + H+AG+V Y+ TG+L+KN++  +  +++L+++SK     ++F   E    T  RK+     T+    R SL+ LMK L S    F+RC+ PN +K+P   D  L   QL  +G+LE +RI + G+  R  + EF  RY +L  +++        +  S ++    L    ++LG  ++F K      LE+ R + LSS I   Q
Sbjct:   18 ENDVAIGACVKEVQGASVILVDDEGKEVVIDRSVAESLKHMHPSSVEGVENMIELGDLDEAGILRNLLIRYRANKIYTYVGSVLVAVNPYCSFPIYGTAYISRYQKAVNATDLPPHIYATGEMSFAMMKREKHNQCVVISGESGAGKTESTKFILQYLTAVSG--------------RHSTIEEQILDANPILEAFGNAKTIRNDNSSRFGKYIDVHFNDSWVIEGAKIDHYLLEQSRIVAQMPNERNYHIFYRMLA-GMSPQEKKSLHLTHAQDYYYLSQGNCLTCEGMDDAYEYDVIRKAMTALWFTEEETQFIFRSIAAVLHLGNISFEAK-MEDNIEACDVMNPETVAAAADLLQVPKEHMEEAFTRKSTFAEGEMIYSPVSVERATDIRDAFVKGLYSKVFIWIVNKINSSIYKPRGKDDTSGRQ-SIGVLDIFGFEKFDMNSFEQLCINYANENLQQFFVAQIFKNEQEEYDREGIEWNFVTF-VDNQEVLDMLAEKPMNFIALIDEESRFPQGTDESFLDKLNYNH-KDNKHF----VRPKSRVQSQFGVVHFAGTVYYDTTGFLDKNRNTFSADLVDLISSSKCNFFLNMFFK-ERSMGTETRKRS---PTLGVQFRRSLDVLMKTLASCRSFFVRCVKPNNYKKPMEFDRELCWQQLRYSGMLETVRIRKSGYAMRHTFEEFVTRYHMLVRDSLRD---MSSRDASHLIATSLLGQENWKLGTKRIFLKESQDVLLEESRAQLLSSKIIFLQ 748          
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Match: EDO35007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMP8])

HSP 1 Score: 426.787 bits (1096), Expect = 2.412e-130
Identity = 263/734 (35.83%), Postives = 404/734 (55.04%), Query Frame = 3
Query:  327 IEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTE--MPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPA-LYSFINQ-GELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKV---GNEYVTKGQ-NKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIE--KPMGILSILEEECMFPKASDMTFKAKLYD---NHLGKSPNFGXXXXXXXGQAEA-HFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLAD-LEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQ 2483
            + DM  +  +++AS+ +NL+ R  +  IYT  G   +++NP+K+  IY    +  Y GK+  E   PPH++ +++N + NML + D+Q V+I+GESGAGKT + K V+ + + V           G G      ++D I+Q+NP+LEA+GNAKTV NNNSSRFGKF+ I +  SG+  G  I  +LLEKSRV SQ +GERNYHIFYQ+LS        +L I   PA  Y ++NQ G  TI+G DD  +   T  A +++G ++  + ++ K   ++L++G ++F +   + QA     +  +  + LL V+   L+  +    ++    G   VTK   NKDQ + +  ALAK+++ ++F +LV  VN T+ T+  + F+IGVLDI GFE F  NGFEQ  INY NE+LQ  F      +EQEEY +E I W  ID+  +    ++LIE  +P GI+ +L++ C    A        L D     +G + +F K       QA+A HF + HYAG V Y   G+ EKNKD L+  ++ L+ +S E  V  +F  +    + G   +     T SS  R   + L+  ++  +PH++RC+ P E K P   D   VLHQ+   G+ E I++ R GF  R  +    +RYS+L P  + +   +       IL A  LD   Y++G TK+F K   + + LE+ R+  ++      Q   RGY  R+ YK+L+ +
Sbjct:    5 VSDMIEIPDVSEASIANNLKIRLKQEEIYTNIGRVLISVNPFKKINIYGMDAVELYSGKKHNEGAKPPHLYEVANNMFENMLIEGDSQCVIISGESGAGKTVSAKHVMGFLSKVC----------GEGSTEVERVKDIIMQSNPLLEAFGNAKTVMNNNSSRFGKFMEIQYSRSGQPNGGKISTFLLEKSRVVSQGQGERNYHIFYQLLSGCTPDEMSELEIDLGPAESYKYLNQTGVYTIEGTDDVSDYAATINAMEVIGIASSTRNTVLKLVATVLHLGNIQFTEE--DNQAVPVDVSMLDAPSRLLSVDKDILLDKLTSYSMETRWGGKVEVTKKTLNKDQAVIARDALAKAIFFQLFEYLVEAVNSTMATR-DQDFYIGVLDIYGFESFKVNGFEQFSINYVNEKLQNLFIDFTLKMEQEEYAEEGISWSDIDY-FNNDVVLQLIESRRPPGIMGVLDDVCSTLHAVSEGSANTLMDKLRGVIGSNSSFAKYF-----QAQARHFAITHYAGKVSYESEGFCEKNKDTLSNDLVCLMQSSTEPFVRDMFPDSLYGASAGVGGRKAKSNTGSSKIRTQAHALVSKIRMCTPHYVRCVKPTESKIPLDWDDKKVLHQVRYLGLAENIKVRRAGFAFRREFPRIVERYSLLDPITVRKHQSDPVAACKAILLAGNLDMTKYQVGKTKLFLKEPQMINQLEEARNAIITKYALTIQTVYRGYRARKIYKRLKKE 719          
BLAST of Myosin heavy chain vs. Ensembl Medaka
Match: vmhc (ventricular myosin heavy chain [Source:NCBI gene;Acc:100415781])

HSP 1 Score: 1764.59 bits (4569), Expect = 0.000e+0
Identity = 1037/1927 (53.81%), Postives = 1412/1927 (73.27%), Query Frame = 3
Query:  111 YLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPN---------NTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARG 5861
            YL    K  M+     FD KK C++PD  E F+  TI    GD  TV+T   +T TVK  +I Q NPPKF  IEDMA LTFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V+  Y+GK+R+E PPHIFSISD+AY  ML+DR+NQS+LITGESGAGKT NTK+VI YFA +AA + K+  DT    K KGTLEDQI+QANP LEA+GNAKT+RN+NSSRFGKFIRIHF T GK+A ADIE YLLEKSRV  Q K ER+YHIFYQILSN      E LLI+ +P  Y FI+QGE  +  +DD EE+  TD AFD+LGF+ EEK S++K T +I++ G MKFKQRPREEQAEADGT +A+K A+L+G+N+ DL++ +  P+VKVGNE+VTKGQ+ +QV Y++GAL+K++Y +MF W+V+R+N++L+TK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+  WL KNKDPLNETV+ L   S   L++ LFA     +            K+KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K PG ++  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P AIP+G F++ ++   K+L ++ +D + Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QA+ RG L R +Y+K+ ++R AL +IQ NIR ++ ++ WPW KL+ K+KPLL  A  E+EM    EE  KLKE + K +  +KELEE+ V LL+ KNDL LQ+Q EQD+L DAEE+   L+  K  +E + KEL + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  ++ + KL KEKKA  E  ++T + L +EE+KV  L K KAKLEQ +D++E +L +E+KIR D+E+ KRK+E +LK  QE+V DLE  K++LEE+LK+K+ E+   +SKIEDE  ++AQLQ+K+KELQAR++ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEE+ +QH+   A  RKKQ D V +  EQ+D LQ+VK K+EKEK+E+K +L+D+   +E + K+K   +K  + +E Q +E + K +E  R +ND      K Q  N EL  ++EE ES I+QL + K     QLE+ ++  EEE +AK  L+  V++   D D LRE  EEE E K+++QR + KA  E+ Q + K+E     R+EEL+EAK+K   R+ E EE  E   +K   LEK K RLQ EIED++VDV+R+N +A+ L+KKQ+ FD+V++EW+QKY ESQ ELE+SQ+E+R++S E+F++K   EE+ E LE++KRENKNL +EI DLTEQ+GEGG+++HE++K RK+LE EK E+Q ALEEAE +LE EE+K  R+QLE +QI+ E++R+L+EK+EE E ++ N QR ++++++SLEAE R R EA ++KKK+E D+ E+E+ +  ANR  +E +K  K     +++    +++     D +RE   + ER+ T++ AELEE+R +LE +ER+RK  E E +++++R+  L  Q++G +  K+KLE+D   +Q+++E+A  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE RVRELE E++ EQK+  E+ K  RK ERR+KEL  QT+ED+KN  RLQDL++KLQ K+K YKR  EEAEE A V+L+K+RK+Q E++++EERAD AE  + KLR K+R  V + +G
Sbjct:   15 YLRKSDKERMEASTRLFDIKKECFVPDPVEEFVKGTITSRDGDKVTVETQNGKTVTVKDSDILQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVLAYRGKKRSEAPPHIFSISDSAYQYMLSDRENQSILITGESGAGKTVNTKRVIQYFASIAAGSNKK--DTA---KDKGTLEDQIIQANPALEAFGNAKTIRNDNSSRFGKFIRIHFDTRGKVASADIETYLLEKSRVVCQLKAERDYHIFYQILSNKKPELLEMLLITNNPYDYFFISQGETQVPSIDDAEELMATDSAFDVLGFTQEEKNSVYKLTGAIMHYGNMKFKQRPREEQAEADGTEDADKAAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQSVNQVNYAIGALSKAVYEKMFLWMVIRINQSLETKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKSNNF-QKPRVVKGKPEAHFSLVHYAGTVDYNINNWLVKNKDPLNETVVGLYQKSTLKLLAILFANYAGADLVLGEASEGKKEKKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDVDHSQYKFGHTKVFFKAGLLGLLEEMRDERLSKIITAIQARSRGLLSRIEYQKMVERRDALLVIQWNIRSFMGVKNWPWMKLFFKIKPLLRSAEAEKEMANMKEEFLKLKEAYAKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLCDAEERCEGLIKNKIQLEAKAKELSERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKLKAKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLAQESVMDLENDKQQLEERLKKKDFEISQLNSKIEDEQSIIAQLQKKLKELQARVEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATAATLRKKQADSVADLGEQIDNLQRVKQKLEKEKSELKLELDDVVSNMEHIVKSKTFLEKTCRTLEDQMNEYRNKCDEYQRSLNDFTTQKAKLQAENDELSRQMEEKESLISQLTRGKNSYNQQLEDLKRQLEEEIKAKNALAHAVQSARHDCDLLREQYEEEQEAKAELQRSMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAVAATLDKKQRNFDRVLAEWKQKYEESQCELESSQKEARSLSTELFKLKNSYEEALEHLETLKRENKNLQEEISDLTEQLGEGGKTLHELEKVRKQLEQEKSEIQSALEEAEGSLEHEESKILRTQLEFNQIKAEMERKLSEKDEEMEQSKRNMQRTIDTLQSSLEAECRSRNEALRIKKKMEGDLNEMEIQLSQANRQAAEAQKQLKSIHAHLKDCQIQLDESSKGNDDLRENMAIVERRNTLLQAELEELRAALEQTERSRKLAEQELLDVSERVQLLHSQNTGLINQKKKLESDTVQLQTEVEDAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELENEVELEQKKSSETVKGIRKYERRIKELTYQTEEDRKNIARLQDLIDKLQLKVKAYKRAAEEAEEQANVHLSKFRKLQHELDEAEERADIAESQVNKLRVKSR-DVGSKKG 1934          
BLAST of Myosin heavy chain vs. Ensembl Medaka
Match: myh6 (myosin, heavy chain 6, cardiac muscle, alpha [Source:ZFIN;Acc:ZDB-GENE-031112-1])

HSP 1 Score: 1761.12 bits (4560), Expect = 0.000e+0
Identity = 1041/1911 (54.47%), Postives = 1400/1911 (73.26%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQK--RKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTG-----------KRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVS 5849
            FD K  C++ D+K  F+   I+   G + TVK +   T TVK+ ++   NPPKF  IEDMA  TFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y   V++ Y+GK+R+E PPHIFSISDNAY  ML DR+NQSVLITGESGAGKT NTK+VI YFA +AA         G G+K   KGTLEDQI+QANP LEA+GNAKT RN+NSSRFGKFIRIHFGTSGK++ ADIE YLLEKSRV  Q K ERNYHIFYQILSN      + LLI+ +P  YS+I+QGE+T+  ++D EE+  TD AFD+LGF+ EEKM ++K T +I++ G MKFKQ+ REEQAE DGT  A+K A+L+G+N+ DL++ +  P+VKVGNEYVTKGQ  DQV Y++GALAKS+Y +MF W+V+R+N++LDTK  RQ+FIGVLDIAGFEIF+FN FEQ+CINYTNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGILSILEEECMFPKASD TFKAKLYDNHLGK+  F +      G+AEAHF L HYAG+V YN++GWL KNKDPLNETV+ L   S   L+S LF+     N +G            +KKG + QT+S+ HRE+LNKLM NL++T PHF+RC++PNE K PGV+D  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL  +AIP+G F++ K+   K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRDE+LS +I+  QA  R  LMR Q+ KL ++R AL +IQ N+R +L ++ WPW KL+ K+KPLL  A  E+EM    +E  KLKE  EK +  +KELEE+ V LL+ KNDL LQ+Q+EQD+L DAEE+  +L+  K  +E ++KE+ + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L +++A Q+E + KL KEKKA  E  ++T + L +EE+K  +L KAKAKLEQ +D++E +L +E+K+R D+E+ KRK+E +LK TQE + DLE  K++LEE+LK+K+ E+   +SK+EDE     QLQ+K+KE QA+I+ELEE+L+AER ARAK EK R +L  ELE++S+RLEE GGATSAQ++LNKKR+AE  KL+R+ EES +QH+   A  RKK  D V E  E +D LQ+VK K+EKEKNE+K +L+DL   +ES+ K+KAN +K  + +E   +E + K EEA R IND      +    N E   +LEE ES I+QL + K     Q+E+ R+  EEE +AK  L+  V++   D D LRE  EEE E K+++QR L K+  E+   + K+E  G  R+EEL+EAK+K + R+ E EE  E   +K   LEK K RLQ EIED+++D++R+N  ++ L+KKQ+TFDKV++EW+QK+ ESQ+ELEASQ+ESR++S E+F++K   EES +QLE++KRENKNL +EI DLT+Q+GEGGRS HE++K RK+LE EK ELQ ALEEAE +LE EE+K  R+QLE +Q++ EI+R+LAEK+EE E  + N+QR +ES+++SL++E+R R EA ++KKK+E D+ E+E+ ++ ANR  ++ +K  K  Q  +++    ++D +H  D +RE  T+ ER+  ++ +ELEE+R +LE +ER+RK  E E  + T+R+  L  Q++  +  K+K EADL  +Q+++EE   E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE R+RELE ELD EQKR  ES K  RK ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K+YK   +EAEE A  N+AK RK+Q E+E++EERAD AE  + KLR K R   S
Sbjct:   31 FDIKTECFVVDDKVEFMKGQIQSKDGGMVTVKKEDGNTVTVKESDVHPQNPPKFDKIEDMAMFTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYDYDVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSVLITGESGAGKTVNTKRVIQYFASIAAVG-------GAGKKDSSKGTLEDQIIQANPALEAFGNAKTARNDNSSRFGKFIRIHFGTSGKLSSADIETYLLEKSRVTFQLKAERNYHIFYQILSNQKPELLDLLLITNNPYDYSYISQGEVTVASINDSEELMATDSAFDVLGFTQEEKMGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEAADKSAYLMGLNSADLIKGLCHPRVKVGNEYVTKGQGVDQVYYAIGALAKSVYEKMFNWMVVRINQSLDTKQDRQYFIGVLDIAGFEIFDFNTFEQLCINYTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGILSILEEECMFPKASDQTFKAKLYDNHLGKNKMF-EKPRAAKGKAEAHFALVHYAGTVDYNISGWLVKNKDPLNETVVGLYQKSSLKLLSVLFS-----NYSGTDGGDKGGSKGAKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCLIPNEKKIPGVMDNCLVMHQLRCNGVLEGIRICRKGFPNRVLYGDFKQRYRILNASAIPEGQFIDCKKSAEKLLGSLSIDHTQYKFGHTKVFFKAGLLGTLEEMRDEQLSRIITRIQANARRLLMREQFVKLVERRDALMVIQWNLRSFLGVKNWPWMKLFFKIKPLLKSAESEKEMANMKDEFNKLKEAMEKSETRRKELEEKIVTLLQEKNDLTLQIQSEQDTLTDAEERCEQLIKSKIQLEAKLKEMNERLEDEEELNADLTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLVEEIASQDENILKLTKEKKALQEAHQQTLDDLQSEEDKANSLTKAKAKLEQQVDDLEGSLEQEKKVRMDLERSKRKLEGDLKLTQENMMDLENDKQQLEEKLKKKDFEISQVNSKLEDEQTNSVQLQKKLKESQAKIEELEEELDAERAARAKVEKQRSELSRELEDISERLEEVGGATSAQVELNKKRDAEFQKLRREFEESTLQHEATAAALRKKHADSVAELGEHIDNLQRVKQKLEKEKNELKLELDDLSSSMESVVKSKANIEKMCRTLEDNMNEYKCKFEEAQRTINDLTTQRARLLTENGEFGRQLEEKESLISQLTRGKNSYNQQVEDLRRQLEEEVKAKNALAHAVQSARHDCDLLREQFEEEQEAKAELQRALSKSNTEVAAWRTKYETDGIQRTEELEEAKKKLVQRLQEAEEAIEAVNAKCSSLEKTKHRLQNEIEDLMLDLERSNAASAALDKKQRTFDKVLAEWKQKFEESQSELEASQKESRSLSTELFKLKNAFEESLDQLETIKRENKNLQEEISDLTDQLGEGGRSAHELEKIRKQLEQEKNELQSALEEAEGSLEHEESKILRAQLEFNQVKAEIERKLAEKDEEMEQAKRNYQRMLESLQSSLDSETRSRNEALRVKKKMEGDLNEMEIQLNQANRQAADAQKQVKTLQGFLKDAQLQLDDTQHSNDDLRENITLLERRNNLIQSELEELRAALEQTERSRKLAEQELTDATERIQLLHSQNTSLINQKKKHEADLLNLQNEIEEIIQEHRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARIRELENELDAEQKRGTESIKGVRKYERRIKELTYQTEEDRKNLARLQDLVDKLQLKVKSYKHAADEAEEAANANMAKVRKLQHELEEAEERADIAEAQVNKLRAKTRDGSS 1928          
BLAST of Myosin heavy chain vs. Ensembl Medaka
Match: ENSORLT00000016518.2 (myosin-7 [Source:NCBI gene;Acc:101164097])

HSP 1 Score: 1750.33 bits (4532), Expect = 0.000e+0
Identity = 1020/1895 (53.83%), Postives = 1404/1895 (74.09%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAP-AEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            FD KK C++PD +  ++ AT+    GD  T +T+  +T TVK+ ++   NPPKF  IEDMA  TFL++ +VL NL++RY   +IYTYSGLFCVT+NPYK  P+Y  +V+  Y+GK+R+E PPHIFSISDNAY  ML+DR+NQS+LITGESGAGKT NTK+VI YFA +AAA   ++D      ++KGTLEDQI+Q NP LEA+GNAKT+RN+NSSRFGKFIRIHF   GK+A ADIE YLLEKSRV  Q K ER+YHIFYQILS       E LLI+ +P  Y+FI+QGE T+  ++D EE+  TD+AFD+LGF+ EEK S++K + +I++ G MKFKQ+ REEQAEADGT +A+K A+L+G+N+ DL++ +  P+VKVGNE+VTKGQN +QV Y+VGAL+K++Y +MF W+V+R+N++LDTK  RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD TFKAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YN+  WL KNKDPLNETV+ L   S   L+++LFA  A   +  G +KKG + QT+S+ HRE+LNKLM NL+ST PHF+RCI+PNE K PG ++  LV+HQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P++IP+G F++ K+ + K+L ++ +D N Y+LG+TKVFFKAG L  LE+MRD++L+ +I+  QA+ RG L R +++K+ ++R AL +IQ NIR ++ ++ WPW KLY K+KPLL  A  E+EM    EE  KLKE + K +  +KELEE+ V LL+ KNDL LQ+Q EQD+L DAEE+   L+  K  +E +IKEL + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA  ++ + KL KEKKA  E  ++T + L +EE+KV  L KAKAKLEQ +D++E +L +E+KIR D+E+ KRK+E +LK  QE+V DLE  K++LEE+LK+K+ E+   + KIEDE  + AQLQ+K+KELQARI+ELEE+LEAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEE+ + H+   A  RKKQ D V +  EQ+D LQ+VK K+EKEK+E+K +L+D+   +E + K+K N +K  + +E Q +E + K EE  R IND      K Q  N E Q +LEE +S ++QL + KQ    Q+++ ++  EEE +AK  L+  V++   D D LRE  EEE E K+++QR + KA  E+ Q + K+E     R+EEL+EAK+K   R+ E EE  E   +K   LEK K RLQ EIED++VDV+R+N  A+ L+KKQ+ FDKV++EW+QKY ESQ+ELE+SQ+E+R++S E+F++K   EE+ E LE++KRENKNL +EI DLTEQIGEGG+S+HE++K RK+LE EK E+Q ALEEAE +LE EE K  R QLE +QI+ +++R++AEK+EE E  + N QR ++++++SLEAE+R R EA ++KKK+E D+ E+E+ +  ANR  +E +K  K     +++    +++     D ++E   + ER+  ++ AELEE+R +LE +ER+RK  E E +++++R+  L  Q++G +  K+KLE+D   +Q+++E+A  E R A E+AKKA+ D+A + +E+++EQ+ +  ++++KK +E   K+LQ +LDE+E  A+KGGKK + KLE RVRELE E++ EQ++  ++ K  +K ERR+KEL  QT+ED+KN  RLQDLV+KLQ K+K+YK+  EE+EE A  NL K+RK+Q E++++EERAD AE  + KLR K+R
Sbjct:   31 FDMKKECFVPDPEVEYVKATVTSRDGDKVTAETEFGKTVTVKECDVHPQNPPKFDKIEDMAMFTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVVAYRGKKRSEAPPHIFSISDNAYQYMLSDRENQSILITGESGAGKTVNTKRVIQYFASIAAAPGLKKD---AAAEKKGTLEDQIIQCNPALEAFGNAKTIRNDNSSRFGKFIRIHFDNRGKLASADIETYLLEKSRVTYQLKAERDYHIFYQILSQAKPELLEMLLITNNPYDYAFISQGETTVASINDAEELMATDDAFDVLGFTQEEKNSIYKLSGAIMHFGNMKFKQKQREEQAEADGTEDADKAAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVNQVYYAVGALSKAVYEKMFLWMVIRINQSLDTKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKSSNF-QKPRNVKGKPEAHFSLVHYAGTVDYNINNWLVKNKDPLNETVVGLYQKSTMKLLANLFANYAGADSGGGSKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPSSIPEGQFIDNKKASEKLLGSLDIDHNQYKLGHTKVFFKAGLLGLLEEMRDDRLALIITRIQARSRGVLARIEFQKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMANMKEEFAKLKEAYAKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLGDAEERCEGLIKSKIQLEAKIKELTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLAQESVMDLENDKQQLEERLKKKDFEISQLNGKIEDEQAMCAQLQKKLKELQARIEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLHHESTTASLRKKQADSVADLGEQIDNLQRVKQKLEKEKSELKLELDDVVSNMEQIVKSKNNLEKMCRSLEDQMNEYKTKSEEGQRTINDFTMQKAKLQTENGEFQRQLEEKDSLVSQLTRGKQSYTQQIDDLKRQLEEEVKAKNALAHAVQSARHDCDLLREQYEEEQEAKAELQRSMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKVLAEWKQKYEESQSELESSQKEARSLSTELFKLKNSYEEALEHLETMKRENKNLQEEISDLTEQIGEGGKSIHELEKIRKQLEQEKSEIQTALEEAEASLEHEEGKILRVQLEFNQIKADMERKIAEKDEEMEQAKRNQQRVVDTLQSSLEAETRSRNEALRIKKKMEGDLNEMEIQLSQANRQAAEAQKQLKAVHAHLKDSQLQLDESLRANDDMKENIAIIERRNNLLQAELEELRAALEQTERSRKLAEQELLDVSERVQLLHSQNTGLINQKKKLESDTVQLQTEVEDAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELENEVESEQRKAGDAIKGVKKYERRIKELTYQTEEDRKNLSRLQDLVDKLQLKVKSYKKAAEESEEQANTNLTKFRKLQHELDEAEERADIAESQVNKLRAKSR 1921          
BLAST of Myosin heavy chain vs. Ensembl Medaka
Match: ENSORLT00000007991.2 (myosin heavy chain, fast skeletal muscle [Source:NCBI gene;Acc:100125431])

HSP 1 Score: 1742.24 bits (4511), Expect = 0.000e+0
Identity = 1019/1900 (53.63%), Postives = 1391/1900 (73.21%), Query Frame = 3
Query:  159 FDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKP-FHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDP-----NNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            FD+K   ++ D  E ++   +        TV+TD  +T TVK+D+I   NPPKF  IEDMA +T LN+  VL NL+ R+   +IYTYSGLFCV +NPYK  P+Y   V++ Y+GK+R E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +AA   K+E  +G   K +G+LEDQIV ANP+LEAYGNAKTVRN+NSSRFGKFIRIHFG+SGK+A ADIE YLLEKSRV  Q   ER+YHIFYQ+++ G KP   E LLI+ +P  Y  I+ GE+T+  ++D EE   TD A DILGF+ +EK++++K T ++++ G MKFKQ+ REEQAE DGT  A+K+A+L+G+N+ D+++++  P+VKVGNE VTKGQ   QV  SV AL KS+Y +MF W+VLR+N+ LDTK  RQFFIGVLDIAGFEIF++N  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDL ACIELIEKP+GI SILEEECMFPKASD TFK KL+D HLGKS  F +   P  G+AEAHF L HYAG+V YN+TGWL+KNKDPLN++V+ L   S   L++ L+A             G +KKGG+ QT+S+  RE+L KLM NL+ST PHF+RC++PNE K PG+++ HLV+HQL CNGVLEGIRICRKGFP+R++Y +FKQRY +L  + IP+G F++ K+ + K+L ++ +D   Y+ G+TKVFFKAG L  LE+MRDEKL+SL+++ QA  R Y+MR+++ K+  +R A+  IQ NIR ++ ++ WPW KLY K+KPLL  A  E+E+++  E   K+K +       KKELEE+ V LL+ KNDL LQ+ +E ++L+DAEE+   L+  K  +E ++KE  + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA Q+E + KL KEKKA  E  ++T + L AEE+KV  L KAK KLEQ +D++E +L +E+K+R D+E+ KRK+E +LK  QE++ DLE  K++ +E++K+K+ E+    SKIEDE  L AQLQ+KIKELQARI+ELEE++EAER ARAK EK R  L  ELEE+S+RLEE GGATSAQ+++NKKREAE  KL+RDLEES +QH+   A  RKKQ D V E  EQ+D LQ+VK K+EKEK+E K +++DL   +E++ K K N +K  + +E Q SEL+ K +E  R +NDAN    + Q  N E+  +LEE E+ ++QL + KQ    Q+EE ++  EEE +AK  L+  V++   D D LRE  EEE E K+++QR + KA  E+ Q + K+E     R+EEL+E+K+K   R+ E EE  E   SK   LEK K RLQGE+ED+++DV+RAN+LA+ L+KKQ+ FDKV++EW+QKY ESQAELE +Q+E+R++S E+F+MK   EE+ +QLE++KRENKNL  EI DLTEQ+GE G+S+HE++KA+K +E EK E+Q ALEEAE  LE EE+K  R QLE++Q++ EIDR+LAEK+EE E  + N QR +ESM+++L+AE R R +A ++KKK+E D+ E+E+ +  ANR  +E +K  +  Q Q+++    ++D    ++ ++EQ  M ER+  ++LAE+EE+R +LE +ER RK  E E ++I++R+  L  Q++  + TK+KLEADL  +Q ++EEA  EAR A E+AKKA+ D+A + +E+++EQ+ +  ++++KK LE   K+LQ +LDE+EN A+KGGKK L KLE RV ELEAE++ EQKR  E+ K  RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE A  +++++RK+Q E+E+++ERAD AE  + KLR K+R
Sbjct:   32 FDAKTAYFVVDPDELYVKCKLVKKEAGKATVETDGGKTVTVKEDDIHPRNPPKFDKIEDMAMMTHLNEPCVLYNLKDRFASWMIYTYSGLFCVVVNPYKWLPVYDSVVVAAYRGKKRIEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAALGGKKEQSSG---KMQGSLEDQIVAANPLLEAYGNAKTVRNDNSSRFGKFIRIHFGSSGKLASADIETYLLEKSRVTFQLSAERSYHIFYQLMT-GHKPELLEALLITTNPYDYPMISMGEITVKSINDVEEFIATDTAIDILGFTGDEKINIYKLTGAVMHHGNMKFKQKQREEQAEPDGTEVADKIAYLMGLNSADMLKAVCYPRVKVGNEMVTKGQTVPQVHNSVMALCKSVYEKMFLWMVLRINEMLDTKQPRQFFIGVLDIAGFEIFDYNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPLGIFSILEEECMFPKASDTTFKNKLHDQHLGKSKGF-EKPKPAKGKAEAHFALVHYAGTVDYNITGWLDKNKDPLNDSVVQLYQKSSNKLLTHLYAAHSSTEASGGAKKGGKKKGGSFQTVSALFRENLAKLMTNLKSTHPHFVRCLIPNETKTPGLMENHLVIHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYKVLNASVIPEGQFIDNKKASEKLLGSIDVDHTQYKFGHTKVFFKAGLLGQLEEMRDEKLASLVTMTQALCRAYVMRKEFVKMMKRREAIYSIQYNIRSFMNVKNWPWLKLYFKIKPLLKSAETEKELQEMKENYEKMKTDLAAALAKKKELEEKMVSLLQEKNDLQLQV-SEVENLSDAEERCEGLIKSKIQLEAKLKETTERLEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMASQDESIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDLENDKQQSDEKIKKKDFEISQLLSKIEDEQSLGAQLQKKIKELQARIEELEEEIEAERAARAKVEKQRADLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLCSNMEAVAKMKGNLEKMCRTLEDQLSELKAKNDENVRQLNDANALKARLQTENGEITRQLEEKEALVSQLTRGKQAFTQQIEELKRHIEEEVKAKNALAHAVQSARHDCDLLREQFEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEESKKKLAQRLQEAEESIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANSLAANLDKKQRNFDKVLAEWKQKYEESQAELEGAQKEARSLSTELFKMKNSYEEALDQLETMKRENKNLQQEISDLTEQLGETGKSIHELEKAKKSVETEKAEIQTALEEAEGTLEHEESKILRVQLELNQVKGEIDRKLAEKDEEMEQIKRNSQRVIESMQSTLDAEVRSRNDALRVKKKMEGDLNEMEIQLSHANRQAAEAQKQLRNVQGQLKDAQLHLDDALRAQEDMKEQVAMVERRNGLMLAEIEELRAALEQTERGRKVAEQELVDISERVALLHSQNTSLLNTKKKLEADLVQVQGEVEEAIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHVERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLEIRVHELEAEVEAEQKRGAEAIKGVRKYERRMKELTYQTEEDKKNMNRLQDLVDKLQLKVKVYKRQAEEAEEQANTHMSRFRKVQHELEEAQERADIAESQVNKLRAKSR 1925          
BLAST of Myosin heavy chain vs. Ensembl Medaka
Match: ENSORLT00000002485.2 (myosin heavy chain, fast skeletal muscle [Source:NCBI gene;Acc:101164155])

HSP 1 Score: 1736.08 bits (4495), Expect = 0.000e+0
Identity = 1016/1920 (52.92%), Postives = 1398/1920 (72.81%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKP-FHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNR 5837
            M    P   YL    K  ++     FD+K   ++ + +E ++   +    G   TV+T    T TVK+++I  MNPPKF  IEDMA +T LN+ +VL NL++R+   +IYTYSGLFCV +NPYK  P+Y  QV++ Y+GK+R E PPHIFSISDNAY  ML DR+NQS+LITGESGAGKT NTK+VI YFA +A A  K+ +  G+  K +G+LEDQI+ ANP+LEAYGNAKTVRN+NSSRFGKFIRIHFG++GK+A ADIE YLLEKSRV  Q   ER+YHIFYQ+++ G KP   E LLI+ +P  Y  I+QGE+T+  ++D EE   TD A DILGFSAEEKM ++K T ++++ G MKFKQ+ REEQAE DGT  A+K+A+L+G+N+ D+++++  P+VKVGNE VTKGQ   QV  +V AL KS+Y +MF W+V+R+N+ LDTK  RQFFIGVLDIAGFEIF++N  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDL ACIELIEKPMGI SILEEECMFPKA+D +FK KL+D HLGK+  F +   P  G+AEAHF L HYAG+V YN+TGWL+KNKDPLN++V+ L   S   L+  L+A      + G +KKGG+ QT+S+  RE+L KLM NL+ST PHF+RC++PNE K PG+++  LV+HQL CNGVLEGIRICRKGFP+R++Y +FKQRY +L  + IP+G F++ K+ + K+L ++ +D + Y+ G+TKVFFKAG L  LE+MRDEKL+ L+++ QA  RG+LMR+++ K+ ++R A+  IQ N+R ++ ++ WPW KLY K+KPLL  A  E+E+++      K+K +       KKELEE+ V LL+ KNDL LQ+  E ++L+DAEE+   L+  K  +E ++KE  + L +EE+  A L   K+K++ E  ELKKD+ DLE +L K E+EK A + ++K+L ++MA Q+E + KL KEKKA  E  ++T + L AEE+KV  L KAK KLEQ +D++E +L +E+KIR D+E+ KRK+E +LK  QE++ DLE  K++ +E++K+K+ E+    SKIEDE  L AQLQ+KIKELQARI+ELEE++EAER ARAK EK R  L  ELEE+S+RLEE GGAT+AQ+++NKKREAE  KL+RDLEES +QH+   A  RKKQ D V E  EQ+D LQ+VK K+EKEK+E K +++DL   +E++ K+K N +K  + +E Q SEL+ K +E  R +ND N    + Q  N E   +LEE E+ ++QL + KQ    Q+EE ++  EEE +AK  L+  V++   D D LRE  EEE E K+++QR + KA  E+ Q + K+E     R+EEL+E+K+K   R+ E EE  E   SK   LEK K RLQGE+ED+++DV+RAN LA+ L+KKQ+ FDKV++EW+QKY ESQAELE +Q+E+R++S E+F+MK   EE+ +QLE++KRENKNL  EI DLTEQIGE G+S+HE++KA+K +E EK ELQ ALEEAE  LE EE+K  R QLE++Q++ EIDR+LAEK+EE E  + N QR +ESM+++L+AE R R +A ++KKK+E D+ E+E+ +  ANR  +E +K  +  Q Q+++    ++D    ++ ++EQ  M ER+  ++LAE+EE+R +LE +ER RK  E E ++ ++R+  L  Q++  + TK+KLEAD   +Q ++++A  EAR A E+AKKA+ D+A + +E+++EQ+ +  ++++KK LE   K+LQ +LDE+EN A+KGGKK L KLE RVRELEAE++ EQ+R  ++ K  RK ERR+KEL  QT+EDKKN  RLQDLV+KLQ K+K YKRQ EEAEE A  ++A+ RK+Q E+E+++ERAD AE  + KLR K+R
Sbjct:    7 MEAYGPAAIYLRKPEKERIEAQAAPFDAKTAYFVAEPEEMYLKGKLIKREGGKATVET----TLTVKEEDIHPMNPPKFDKIEDMAMMTHLNEPAVLYNLKERFASWMIYTYSGLFCVVVNPYKWLPVYDAQVVNAYRGKKRIEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVAGGKKSE--GSSGKMQGSLEDQIIAANPLLEAYGNAKTVRNDNSSRFGKFIRIHFGSTGKLASADIETYLLEKSRVTFQLSAERSYHIFYQLMT-GHKPELLEALLITTNPYDYPMISQGEITVKSINDVEEFIATDTAIDILGFSAEEKMGIYKLTGAVMHHGNMKFKQKQREEQAEPDGTEVADKIAYLMGLNSADMLKALCYPRVKVGNEMVTKGQTVPQVNNAVSALCKSVYEKMFLWMVIRINEMLDTKQPRQFFIGVLDIAGFEIFDYNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLHDQHLGKTKAF-EKPKPAKGKAEAHFALVHYAGTVDYNITGWLDKNKDPLNDSVVQLYQKSSNKLLCYLYAA-----HGGGKKKGGSFQTVSALFRENLGKLMTNLRSTHPHFVRCLIPNESKTPGLMENFLVIHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYKVLNASVIPEGQFIDNKKASEKLLGSIDVDHSQYKFGHTKVFFKAGLLGTLEEMRDEKLAELVTMTQALCRGFLMRKEFVKMMERRDAIFTIQYNVRSFMNVKNWPWLKLYFKIKPLLKSAETEKELQEMKGNYEKMKTDLAAALAKKKELEEKMVSLLQEKNDLQLQVAAETENLSDAEERCEGLIKSKIQLEAKLKETTERLEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMASQDESIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLAQESIMDLENDKQQSDEKIKKKDFEISQLLSKIEDEQSLGAQLQKKIKELQARIEELEEEIEAERAARAKVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEAVAKSKGNLEKMCRTLEDQLSELKAKNDENVRQLNDINVQKARLQTENGEFARQLEEKEALVSQLTRGKQAFTQQIEELKRHVEEEVKAKNALAHAVQSARHDCDLLREQFEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEESKKKLAQRLQEAEESIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANALAANLDKKQRNFDKVLAEWKQKYEESQAELEGAQKEARSLSTELFKMKNSYEEALDQLETMKRENKNLQQEISDLTEQIGENGKSIHELEKAKKTVENEKIELQTALEEAEGTLEHEESKILRVQLELNQVKGEIDRKLAEKDEEMEQIKRNSQRVIESMQSTLDAEVRSRNDALRVKKKMEGDLNEMEIQLSHANRQAAEAQKQLRNVQGQLKDAQLHLDDALRGQEDMKEQVAMVERRNGLMLAEIEELRAALEQTERGRKVAEQELVDASERVALLHSQNTSLLNTKKKLEADFVQVQGEVDDAVQEARNAEEKAKKAITDAAMMAEELKKEQDTSSHLERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELEAEVETEQRRGADAVKGVRKYERRVKELTYQTEEDKKNVSRLQDLVDKLQLKVKAYKRQAEEAEEQANTHMARLRKVQHELEEAQERADIAETQVNKLRAKSR 1913          
BLAST of Myosin heavy chain vs. Planmine SMEST
Match: SMESG000013389.1 (SMESG000013389.1)

HSP 1 Score: 3450.22 bits (8945), Expect = 0.000e+0
Identity = 1910/1935 (98.71%), Postives = 1915/1935 (98.97%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 5888
            MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGKPKPPKPGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQEEEMKKAAEELTKLKEEFEKVDKFKKELEEQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKELEDHLLEEEDNAAGLEDIKKKMQGEIE                  E+  KDQQIKSLQDQMAKQEEEMNKLKKEKKAADEVQKKTEESLLAEEEKVKNLNKAKAKLEQTIDEMEENL+REQKIRADVEKVKRKIETELKQTQETVDDLERVKRELEEQLKRKEMELVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLEAERQARAKAEKSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQKVKAKVEKEKNEMKEDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAE+ESRAKAKLSSD+RNLNADLDNLREALEEENENKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLEMEKEELQHALEEAEQALEQEEAKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRAMESMEASLEAESRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAEL+EVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNALKGGKKALSKLEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT
Sbjct:    1 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGKPKPPKPGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQEEEMKKAAEELTKLKEEFEKVDKFKKELEEQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKELEDHLLEEEDNAAGLEDIKKKMQGEIE------------------EENTKDQQIKSLQDQMAKQEEEMNKLKKEKKAADEVQKKTEESLLAEEEKVKNLNKAKAKLEQTIDEMEENLAREQKIRADVEKVKRKIETELKQTQETVDDLERVKRELEEQLKRKEMELVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLEAERQARAKAEKSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQKVKAKVEKEKNEMKEDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEDESRAKAKLSSDIRNLNADLDNLREALEEENENKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLEMEKEELQHALEEAEQALEQEEAKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRAMESMEASLEAESRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELDEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNALKGGKKALSKLEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 1917          
BLAST of Myosin heavy chain vs. Planmine SMEST
Match: SMESG000013389.1 (SMESG000013389.1)

HSP 1 Score: 3446.37 bits (8935), Expect = 0.000e+0
Identity = 1910/1938 (98.56%), Postives = 1915/1938 (98.81%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAE---DPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 5888
            MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGKPKPPKPGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAE   DPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQEEEMKKAAEELTKLKEEFEKVDKFKKELEEQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKELEDHLLEEEDNAAGLEDIKKKMQGEIE                  E+  KDQQIKSLQDQMAKQEEEMNKLKKEKKAADEVQKKTEESLLAEEEKVKNLNKAKAKLEQTIDEMEENL+REQKIRADVEKVKRKIETELKQTQETVDDLERVKRELEEQLKRKEMELVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLEAERQARAKAEKSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQKVKAKVEKEKNEMKEDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAE+ESRAKAKLSSD+RNLNADLDNLREALEEENENKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLEMEKEELQHALEEAEQALEQEEAKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRAMESMEASLEAESRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAEL+EVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNALKGGKKALSKLEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT
Sbjct:    1 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGKPKPPKPGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEEDTDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQEEEMKKAAEELTKLKEEFEKVDKFKKELEEQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKELEDHLLEEEDNAAGLEDIKKKMQGEIE------------------EENTKDQQIKSLQDQMAKQEEEMNKLKKEKKAADEVQKKTEESLLAEEEKVKNLNKAKAKLEQTIDEMEENLAREQKIRADVEKVKRKIETELKQTQETVDDLERVKRELEEQLKRKEMELVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLEAERQARAKAEKSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQKVKAKVEKEKNEMKEDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEDESRAKAKLSSDIRNLNADLDNLREALEEENENKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLEMEKEELQHALEEAEQALEQEEAKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRAMESMEASLEAESRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELDEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNALKGGKKALSKLEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 1920          
BLAST of Myosin heavy chain vs. Planmine SMEST
Match: SMESG000013389.1 (SMESG000013389.1)

HSP 1 Score: 3443.28 bits (8927), Expect = 0.000e+0
Identity = 1910/1944 (98.25%), Postives = 1915/1944 (98.51%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAE---------DPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 5888
            MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGKPKPPKPGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAE         DPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQEEEMKKAAEELTKLKEEFEKVDKFKKELEEQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKELEDHLLEEEDNAAGLEDIKKKMQGEIE                  E+  KDQQIKSLQDQMAKQEEEMNKLKKEKKAADEVQKKTEESLLAEEEKVKNLNKAKAKLEQTIDEMEENL+REQKIRADVEKVKRKIETELKQTQETVDDLERVKRELEEQLKRKEMELVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLEAERQARAKAEKSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQKVKAKVEKEKNEMKEDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAE+ESRAKAKLSSD+RNLNADLDNLREALEEENENKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLEMEKEELQHALEEAEQALEQEEAKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRAMESMEASLEAESRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAEL+EVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNALKGGKKALSKLEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT
Sbjct:    1 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGKPKPPKPGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEEDTGRKKKGDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQEEEMKKAAEELTKLKEEFEKVDKFKKELEEQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKELEDHLLEEEDNAAGLEDIKKKMQGEIE------------------EENTKDQQIKSLQDQMAKQEEEMNKLKKEKKAADEVQKKTEESLLAEEEKVKNLNKAKAKLEQTIDEMEENLAREQKIRADVEKVKRKIETELKQTQETVDDLERVKRELEEQLKRKEMELVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLEAERQARAKAEKSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQKVKAKVEKEKNEMKEDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEDESRAKAKLSSDIRNLNADLDNLREALEEENENKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLEMEKEELQHALEEAEQALEQEEAKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRAMESMEASLEAESRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELDEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNALKGGKKALSKLEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTT 1926          
BLAST of Myosin heavy chain vs. Planmine SMEST
Match: SMESG000056451.1 (SMESG000056451.1)

HSP 1 Score: 2782.28 bits (7211), Expect = 0.000e+0
Identity = 1525/1932 (78.93%), Postives = 1721/1932 (89.08%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPG 5879
            M+PSDPDF YLGVDRKAL+KQYGDSFDSKKN WIPDEKE +IA T+E+ +GD  TVKTDK ETK VK+D +EQMNPPKF+MIEDMANLTFLNDASV DNLRQRYYKNLIYTYSGLFC+ +NPY+RFPIYT QVI KYKGKRR EMPPHIFSISDNAY+NML DR+NQSVLITGESGAGKTENTKKVITYFA+VAAA+KK+        K+KG+LEDQIVQANPVLEAYGNAKT RNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRV SQQKGERNYHIFYQ+LS GGK +H+KLL++ DPAL+SFINQGELTIDGVDDEEEMK+TDEAF ILGFS EEKMSLFKCT SI+NMGEMKFKQRPREEQAEADGT EAEKV+FLLGVNAKDLMQ+ILKPKVKVGNEYVTKGQ+KDQVLYS+GALAKSLYNRMFAWLV RVNKTLDTKVKRQFFIGVLDIAGFEIF+FNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASD T KAKLYDNHLGKSPNFGKPKPPKPGQ EAHFELHHYAGSVPYN+TGWLEKNKDPLNE+V+ LL ASKE LV+SLFAPAEDP+ +GKRKKGGAMQTISSTHRESLNKLMKNL STSPHFIRCIVPNEFKQPGV+DAHLV+HQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVT KIL A+QLDTNLYRLGNTKVFFKAGTLA LED+RDEKLSS               RQYKKLQDQRVALS+IQRNIRKYL+LRTW WWKL+TKVKP+LNIARQEEEMKKAAEEL KLKEEFEK +K+KKELEEQNV LL+AKNDLFLQLQTEQDSLADAEEKVSKLV+QKADMEGRIKELED L EEE++A+ LE+ KKK+  +I+ELKKDV DLESSLQKAEQEK AKDQQIKSL D + ++EE++ K++KEKKAADE+QKKTEESL AEEEKV NLNKAKAKLEQ +DEMEENL REQKIRADVEK KRK+E ELKQ QE ++DLER+K ELEEQLKRKE+EL  A+SKIEDES LVA LQRKIKELQARIQELEEDLEAERQARAKAEK++HQLE ELEE+S+RLEEQGGAT AQ DLNKKREAEL+KLKRDLEE+NMQH+Q + Q RKKQQD  NEF++QLDQLQK K+K+E+EK+E++ D+ DL  QLESLNK K N +K  K +E   S+LQ KL+E +R + +A N + +NQ  N+E+   LE+AESQINQLGK KQQ+Q QLEEA+Q  E+ESRAKAKL+ D+RN  +DLD LRE+LEEE E KSD+QRQLVK Q E+QQLKA  +G+G +R+EE++E +RK   RI ELEEE+E+ KSK  QLEK+K+RLQGEIED+++DV+RAN LASQLEKKQK  DK++ EWQ+KY+ESQ ELE S RESRT+SAEVF++K+Q+E SQ+Q+ES++RENKNL+DEIHDLTEQ+GEGGR+VHEI+K RKR+E+E++ELQHALEEAE ALEQEEAKSQR+QLE+SQ RQE +RRLAEKEEEFE TR NHQR +ESM+ASLEAE RGR EA KMKKKLEHDI ELEV +DTANR++SEQEKNAKK+QQQ+ E+ + VE++ HQ++Q+ EQ  +TERKL M+  ELEE++   +++E+NRK  E+EK E  D+LNE S+Q+S FMATKRK+EADLAAMQ+DLEE+   ARQANEQ KKA+ D+ RLFDEI+QEQEHAQQ +K +K LE+Q KELQ+KL+E+E N LKGGKKALSKLEQR+RELE ELDGEQKRHVE+QKN+RK +RRLKE+  Q DEDKKNQ+R+Q L+E LQ KIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLR KNRSSVS +RG S  PG
Sbjct:    1 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVAAASKKD---DDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDPSQSGKRKKGGAMQTISSTHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSS---------------RQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQEEEMKKAAEELEKLKEEFEKTEKYKKELEEQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKELEDSLSEEENSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLEAERQARAKAEKAKHQLEAELEEISERLEEQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQKSKSKIEREKSELRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGKAKQQLQAQLEEAKQNLEDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQELEEESESNKSKCSQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHEIEKTRKRIEIERDELQHALEEAESALEQEEAKSQRAQLEISQARQESERRLAEKEEEFEGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMQAQVEEQHHQREQVSEQLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIKQEQEHAQQAEKARKNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNRSSVSVSRGASSGPG 1914          
BLAST of Myosin heavy chain vs. Planmine SMEST
Match: SMESG000056451.1 (SMESG000056451.1)

HSP 1 Score: 2780.36 bits (7206), Expect = 0.000e+0
Identity = 1524/1932 (78.88%), Postives = 1720/1932 (89.03%), Query Frame = 3
Query:   84 MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDASGDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNLRQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIFSISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEEDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGXXXXXXXGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYRLGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMEGRIKXXXXXXXXXXXNAAGLEDIKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKSLQDQMAXXXXXXXXXXXXXXAADEVQKKTEESXXXXXXXXXXXXXXXXXXXQTIDEMEENLSREQKIRADVEKVKRKIETELKQTQETVDDXXXXXXXXXXXXXXXXXXXVNASSKIEDESGLVAQLQRKIKELQARIQELEEDLXXXXXXXXXXXXSRHQLEGELEELSDRLEEQGGATSAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQLDQLQXXXXXXXXXXXXXXXDLNDLQGQLESLNKAKANSDKRIKEIEAQNSELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQMQTQLEEARQIAEEESRAKAKLSSDVRNLNXXXXXXXXXXXXXXXXKSDIQRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETAKSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQQKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHEIDKARKRLXXXXXXXXXXXXXXXXXXXXXXXKSQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRXXXXXXXXXXXXXRGRAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMVEDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKMEITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKKAVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNXXXXXXXXXXXXEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPG 5879
            M+PSDPDF YLGVDRKAL+KQYGDSFDSKKN WIPDEKE +IA T+E+ +GD  TVKTDK ETK VK+D +EQMNPPKF+MIEDMANLTFLNDASV DNLRQRYYKNLIYTYSGLFC+ +NPY+RFPIYT QVI KYKGKRR EMPPHIFSISDNAY+NML DR+NQSVLITGESGAGKTENTKKVITYFA+VAAA+KK+        K+KG+LEDQIVQANPVLEAYGNAKT RNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRV SQQKGERNYHIFYQ+LS GGK +H+KLL++ DPAL+SFINQGELTIDGVDDEEEMK+TDEAF ILGFS EEKMSLFKCT SI+NMGEMKFKQRPREEQAEADGT EAEKV+FLLGVNAKDLMQ+ILKPKVKVGNEYVTKGQ+KDQVLYS+GALAKSLYNRMFAWLV RVNKTLDTKVKRQFFIGVLDIAGFEIF+FNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASD T KAKLYDNHLGKSPNFGKPKPPKPGQ EAHFELHHYAGSVPYN+TGWLEKNKDPLNE+V+ LL ASKE LV+SLFAPAEDP+ +GKRKKGGAMQTISSTHRESLNKLMKNL STSPHFIRCIVPNEFKQPGV+DAHLV+HQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVT KIL A+QLDTNLYRLGNTKVFFKAGTLA LED+RDEKLS                RQYKKLQDQRVALS+IQRNIRKYL+LRTW WWKL+TKVKP+LNIARQEEEMKKAAEEL KLKEEFEK +K+KKELEEQNV LL+AKNDLFLQLQTEQDSLADAEEKVSKLV+QKADMEGRIKELED L EEE++A+ LE+ KKK+  +I+ELKKDV DLESSLQKAEQEK AKDQQIKSL D + ++EE++ K++KEKKAADE+QKKTEESL AEEEKV NLNKAKAKLEQ +DEMEENL REQKIRADVEK KRK+E ELKQ QE ++DLER+K ELEEQLKRKE+EL  A+SKIEDES LVA LQRKIKELQARIQELEEDLEAERQARAKAEK++HQLE ELEE+S+RLEEQGGAT AQ DLNKKREAEL+KLKRDLEE+NMQH+Q + Q RKKQQD  NEF++QLDQLQK K+K+E+EK+E++ D+ DL  QLESLNK K N +K  K +E   S+LQ KL+E +R + +A N + +NQ  N+E+   LE+AESQINQLGK KQQ+Q QLEEA+Q  E+ESRAKAKL+ D+RN  +DLD LRE+LEEE E KSD+QRQLVK Q E+QQLKA  +G+G +R+EE++E +RK   RI ELEEE+E+ KSK  QLEK+K+RLQGEIED+++DV+RAN LASQLEKKQK  DK++ EWQ+KY+ESQ ELE S RESRT+SAEVF++K+Q+E SQ+Q+ES++RENKNL+DEIHDLTEQ+GEGGR+VHEI+K RKR+E+E++ELQHALEEAE ALEQEEAKSQR+QLE+SQ RQE +RRLAEKEEEFE TR NHQR +ESM+ASLEAE RGR EA KMKKKLEHDI ELEV +DTANR++SEQEKNAKK+QQQ+ E+ + VE++ HQ++Q+ EQ  +TERKL M+  ELEE++   +++E+NRK  E+EK E  D+LNE S+Q+S FMATKRK+EADLAAMQ+DLEE+   ARQANEQ KKA+ D+ RLFDEI+QEQEHAQQ +K +K LE+Q KELQ+KL+E+E N LKGGKKALSKLEQR+RELE ELDGEQKRHVE+QKN+RK +RRLKE+  Q DEDKKNQ+R+Q L+E LQ KIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLR KNRSSVS +RG S  PG
Sbjct:    1 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVAAASKKD---DDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDPSQSGKRKKGGAMQTISSTHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLS----------------RQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQEEEMKKAAEELEKLKEEFEKTEKYKKELEEQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKELEDSLSEEENSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLEAERQARAKAEKAKHQLEAELEEISERLEEQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQKSKSKIEREKSELRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGKAKQQLQAQLEEAKQNLEDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQELEEESESNKSKCSQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHEIEKTRKRIEIERDELQHALEEAESALEQEEAKSQRAQLEISQARQESERRLAEKEEEFEGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMQAQVEEQHHQREQVSEQLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIKQEQEHAQQAEKARKNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNRSSVSVSRGASSGPG 1913          
The following BLAST results are available for this feature:
BLAST of Myosin heavy chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYH70.000e+055.04myosin heavy chain 7 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH60.000e+054.64myosin heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH80.000e+053.26myosin heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH20.000e+053.31myosin heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH20.000e+053.31myosin heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo-50.000e+053.67MYOsin heavy chain structural genes [Source:UniPr... [more]
unc-540.000e+053.64Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
unc-540.000e+053.64Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
unc-540.000e+053.64Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
myo-30.000e+051.48Myosin-3 [Source:UniProtKB/Swiss-Prot;Acc:P12844][more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mhc0.000e+058.37gene:FBgn0264695 transcript:FBtr0307496[more]
Mhc0.000e+058.30gene:FBgn0264695 transcript:FBtr0080900[more]
Mhc0.000e+058.32gene:FBgn0264695 transcript:FBtr0301827[more]
Mhc0.000e+058.56gene:FBgn0264695 transcript:FBtr0307495[more]
Mhc0.000e+058.19gene:FBgn0264695 transcript:FBtr0080903[more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh7l0.000e+054.09myosin heavy chain 7-like [Source:ZFIN;Acc:ZDB-GEN... [more]
myh7l0.000e+054.09myosin heavy chain 7-like [Source:ZFIN;Acc:ZDB-GEN... [more]
smyhc20.000e+054.41slow myosin heavy chain 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
smyhc20.000e+054.41slow myosin heavy chain 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
smyhc20.000e+054.41slow myosin heavy chain 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde1b0.000e+054.89phosphodiesterase 1B [Source:Xenbase;Acc:XB-GENE-9... [more]
dtd20.000e+055.11D-tyrosyl-tRNA deacylase 2 (putative) [Source:Xenb... [more]
dtd20.000e+055.27D-tyrosyl-tRNA deacylase 2 (putative) [Source:Xenb... [more]
dtd20.000e+055.11D-tyrosyl-tRNA deacylase 2 (putative) [Source:Xenb... [more]
pde1b0.000e+055.09phosphodiesterase 1B [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myh60.000e+054.76myosin, heavy polypeptide 6, cardiac muscle, alpha... [more]
Myh60.000e+054.76myosin, heavy polypeptide 6, cardiac muscle, alpha... [more]
Myh70.000e+055.24myosin, heavy polypeptide 7, cardiac muscle, beta ... [more]
Myh70.000e+055.24myosin, heavy polypeptide 7, cardiac muscle, beta ... [more]
Myh40.000e+053.18myosin, heavy polypeptide 4, skeletal muscle [Sour... [more]
back to top
BLAST of Myosin heavy chain vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P24733|MYS_ARGIR0.000e+064.65Myosin heavy chain, striated muscle OS=Argopecten ... [more]
sp|F1PT61|MYH16_CANLF0.000e+055.54Myosin-16 OS=Canis lupus familiaris OX=9615 GN=MYH... [more]
sp|P05661|MYSA_DROME0.000e+057.59Myosin heavy chain, muscle OS=Drosophila melanogas... [more]
sp|P02563|MYH6_RAT0.000e+054.85Myosin-6 OS=Rattus norvegicus OX=10116 GN=Myh6 PE=... [more]
sp|Q9BE39|MYH7_BOVIN0.000e+055.09Myosin-7 OS=Bos taurus OX=9913 GN=MYH7 PE=1 SV=1[more]
back to top
BLAST of Myosin heavy chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|196118560.000e+093.39tr|O96062|O96062_DUGJA Myosin heavy chain OS=Duges... [more]
gnl|BL_ORD_ID|228301910.000e+073.76tr|A0A3Q0KIL4|A0A3Q0KIL4_SCHMA Myosin heavy chain ... [more]
gnl|BL_ORD_ID|171896910.000e+073.29tr|A0A4Z2CPI5|A0A4Z2CPI5_SCHJA Myosin heavy chain,... [more]
gnl|BL_ORD_ID|228372680.000e+073.34tr|A0A3Q0KIP4|A0A3Q0KIP4_SCHMA Myosin heavy chain ... [more]
gnl|BL_ORD_ID|228245590.000e+073.23tr|Q02456|Q02456_SCHMA Myosin heavy chain OS=Schis... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000010358.20.000e+053.93pep primary_assembly:Astyanax_mexicanus-2.0:23:342... [more]
MYH60.000e+053.25myosin heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:... [more]
ENSAMXT00000001735.20.000e+054.00pep primary_assembly:Astyanax_mexicanus-2.0:9:3082... [more]
ENSAMXT00000042907.10.000e+053.79myosin heavy chain, fast skeletal muscle-like [Sou... [more]
ENSAMXT00000039595.10.000e+053.63myosin heavy chain, fast skeletal muscle-like [Sou... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002731.10.000e+053.66pep scaffold:Pmarinus_7.0:GL478284:11062:40470:1 g... [more]
ENSPMAT00000005582.10.000e+052.56pep scaffold:Pmarinus_7.0:GL481917:38212:72095:-1 ... [more]
ENSPMAT00000003821.10.000e+057.02pep scaffold:Pmarinus_7.0:GL477325:10535:35195:1 g... [more]
ENSPMAT00000004078.10.000e+058.10pep scaffold:Pmarinus_7.0:GL478761:5289:25008:-1 g... [more]
ENSPMAT00000005411.10.000e+055.75pep scaffold:Pmarinus_7.0:GL476612:1285:44967:1 ge... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MYO10.000e+042.66Type II myosin heavy chain; required for wild-type... [more]
MYO21.751e-15837.96Type V myosin motor involved in actin-based transp... [more]
MYO42.971e-15636.35Type V myosin motor involved in actin-based transp... [more]
MYO32.789e-12034.97One of two type I myosins; localizes to actin cort... [more]
MYO52.266e-11934.27One of two type I myosin motors; contains proline-... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
MYHC-ST0.000e+060.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418192.229e-15936.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495151.657e-14237.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455634.777e-13635.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350072.412e-13035.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vmhc0.000e+053.81ventricular myosin heavy chain [Source:NCBI gene;A... [more]
myh60.000e+054.47myosin, heavy chain 6, cardiac muscle, alpha [Sour... [more]
ENSORLT00000016518.20.000e+053.83myosin-7 [Source:NCBI gene;Acc:101164097][more]
ENSORLT00000007991.20.000e+053.63myosin heavy chain, fast skeletal muscle [Source:N... [more]
ENSORLT00000002485.20.000e+052.92myosin heavy chain, fast skeletal muscle [Source:N... [more]
back to top
BLAST of Myosin heavy chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013389.10.000e+098.71SMESG000013389.1[more]
SMESG000013389.10.000e+098.56SMESG000013389.1[more]
SMESG000013389.10.000e+098.25SMESG000013389.1[more]
SMESG000056451.10.000e+078.93SMESG000056451.1[more]
SMESG000056451.10.000e+078.88SMESG000056451.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025388 ID=SMED30025388|Name=Myosin heavy chain|organism=Schmidtea mediterranea sexual|type=transcript|length=6089bp
TTTTTTTTCGAGTTTGTGCTAGAAATTAATTTCAGTTTGAAATTTTTTGC
CTATTTCGAGTTCTTTGAAAACAATCTGAAAACATGAACCCATCTGATCC
CGATTTTCAATATCTCGGTGTCGACCGAAAAGCTTTAATGAAGCAGTATG
GGGATTCCTTTGACAGCAAGAAAAACTGTTGGATTCCTGACGAGAAAGAA
GCCTTCATTGCGGCGACAATTGAAGATGCGTCTGGAGATGTCTATACGGT
CAAAACCGATAAAAGTGAAACCAAGACTGTTAAAAAGGACGAAATCGAAC
AAATGAATCCACCGAAATTTTTGATGATTGAAGACATGGCAAATTTAACC
TTTCTAAACGATGCCAGCGTTCTTGATAATTTAAGACAAAGATATTACAA
GAATCTGATTTATACCTACTCTGGACTGTTTTGTGTGACAATAAATCCAT
ACAAAAGATTTCCAATTTACACCCCGCAGGTGATTTCAAAATACAAAGGT
AAACGACGAACTGAAATGCCTCCACATATTTTCTCGATATCCGACAATGC
TTACACCAACATGTTGGCGGACCGAGATAATCAATCTGTCTTAATTACTG
GTGAAAGTGGAGCTGGGAAAACTGAAAATACAAAAAAAGTTATCACTTAT
TTTGCACACGTTGCAGCTGCTACTAAAAAAGAAGAGGATGATACTGGAAC
TGGTCAAAAGAGAAAGGGAACATTGGAAGACCAAATCGTGCAAGCAAATC
CTGTTTTAGAAGCATACGGTAACGCAAAAACTGTGCGAAACAACAATTCA
TCCAGATTTGGTAAATTCATTCGTATTCATTTCGGTACAAGTGGAAAAAT
AGCTGGAGCTGATATTGAATTTTACTTACTCGAAAAATCGAGAGTAAATT
CTCAACAGAAAGGTGAAAGAAACTATCACATTTTCTATCAAATTTTATCG
AACGGAGGAAAACCATTTCATGAAAAATTACTCATCTCTCCTGATCCAGC
TTTGTATTCCTTCATTAATCAAGGTGAATTAACAATCGATGGAGTCGACG
ATGAAGAAGAAATGAAAATAACTGATGAAGCTTTCGACATTTTGGGATTT
TCTGCCGAAGAAAAAATGAGCTTGTTCAAGTGTACTTGCTCAATTTTAAA
CATGGGCGAAATGAAATTTAAACAAAGGCCAAGAGAAGAACAAGCCGAAG
CCGACGGTACTGCTGAAGCTGAGAAAGTGGCTTTTCTGTTGGGTGTCAAT
GCAAAAGATTTAATGCAATCGATTCTGAAACCGAAAGTTAAAGTTGGTAA
TGAATATGTCACAAAGGGGCAGAATAAAGATCAAGTTCTTTATTCGGTTG
GTGCGCTAGCAAAATCTCTTTACAACAGAATGTTTGCGTGGTTGGTTTTG
AGAGTTAACAAAACCCTCGACACTAAAGTCAAGCGACAATTTTTCATCGG
TGTTTTGGATATTGCCGGTTTCGAAATTTTCAATTTCAATGGATTTGAAC
AAATTTGTATTAATTACACCAATGAAAGATTGCAGCAATTTTTTAACCAT
CACATGTTCGTGTTGGAACAGGAAGAGTACAAGAAGGAAGCGATCGATTG
GGAGTTCATTGATTTTGGAATGGATCTTCAAGCGTGCATTGAGCTCATTG
AAAAGCCAATGGGTATTCTGTCAATCTTAGAAGAAGAGTGCATGTTTCCG
AAAGCATCTGATATGACATTTAAAGCAAAATTGTATGATAATCATCTCGG
AAAAAGTCCCAATTTTGGAAAGCCAAAACCTCCAAAACCCGGACAGGCTG
AAGCTCACTTCGAATTGCATCACTATGCTGGCAGTGTGCCATACAATGTT
ACTGGTTGGCTGGAAAAGAATAAAGATCCTCTCAACGAAACTGTGATAAA
TCTACTTGCGGCAAGTAAAGAGGCATTAGTTTCGAGTTTGTTTGCTCCGG
CTGAAGATCCAAATAATACGGGTAAACGGAAAAAGGGTGGGGCCATGCAG
ACCATTTCTTCAACTCATAGGGAATCCTTGAATAAATTGATGAAAAATTT
ACAAAGTACCAGTCCACATTTTATCCGATGCATTGTTCCAAACGAATTCA
AACAACCTGGTGTAATCGACGCTCATTTGGTATTACATCAATTGCATTGT
AACGGTGTCCTTGAAGGCATCAGAATCTGTCGAAAGGGTTTCCCAAACAG
AATGATTTATTCTGAATTTAAACAAAGATATTCTATCTTGGCTCCAAATG
CAATTCCACAGGGATTTGTTGAAGGCAAACAAGTAACGAGCAAAATTCTG
GAAGCTGTTCAATTGGACACCAATCTTTACCGCCTGGGAAATACTAAGGT
ATTTTTCAAAGCTGGAACTTTGGCTGATTTAGAAGACATGCGTGATGAAA
AATTATCTTCACTGATTTCATTGTTTCAAGCTCAAATACGCGGATATTTG
ATGCGAAGACAATATAAAAAATTACAAGATCAGAGAGTTGCTCTATCTAT
CATTCAAAGAAATATTCGTAAATATCTTCTTCTGAGAACATGGCCATGGT
GGAAATTGTATACCAAAGTTAAGCCACTTTTGAACATTGCTCGTCAAGAG
GAAGAAATGAAAAAGGCCGCTGAAGAATTGACAAAATTAAAGGAAGAATT
CGAAAAAGTTGACAAATTCAAAAAAGAACTTGAAGAACAAAACGTCAAAT
TGTTGGAAGCTAAAAACGATTTGTTCTTACAATTACAAACCGAACAAGAC
AGTTTAGCCGATGCCGAGGAAAAGGTTTCAAAATTGGTTATGCAAAAAGC
CGATATGGAAGGAAGAATTAAAGAATTGGAAGATCACCTTCTAGAAGAAG
AAGATAATGCTGCTGGACTGGAAGATATCAAGAAGAAAATGCAGGGTGAG
ATTGAAGAGTTGAAAAAAGATGTTGTCGATTTGGAATCTTCATTACAAAA
GGCTGAACAAGAGAAAACCGCGAAAGATCAACAGATAAAATCGTTACAAG
ATCAAATGGCAAAACAAGAAGAAGAGATGAACAAATTGAAAAAGGAGAAA
AAGGCCGCCGATGAAGTGCAAAAGAAAACCGAAGAATCTCTACTAGCGGA
AGAAGAGAAAGTCAAAAATCTAAACAAAGCTAAAGCCAAATTGGAACAGA
CCATTGATGAGATGGAAGAAAACCTCTCGCGAGAACAGAAAATCCGAGCT
GACGTAGAAAAAGTTAAACGAAAAATCGAAACTGAACTGAAACAAACTCA
AGAGACCGTAGACGATTTGGAAAGAGTAAAACGAGAATTAGAGGAACAAT
TGAAGCGCAAGGAAATGGAATTAGTCAATGCTTCATCGAAAATTGAAGAC
GAATCGGGATTAGTTGCCCAGCTTCAGAGGAAAATCAAAGAACTTCAAGC
TCGAATTCAAGAATTGGAAGAAGATCTGGAAGCAGAAAGACAAGCCCGTG
CAAAAGCAGAGAAAAGCCGACATCAACTCGAAGGCGAGTTGGAAGAATTG
AGTGATCGACTGGAAGAACAAGGAGGCGCAACCTCAGCTCAAATGGATCT
CAATAAGAAGCGAGAGGCAGAATTAATGAAATTAAAGAGAGATTTAGAAG
AATCGAATATGCAACACGATCAGGTTATCGCACAAGCTCGAAAGAAGCAA
CAGGATGTTGTCAATGAATTCTCAGAACAGCTCGATCAACTGCAGAAAGT
CAAAGCTAAAGTTGAAAAAGAAAAGAATGAGATGAAAGAAGATTTAAATG
ACCTACAAGGACAGCTGGAATCATTAAATAAAGCCAAGGCTAACAGCGAC
AAACGAATCAAAGAAATCGAAGCTCAAAATTCCGAATTACAGGGCAAATT
GGAAGAGGCAAATAGACATATCAATGATGCCAACAATACATCTGGAAAGA
ATCAACAAACCAATGCGGAACTCCAAGCACGTTTAGAAGAAGCCGAATCG
CAAATCAATCAGCTGGGTAAAGTCAAGCAACAAATGCAGACTCAACTCGA
AGAAGCCAGGCAAATCGCTGAGGAAGAGTCGAGAGCAAAGGCTAAATTGA
GTTCTGATGTTCGCAATCTCAATGCCGATTTAGACAATCTCAGGGAGGCA
CTGGAAGAGGAAAATGAGAACAAAAGTGACATACAGAGACAGCTAGTTAA
AGCTCAGGGAGAAATGCAACAATTGAAGGCTAAATTCGAAGGCTCGGGAT
CCATTCGTTCAGAAGAGTTGGATGAAGCCAAGCGAAAGTTTATGACACGA
ATCCATGAGCTGGAAGAGGAAGCTGAAACCGCCAAATCGAAAGCCGGACA
ACTAGAAAAAGTTAAAGCTCGACTCCAAGGAGAAATCGAAGATATGCTGG
TCGACGTTGACAGAGCGAATACACTCGCATCTCAGTTGGAAAAGAAGCAG
AAAACATTCGATAAAGTCGTGTCAGAATGGCAGCAGAAATATGCTGAATC
TCAGGCGGAATTGGAAGCATCCCAGAGAGAAAGCAGGACGATTTCAGCTG
AGGTGTTTCGAATGAAAGCACAAATCGAAGAAAGTCAAGAGCAGTTGGAA
AGCGTTAAACGGGAAAACAAAAATCTAGCAGATGAAATCCACGATTTGAC
AGAGCAAATCGGAGAAGGAGGTCGCAGTGTTCACGAAATCGACAAAGCAA
GGAAACGATTGGAAATGGAAAAGGAAGAATTGCAACATGCGTTAGAAGAA
GCCGAACAAGCTTTGGAACAGGAAGAAGCCAAGTCTCAACGATCACAACT
GGAAATGAGCCAGATCAGACAAGAAATCGACAGGCGATTGGCTGAGAAGG
AAGAGGAATTCGAGGCCACTCGAGTCAATCATCAAAGAGCAATGGAGTCA
ATGGAAGCCTCACTTGAAGCCGAATCCAGAGGCAGGGCTGAAGCAACGAA
GATGAAAAAGAAACTGGAGCACGATATCGGTGAACTGGAAGTTGCAGTGG
ATACCGCCAACAGAATCCGATCGGAGCAAGAAAAGAACGCAAAGAAATTC
CAGCAGCAAGTTCAAGAATTGCTATCAATGGTGGAGGATGAGAAACACCA
GAAGGATCAGATACGAGAGCAAACGACGATGACAGAAAGGAAATTGACAA
TGGTCCTGGCAGAGCTTGAGGAGGTTCGTGGCTCATTGGAAAATTCCGAG
AGAAACAGGAAAAATACCGAGAATGAGAAAATGGAAATAACTGATCGATT
GAATGAGTTGAGTGTCCAGAGCTCCGGTTTCATGGCTACCAAGCGGAAAT
TGGAAGCTGATTTGGCTGCTATGCAGTCCGATTTAGAGGAGGCCGCTACT
GAAGCCCGACAAGCCAATGAACAAGCCAAGAAGGCTGTTGCTGACAGTGC
GAGATTGTTTGATGAAATCCGGCAAGAGCAGGAACACGCACAGCAAATCG
ATAAGATCAAGAAACAACTCGAGGCCCAAAATAAAGAATTGCAAGCCAAA
TTAGATGAATCGGAGAATAATGCTTTGAAAGGTGGCAAAAAAGCCTTGAG
CAAACTAGAGCAACGCGTTCGTGAACTTGAAGCCGAATTAGACGGAGAAC
AAAAAAGACACGTTGAAAGTCAAAAGAACTCCAGAAAAGTTGAAAGACGG
CTTAAGGAGCTTGGATTACAAACCGACGAAGATAAGAAGAACCAAGAAAG
ATTGCAAGATCTGGTGGAGAAGCTTCAAGGTAAAATCAAAACCTACAAAC
GCCAGGTGGAAGAGGCGGAAGAAATTGCTGCTGTAAACTTAGCAAAATAC
AGAAAGATCCAACAGGAAATCGAAGATTCCGAAGAAAGAGCTGATCAAGC
TGAACAAGCGTTGCAGAAGCTGAGGACCAAAAACCGCAGCTCCGTTTCGA
CAGCGAGAGGCGGTAGCATGGCTCCCGGCATGACCACAGTGAAATCGACA
TCACTCTCTGTTTCGGCTTCGAGCCGACGACAAGGTTCTAGTGTTTCCAG
AGAGAGCTAAGTCAGAAATTCTAGTAACACAACGATAAATTATTAGGATT
TACTTAATTGACATTATTTGCATGTTATCAATTATTGGACACAATTTAGT
GATGCTTTTATTTAATAAAATTTACATTTTGAAAAAAAA
back to top

protein sequence of SMED30025388-orf-1

>SMED30025388-orf-1 ID=SMED30025388-orf-1|Name=SMED30025388-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1959bp
MNPSDPDFQYLGVDRKALMKQYGDSFDSKKNCWIPDEKEAFIAATIEDAS
GDVYTVKTDKSETKTVKKDEIEQMNPPKFLMIEDMANLTFLNDASVLDNL
RQRYYKNLIYTYSGLFCVTINPYKRFPIYTPQVISKYKGKRRTEMPPHIF
SISDNAYTNMLADRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKE
EDDTGTGQKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHF
GTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSNGGKPFHEKLL
ISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSAEEKMSLFKC
TCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKP
KVKVGNEYVTKGQNKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVK
RQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYK
KEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKL
YDNHLGKSPNFGKPKPPKPGQAEAHFELHHYAGSVPYNVTGWLEKNKDPL
NETVINLLAASKEALVSSLFAPAEDPNNTGKRKKGGAMQTISSTHRESLN
KLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICR
KGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTSKILEAVQLDTNLYR
LGNTKVFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQ
RVALSIIQRNIRKYLLLRTWPWWKLYTKVKPLLNIARQEEEMKKAAEELT
KLKEEFEKVDKFKKELEEQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSK
LVMQKADMEGRIKELEDHLLEEEDNAAGLEDIKKKMQGEIEELKKDVVDL
ESSLQKAEQEKTAKDQQIKSLQDQMAKQEEEMNKLKKEKKAADEVQKKTE
ESLLAEEEKVKNLNKAKAKLEQTIDEMEENLSREQKIRADVEKVKRKIET
ELKQTQETVDDLERVKRELEEQLKRKEMELVNASSKIEDESGLVAQLQRK
IKELQARIQELEEDLEAERQARAKAEKSRHQLEGELEELSDRLEEQGGAT
SAQMDLNKKREAELMKLKRDLEESNMQHDQVIAQARKKQQDVVNEFSEQL
DQLQKVKAKVEKEKNEMKEDLNDLQGQLESLNKAKANSDKRIKEIEAQNS
ELQGKLEEANRHINDANNTSGKNQQTNAELQARLEEAESQINQLGKVKQQ
MQTQLEEARQIAEEESRAKAKLSSDVRNLNADLDNLREALEEENENKSDI
QRQLVKAQGEMQQLKAKFEGSGSIRSEELDEAKRKFMTRIHELEEEAETA
KSKAGQLEKVKARLQGEIEDMLVDVDRANTLASQLEKKQKTFDKVVSEWQ
QKYAESQAELEASQRESRTISAEVFRMKAQIEESQEQLESVKRENKNLAD
EIHDLTEQIGEGGRSVHEIDKARKRLEMEKEELQHALEEAEQALEQEEAK
SQRSQLEMSQIRQEIDRRLAEKEEEFEATRVNHQRAMESMEASLEAESRG
RAEATKMKKKLEHDIGELEVAVDTANRIRSEQEKNAKKFQQQVQELLSMV
EDEKHQKDQIREQTTMTERKLTMVLAELEEVRGSLENSERNRKNTENEKM
EITDRLNELSVQSSGFMATKRKLEADLAAMQSDLEEAATEARQANEQAKK
AVADSARLFDEIRQEQEHAQQIDKIKKQLEAQNKELQAKLDESENNALKG
GKKALSKLEQRVRELEAELDGEQKRHVESQKNSRKVERRLKELGLQTDED
KKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSE
ERADQAEQALQKLRTKNRSSVSTARGGSMAPGMTTVKSTSLSVSASSRRQ
GSSVSRES*
back to top
Aliases
The feature 'Myosin heavy chain' has the following synonyms
Synonym
Dj-mhc
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0051015actin filament binding
GO:0003774motor activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0003779actin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000016pharynx
PLANA:0000019muscle progenitor cell
PLANA:0000061enteric musculature
PLANA:0000140anterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000420parapharyngeal region
PLANA:0000478pharynx musculature
PLANA:0003104enteric muscle cell
PLANA:0004520embryonic pharynx radial muscle cell
PLANA:0004524embryonic pharynx circular muscle cell
PLANA:0000428musculature system
PLANA:0000058embryonic digestive system
PLANA:0007549obsolete body wall musculature compartment
PLANA:0000023embryonic pharynx
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR001609Myosin_head_motor_dom
IPR000048IQ_motif_EF-hand-BS
IPR027401Myosin_IQ_contain_sf
IPR002928Myosin_tail
IPR004009Myosin_N
Vocabulary: cellular component
TermDefinition
GO:0016459myosin complex
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000002Stage 2
PLANA:0000006Stage 6
PLANA:0000007Stage 7
PLANA:0000004Stage 4
PLANA:0000008Stage 8
PLANA:0000003Stage 3
PLANA:0000005Stage 5
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 183..393
NoneNo IPR availableCOILSCoilCoilcoord: 704..738
NoneNo IPR availableCOILSCoilCoilcoord: 472..492
NoneNo IPR availableCOILSCoilCoilcoord: 402..464
NoneNo IPR availableCOILSCoilCoilcoord: 915..942
NoneNo IPR availableCOILSCoilCoilcoord: 1..175
NoneNo IPR availableCOILSCoilCoilcoord: 880..907
NoneNo IPR availableCOILSCoilCoilcoord: 788..822
NoneNo IPR availableCOILSCoilCoilcoord: 500..534
NoneNo IPR availableCOILSCoilCoilcoord: 746..780
NoneNo IPR availableCOILSCoilCoilcoord: 542..608
NoneNo IPR availableCOILSCoilCoilcoord: 627..689
NoneNo IPR availableCOILSCoilCoilcoord: 824..858
NoneNo IPR availableGENE3DG3DSA:1.20.5.370coord: 586..641
e-value: 2.7E-9
score: 39.0
NoneNo IPR availableGENE3DG3DSA:1.20.5.1050coord: 1..91
e-value: 8.8E-8
score: 34.2
coord: 92..206
e-value: 3.3E-5
score: 25.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..27
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 938..978
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 922..937
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 812..831
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 145..183
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 922..984
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 842..882
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 145..170
NoneNo IPR availablePANTHERPTHR34491FAMILY NOT NAMEDcoord: 1..946
NoneNo IPR availablePANTHERPTHR34491:SF5coord: 1..946
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 253..370
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 2..90
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 85..201
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 448..570
IPR002928Myosin tailPFAMPF01576Myosin_tail_1coord: 5..942
e-value: 7.0E-154
score: 514.2