Pinin, desmosome associated protein

Overview
NamePinin, desmosome associated protein
Smed IDSMED30025387
Length (bp)1458
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pinin, desmosome associated protein (SMED30025387) t-SNE clustered cells

Violin plots show distribution of expression levels for Pinin, desmosome associated protein (SMED30025387) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pinin, desmosome associated protein (SMED30025387) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pinin, desmosome associated protein (SMED30025387) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025387

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025387h1SMcG0020290 SmedASXL_008942SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30025387h1SMcG0020289 SmedASXL_013522SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025387h1SMcG0020289 SmedASXL_013522SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30025387h1SMcG0020290 SmedASXL_013522SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025387h1SMcG0020290 SmedASXL_013522SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30025387h1SMcG0020290 SmedASXL_008942SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30025387h1SMcG0020289 SmedASXL_013522SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025387h1SMcG0020289 SmedASXL_013522SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30025387h1SMcG0020290 SmedASXL_013522SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025387h1SMcG0020290 SmedASXL_013522SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30025387h1SMcG0020289 dd_Smed_v4_6517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025387h1SMcG0020289 dd_Smed_v4_6517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025387h1SMcG0020290 dd_Smed_v4_6517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025387h1SMcG0020290 dd_Smed_v4_6517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025387h1SMcG0020289 dd_Smed_v4_6517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025387h1SMcG0020289 dd_Smed_v4_6517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025387h1SMcG0020290 dd_Smed_v4_6517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025387h1SMcG0020290 dd_Smed_v4_6517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pinin, desmosome associated protein vs. Ensembl Human
Match: PNN (pinin, desmosome associated protein [Source:HGNC Symbol;Acc:HGNC:9162])

HSP 1 Score: 67.3958 bits (163), Expect = 3.443e-11
Identity = 60/195 (30.77%), Postives = 105/195 (53.85%), Query Frame = 2
Query:  188 NDKDGPSL-NSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEIVKAVKYSESHLEGGNMK 769
            +D   P+L +SVV  +K RTR D +       + K K+R +R+FG LMGTL   K+++  +T   +   R +IE+K+E   +   + ++ E+ EL   +R +Q +L++L Q+   A+  + W     K+  YIRT   P +FY P  +   TQ  I+++ R+++A+ E R+    IE  + +   E+     +MK
Sbjct:  105 DDVKKPALQSSVVATSKERTRRDLI--QDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATE--RQKRRQEIEQKLEVQAEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRR----IEFAEQINKMEARPRRQSMK 291          
BLAST of Pinin, desmosome associated protein vs. Ensembl Celegans
Match: pnn-1 (PiNiN nuclear speckle-associated protein and splicing factor homolog [Source:UniProtKB/TrEMBL;Acc:Q95ZQ5])

HSP 1 Score: 50.447 bits (119), Expect = 1.641e-6
Identity = 41/138 (29.71%), Postives = 83/138 (60.14%), Query Frame = 2
Query:  299 RCKRLFGHL-MGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQ-TAREIDAMIETRKKKL 706
            R +RLF +L MGTL+S KK  +K+T   +     K  ++ ++ +    E+ ++E+++LL  +RE++ +LK L ++    +  +   ++ + MKG+I+TT +P +F++P + +    L + Q T R++D  I  R+++L
Sbjct:  159 RNRRLFSNLIMGTLSSFKKTEKKTTQQEKQEEVEKKLEETKKKD---FESRKEEKHDLLNKRREQEKELKSLQRKKALIQYAEHHANQLKLMKGWIKTTTSPHIFWQP-VKHTVRSLELKQATERQLDDQIADREEQL 292          
BLAST of Pinin, desmosome associated protein vs. Ensembl Fly
Match: Pnn (gene:FBgn0037737 transcript:FBtr0113210)

HSP 1 Score: 56.225 bits (134), Expect = 2.114e-8
Identity = 36/140 (25.71%), Postives = 75/140 (53.57%), Query Frame = 2
Query:  299 RCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEI 718
            R +R+FG L+GTL    +  E+S    +   + +I++KVE+        ++K++  L   ++++Q +++ L  +    + F  W +     K  IRT   P +F++P + +  T+  + ++  E D  IE R+++LE+E+
Sbjct:  131 RNRRMFGSLLGTLQKFCQ--EESRLKSKEDKKAEIDRKVEKQELQERAMLRKQRETLFLDRKKKQFEIRRLEYKMARMKDFKVWEATMLNAKNNIRTKTKPHLFFRPKVHSPRTEKLLSKSKSEADVFIEFRREELEVEL 268          
BLAST of Pinin, desmosome associated protein vs. Ensembl Fly
Match: Pnn (gene:FBgn0037737 transcript:FBtr0082126)

HSP 1 Score: 56.225 bits (134), Expect = 2.119e-8
Identity = 36/140 (25.71%), Postives = 75/140 (53.57%), Query Frame = 2
Query:  299 RCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEI 718
            R +R+FG L+GTL    +  E+S    +   + +I++KVE+        ++K++  L   ++++Q +++ L  +    + F  W +     K  IRT   P +F++P + +  T+  + ++  E D  IE R+++LE+E+
Sbjct:  131 RNRRMFGSLLGTLQKFCQ--EESRLKSKEDKKAEIDRKVEKQELQERAMLRKQRETLFLDRKKKQFEIRRLEYKMARMKDFKVWEATMLNAKNNIRTKTKPHLFFRPKVHSPRTEKLLSKSKSEADVFIEFRREELEVEL 268          
BLAST of Pinin, desmosome associated protein vs. Ensembl Zebrafish
Match: pnn (pinin, desmosome associated protein [Source:ZFIN;Acc:ZDB-GENE-060519-3])

HSP 1 Score: 56.9954 bits (136), Expect = 3.906e-8
Identity = 50/175 (28.57%), Postives = 97/175 (55.43%), Query Frame = 2
Query:  203 PSL-NSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEIVK 724
            P+L +SVV  +K RTR D  +      + + K+R +R+FG LMGTL   K+++  ST   +   R +IE+K+E   +   + ++ E+ EL   +R +Q +L++L  +   A+  + W +   K+  +IRT   P +FY P  +   TQ  ++++ ++++ + + R++    +I K
Sbjct:  111 PALQSSVVATSKERTRRD--LIQDQTMDERGKQRNRRMFGLLMGTLQKFKQESTVSTERLKR--RQEIEQKLEVQAEQERKKVECERRELFEERRAKQTELRLLEHKVELAQLQEDWNAHNSKLIKFIRTKTKPPIFYLPGRMCSATQKLLEESQKKLNGVFDERREAFAEQINK 281          
BLAST of Pinin, desmosome associated protein vs. Ensembl Xenopus
Match: pnn (pinin, desmosome associated protein [Source:NCBI gene;Acc:448224])

HSP 1 Score: 65.4698 bits (158), Expect = 1.123e-10
Identity = 54/170 (31.76%), Postives = 95/170 (55.88%), Query Frame = 2
Query:  191 DKDGPSL-NSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRK 697
            D   P+L +SVV  +K RTR D +       + K K+R +R+FG LMGTL   K+++  +T   Q   R +IE+K+E   +   + ++ E+ EL   +R +Q +L++L Q+   A   + W    +K+  YIRT   P +FY P  +   +Q   D++ ++++A+ E+R+
Sbjct:  108 DDKKPALQSSVVATSKERTRRDLI--QDQNMDEKGKQRNRRIFGLLMGTLQKFKQESNVATE--QQKRRHEIEQKLEVQAEEEKKQVETERRELFEERRTKQTELRLLEQKVELAHLQEEWNDHNKKIIKYIRTKTKPHLFYIPGRMCPPSQKLFDESQKKLNAIFESRR 273          
BLAST of Pinin, desmosome associated protein vs. Ensembl Xenopus
Match: pnn (pinin, desmosome associated protein [Source:NCBI gene;Acc:448224])

HSP 1 Score: 65.4698 bits (158), Expect = 1.126e-10
Identity = 54/170 (31.76%), Postives = 95/170 (55.88%), Query Frame = 2
Query:  191 DKDGPSL-NSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRK 697
            D   P+L +SVV  +K RTR D +       + K K+R +R+FG LMGTL   K+++  +T   Q   R +IE+K+E   +   + ++ E+ EL   +R +Q +L++L Q+   A   + W    +K+  YIRT   P +FY P  +   +Q   D++ ++++A+ E+R+
Sbjct:  108 DDKKPALQSSVVATSKERTRRDLI--QDQNMDEKGKQRNRRIFGLLMGTLQKFKQESNVATE--QQKRRHEIEQKLEVQAEEEKKQVETERRELFEERRTKQTELRLLEQKVELAHLQEEWNDHNKKIIKYIRTKTKPHLFYIPGRMCPPSQKLFDESQKKLNAIFESRR 273          
BLAST of Pinin, desmosome associated protein vs. Ensembl Xenopus
Match: pnn (pinin, desmosome associated protein [Source:NCBI gene;Acc:448224])

HSP 1 Score: 65.4698 bits (158), Expect = 1.183e-10
Identity = 54/170 (31.76%), Postives = 95/170 (55.88%), Query Frame = 2
Query:  191 DKDGPSL-NSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRK 697
            D   P+L +SVV  +K RTR D +       + K K+R +R+FG LMGTL   K+++  +T   Q   R +IE+K+E   +   + ++ E+ EL   +R +Q +L++L Q+   A   + W    +K+  YIRT   P +FY P  +   +Q   D++ ++++A+ E+R+
Sbjct:  108 DDKKPALQSSVVATSKERTRRDLI--QDQNMDEKGKQRNRRIFGLLMGTLQKFKQESNVATE--QQKRRHEIEQKLEVQAEEEKKQVETERRELFEERRTKQTELRLLEQKVELAHLQEEWNDHNKKIIKYIRTKTKPHLFYIPGRMCPPSQKLFDESQKKLNAIFESRR 273          
BLAST of Pinin, desmosome associated protein vs. Ensembl Mouse
Match: Pnn (pinin [Source:MGI Symbol;Acc:MGI:1100514])

HSP 1 Score: 67.781 bits (164), Expect = 1.864e-11
Identity = 60/195 (30.77%), Postives = 105/195 (53.85%), Query Frame = 2
Query:  188 NDKDGPSL-NSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEIVKAVKYSESHLEGGNMK 769
            +D   P+L +SVV  +K RTR D +       + K K+R +R+FG LMGTL   K+++  +T   +   R +IE+K+E   +   + ++ E+ EL   +R +Q +L++L Q+   A+  + W     K+  YIRT   P +FY P  +   TQ  I+++ R+++A+ E R+    IE  + +   E+     +MK
Sbjct:  105 DDVKKPALQSSVVATSKERTRRDLI--QDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATE--RQKRRQEIEQKLEVQAEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRR----IEFAEQINKMEARPRRQSMK 291          
BLAST of Pinin, desmosome associated protein vs. UniProt/SwissProt
Match: sp|O35691|PININ_MOUSE (Pinin OS=Mus musculus OX=10090 GN=Pnn PE=1 SV=4)

HSP 1 Score: 68.1662 bits (165), Expect = 8.717e-11
Identity = 60/195 (30.77%), Postives = 105/195 (53.85%), Query Frame = 2
Query:  188 NDKDGPSL-NSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEIVKAVKYSESHLEGGNMK 769
            +D   P+L +SVV  +K RTRD   +      + K K+R +R+FG LMGTL   K+++  +T   +   R +IE+K+E   +   + ++ E+ EL   +R +Q +L++L Q+   A+  + W     K+  YIRT   P +FY P  +   TQ  I+++ R+++A+ E R+    IE  + +   E+     +MK
Sbjct:  105 DDVKKPALQSSVVATSKERTRD---LIQDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATE--RQKRRQEIEQKLEVQAEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRR----IEFAEQINKMEARPRRQSMK 290          
BLAST of Pinin, desmosome associated protein vs. UniProt/SwissProt
Match: sp|Q9H307|PININ_HUMAN (Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5)

HSP 1 Score: 67.3958 bits (163), Expect = 1.653e-10
Identity = 60/195 (30.77%), Postives = 105/195 (53.85%), Query Frame = 2
Query:  188 NDKDGPSL-NSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEIVKAVKYSESHLEGGNMK 769
            +D   P+L +SVV  +K RTR D +       + K K+R +R+FG LMGTL   K+++  +T   +   R +IE+K+E   +   + ++ E+ EL   +R +Q +L++L Q+   A+  + W     K+  YIRT   P +FY P  +   TQ  I+++ R+++A+ E R+    IE  + +   E+     +MK
Sbjct:  105 DDVKKPALQSSVVATSKERTRRDLI--QDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATE--RQKRRQEIEQKLEVQAEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRR----IEFAEQINKMEARPRRQSMK 291          
BLAST of Pinin, desmosome associated protein vs. UniProt/SwissProt
Match: sp|Q5R5X0|PININ_PONAB (Pinin OS=Pongo abelii OX=9601 GN=PNN PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.133e-10
Identity = 60/195 (30.77%), Postives = 105/195 (53.85%), Query Frame = 2
Query:  188 NDKDGPSL-NSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEIVKAVKYSESHLEGGNMK 769
            +D   P+L +SVV  +K RTR D +       + K K+R +R+FG LMGTL   K+++  +T   +   R +IE+K+E   +   + ++ E+ EL   +R +Q +L++L Q+   A+  + W     K+  YIRT   P +FY P  +   TQ  I+++ R+++A+ E R+    IE  + +   E+     +MK
Sbjct:  105 DDVKKPALQSSVVATSKERTRRDLI--QDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATE--RQKRRQEIEQKLEVQAEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRR----IEFAEQINKMEARPRRQSMK 291          
BLAST of Pinin, desmosome associated protein vs. UniProt/SwissProt
Match: sp|P79149|PININ_CANLF (Pinin OS=Canis lupus familiaris OX=9615 GN=PNN PE=2 SV=3)

HSP 1 Score: 62.7734 bits (151), Expect = 3.949e-9
Identity = 59/195 (30.26%), Postives = 104/195 (53.33%), Query Frame = 2
Query:  188 NDKDGPSL-NSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEIVKAVKYSESHLEGGNMK 769
            +D   P+L +SVV  +K RTR D +       + K K+R +R+FG LMGTL   K+++  +T   +   R +IE+K+E   +   + ++ E+ EL   +R +Q +L++L Q+   A+  + W     K+  YIRT   P +FY    +   TQ  I+++ R+++A+ E R+    IE  + +   E+     +MK
Sbjct:  105 DDVKKPALQSSVVATSKERTRRDLI--QDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATE--RQKRRQEIEQKLEVQAEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYILGRMCPATQKLIEESQRKMNALFEGRR----IEFAEQINKMEARPRRQSMK 291          
BLAST of Pinin, desmosome associated protein vs. UniProt/SwissProt
Match: sp|P79122|PININ_BOVIN (Pinin OS=Bos taurus OX=9913 GN=PNN PE=2 SV=3)

HSP 1 Score: 59.3066 bits (142), Expect = 4.625e-8
Identity = 56/195 (28.72%), Postives = 103/195 (52.82%), Query Frame = 2
Query:  188 NDKDGPSL-NSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEIVKAVKYSESHLEGGNMK 769
            +D   P+L +SVV  +K R+ +  L + +N +  +  ER   +FG LMGTL   K+++  +T   +   R +IE+K+E   +   + ++ E+ EL   +R +Q +L++L Q+   A+  + W     K+  YIRT   P +FY P  +    +L I+++ R+ +A+ E R+    IE  + +   E+     +MK
Sbjct:  105 DDVKKPALQSSVVATSKERSTERPLFQDQNTDEKETPERPGPIFGLLMGTLQKFKQESTVATE--RQKRRQEIEQKLEVQAEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPAPKL-IEESQRKTNALFEGRR----IEFAEQINKMEARPRRQSMK 292          
BLAST of Pinin, desmosome associated protein vs. TrEMBL
Match: A0A4Z2CWX5 (Pinin OS=Schistosoma japonicum OX=6182 GN=EWB00_007005 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 6.599e-31
Identity = 84/254 (33.07%), Postives = 145/254 (57.09%), Query Frame = 2
Query:   17 LKRTISLCKEGINTADQNLIKLTGR--SYDKTENLPNQRFNKRRINV------------EHEVPSEVKKPRNDKDGPSL-NSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEIVKAVK 733
            LK+ + L KE +   D ++ ++TGR  S  +  ++ N+R   R + +            ++E+  ++K+P +D    S+ +SVV++T  R+R DA      +    +KER +R+ G L GTL   + ++  +   PQ   R  ++ K+E   K   E +++E+ EL R++RE   ++ IL Q+ R    F+ W+ ++EKMKGY RT+K P++FY+P I NE+++ RI+   R IDA+I  R+KKLE E  + V+
Sbjct:    7 LKKDLELAKEQLKIVDNDIKRITGRDPSDRRVGDVNNKRIRPRTVGINQLRPDSLDKVNDNEIFQDIKRPVDDDLKVSIASSVVRVTDTRSRQDA----AKELKKSDKERGRRMLGILQGTLKQFQAESVAAVKKPQMEKRRLVDAKLEARAKEEKENLRRERAELFRARREHHVEVSILQQKMRLLRKFEIWKEQQEKMKGYCRTSKPPYIFYRPKIHNEKSKWRIEAAVRAIDALIARRRKKLETEFEETVQ 256          
BLAST of Pinin, desmosome associated protein vs. TrEMBL
Match: A0A095BX45 (Pinin OS=Schistosoma haematobium OX=6185 GN=MS3_01785 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 9.388e-27
Identity = 82/237 (34.60%), Postives = 136/237 (57.38%), Query Frame = 2
Query:   17 LKRTISLCKEGINTADQNLIKLTGR--SYDKTENLPNQRFNKRRINVEHEVPSEVKKPRNDK-DGPSLNSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEI 718
            LK+ + L KE +   D ++ ++TGR  S  +     ++R   R   V      ++K+P +D       +SVV++T  R+R+DA      +    +KER +R+ G L GTL   + ++  +   PQ   R  ++ K+E   K   E +++E+ EL R++RE   ++ IL Q+ R  + F+ W+ ++EKMKG+ RT+K P++FY+P I NEE++ RI+ T R IDA+I  R+KKLE E 
Sbjct:    7 LKKNLELAKEQLKIVDNDIKRITGRDPSDRRIGEANSKRIRARIAGVNQLSLQDIKRPIDDDLRVSVASSVVRVTDTRSREDA----AKELKKSDKERGRRMLGILQGTLKQFQAESAAAIKKPQMEKRRLVDAKLEARAKEEKENLRRERAELFRTRREHHVEVSILQQKMRLLKKFEIWKEQQEKMKGFCRTSKPPYIFYRPKIHNEESKWRIEVTVRAIDALIARRRKKLETEF 239          
BLAST of Pinin, desmosome associated protein vs. TrEMBL
Match: A0A183KA05 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS11838 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.041e-25
Identity = 84/256 (32.81%), Postives = 141/256 (55.08%), Query Frame = 2
Query:   17 LKRTISLCKEGINTADQNLIKLTGRSYDKTENLPNQR----FNKRRINV-----------------EHEVPSEVKKPRNDK-DGPSLNSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEI 718
            LK+ + L KE +   D ++ ++TGR        P++R     N +RI                   + ++  ++K+P +D       +SVV++T  R+R+DA      +    +KER +R+ G L GTL   + ++  +   PQ   R  ++ K+E   K   E +++E+ EL R++RE   ++ IL Q+ R  + F+ W+ ++EKMKG+ RT+K P++FY+P I NEE++ RI+ TAR IDA+I  R+KKLE E 
Sbjct:    7 LKKNLELAKEQLKIVDNDIKRITGRD-------PSERRIGEANSKRIRARIAGVNQLRPDSSDKVNDDKILQDIKRPIDDDLRVSVASSVVRVTDTRSREDA----AKELKKSDKERGRRMLGILQGTLKQFQAESAAAIKKPQMEKRRLVDAKLEARAKEEKENLRRERAELFRTRREHHVEVSILQQKMRLLKKFEIWKEQQEKMKGFCRTSKPPYIFYRPKIHNEESKWRIEVTARAIDALIARRRKKLETEF 251          
BLAST of Pinin, desmosome associated protein vs. TrEMBL
Match: A0A3Q0KUH4 (Pinn, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 5.446e-24
Identity = 81/249 (32.53%), Postives = 136/249 (54.62%), Query Frame = 2
Query:   17 LKRTISLCKEGINTADQNLIKLTGR--SYDKTENLPNQRFNKRRINVEHEVP------------SEVKKPRNDK-DGPSLNSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEI 718
            LK+ + L KE +   D ++ ++TGR  S  +     ++R   R   V    P             ++K+P +D       +SVV++T  R+R+DA      +    +KER +R+ G L GTL   + ++  +   PQ   R  ++ K+E   +   E +++E+ EL R++RE   ++ IL Q+ R  + F+ W+ ++EKMKG+ RT+K P++FY+P I NEE++ RI+   R IDA+I  R+KKLE E 
Sbjct:    7 LKKNLELAKEQLKIVDNDIKRITGRDPSDRRIGEANSKRIRARIAGVNQLRPDSSDKVDDAKILQDIKRPIDDDLRVSVASSVVRVTDTRSREDA----AKELKKSDKERGRRMLGILQGTLKQFQAESAAAIKKPQMEKRRLVDAKLEARAREEKENLRRERAELFRTRREHHVEVSILQQKMRLLKKFEIWKEQQEKMKGFCRTSKPPYIFYRPKIHNEESKWRIEVAVRAIDALIARRRKKLETEF 251          
BLAST of Pinin, desmosome associated protein vs. TrEMBL
Match: Q5DEZ4 (SJCHGC01029 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 3.884e-23
Identity = 54/141 (38.30%), Postives = 87/141 (61.70%), Query Frame = 2
Query:  311 LFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEIVKAVK 733
            + G L GTL   + ++  +   PQ   R  ++ K+E   K   E +++E+ EL R++RE   ++ IL Q+ R    F+ W+ ++EKMKGY RT+K P++FY+P I NE+++ RI+   R IDA+I  R+KKLE E  + V+
Sbjct:    1 MLGILQGTLKQFQAESVAAVKKPQMEKRRLVDAKLEARAKEEKENLRRERAELFRARREHHVEVSILQQKMRLLRKFEIWKEQQEKMKGYCRTSKPPYIFYRPKIHNEKSKWRIEAAVRAIDALIARRRKKLETEFEETVQ 141          
BLAST of Pinin, desmosome associated protein vs. Ensembl Cavefish
Match: pnn (pinin, desmosome associated protein [Source:NCBI gene;Acc:103028628])

HSP 1 Score: 62.003 bits (149), Expect = 9.597e-10
Identity = 51/169 (30.18%), Postives = 96/169 (56.80%), Query Frame = 2
Query:  203 PSL-NSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKL 706
            P+L +SVV  +K RTR D  +      + K K+R +R+FG LMGTL   K+++  ST+  +   R +IE+K+E   +   + ++ E+ EL   +R +Q +L++L  +   A+  + W +   K+  +IRT   P +FY P  +   TQ  +D++ ++++A+ + R++  
Sbjct:  111 PALQSSVVATSKERTRRD--LIQDQTMDEKGKQRNRRMFGLLMGTLQKFKQESTVSTDRLKR--RQEIEQKLEVQAEQERKKVESERRELFEERRAKQTELRLLEHKVELAQLQEEWNAHNSKIIKFIRTKTKPPIFYLPGRMCSATQKLLDESQKKMNAVFDERREAF 275          
BLAST of Pinin, desmosome associated protein vs. Ensembl Sea Lamprey
Match: pnn (pinin, desmosome associated protein [Source:ZFIN;Acc:ZDB-GENE-060519-3])

HSP 1 Score: 55.8398 bits (133), Expect = 4.616e-9
Identity = 48/154 (31.17%), Postives = 82/154 (53.25%), Query Frame = 2
Query:  212 NSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREI 673
            +SVV   K RTR D  +      + K ++R +R+FG LMGTL   K  AE S  + +   R +IE KVEE  +     +  E+ EL   +R +Q  L++L  + + A   + W +  +K+  +IRT   P +F+ P  +N +TQ  ++++ + +
Sbjct:  117 SSVVNTAKERTRRD--LIHDQNPDEKGRQRNRRMFGLLMGTLQKFK--AEASEENEKQKRRHEIEAKVEEQAEEERRALALERRELFEERRNQQATLRLLEVKVQLAHLQEEWDAHNQKLLPFIRTKTKPHMFFLPAKMNPDTQKLLEESQKTL 266          
BLAST of Pinin, desmosome associated protein vs. Ensembl Nematostella
Match: EDO44058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWZ2])

HSP 1 Score: 51.2174 bits (121), Expect = 4.601e-7
Identity = 67/279 (24.01%), Postives = 118/279 (42.29%), Query Frame = 2
Query:    8 LTELKRTISLCKEGINTADQNLIKLTGRSYDKTENLPNQR-----------------FNKRRIN------------------------VEHEVPSEVKKPRNDKDGPSLNSVVQITKGRTR--------DDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRK 697
            + EL+R + + +EG+   D+ + KLTGR  D +E  P  R                   KRR++                          H + S+ ++  +D   PS+ S V  T    R        DDA          K K R +R+FG L+GTL   K+D+   ++  +   R +I KK+EE      E +  ++ +L  ++R +Q +LK L  +       + W      +   I+T  TP +FY P+   ++TQ  +++++R +   +  R+
Sbjct:    4 VAELRREVEIAREGLKNVDETIKKLTGR--DPSEFRPPGRRVSLKRDFGDRSGLHGPGGKRRVSGDDQSGPRGRLSSRVIVSQTSQVSARHSLDSDGEEEEDDSKKPSIQSSVVATAAPVRLKREPVIADDA----------KTKSRNRRMFGMLLGTLQKFKQDSVSHSDKEKR--REEINKKLEEKEAKEKEEMATQRRDLYNARRAKQAELKRLEWKVELTAMQEEWDQNSLHLCNSIKTKATPPIFYLPSKHTDKTQKLLEESSRAVKRAMAKRR 268          
BLAST of Pinin, desmosome associated protein vs. Ensembl Medaka
Match: pnn (pinin, desmosome associated protein [Source:ZFIN;Acc:ZDB-GENE-060519-3])

HSP 1 Score: 56.9954 bits (136), Expect = 2.799e-8
Identity = 39/142 (27.46%), Postives = 80/142 (56.34%), Query Frame = 2
Query:  299 RCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEIVK 724
            R +R+FG LMGTL   K+++  S+   +   R +IE+K+E   +   + ++ E+ EL   +R +Q +L++L Q+   A+  + W S    +  +IRT   P +FY P  +   +Q  ++++ ++++A+ E R++    ++ K
Sbjct:    8 RNRRMFGLLMGTLQKFKQESNVSSE--KQKRRSEIEQKLEVQAEAEKKKVENERRELFEERRAKQTELRLLEQKVELAQLQEEWTSHNNNLLKFIRTKTKPHIFYLPGKMCSASQKLLEESTKKLNAVFEERREAFAEQLNK 147          
BLAST of Pinin, desmosome associated protein vs. Planmine SMEST
Match: SMESG000043585.1 (SMESG000043585.1)

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 384/384 (100.00%), Postives = 384/384 (100.00%), Query Frame = 2
Query:    2 MDLTELKRTISLCKEGINTADQNLIKLTGRSYDKTENLPNQRFNKRRINVEHEVPSEVKKPRNDKDGPSLNSVVQITKGRTRDDALIXXXXXXXXXXXXRCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEIVKAVKYSESHLEGGNMKIENLNMDIIDRETIMXXXXXXXXXXXXXXXXXXXKARSRSPVDSLAXXXXXXXXXXXXXXXXXXNPTVHEDDHHNQPPVNHQSPAEQCQPXXXXXXXXXXXXXHVVNVKEETDRPLESMIVPEICSQD 1153
            MDLTELKRTISLCKEGINTADQNLIKLTGRSYDKTENLPNQRFNKRRINVEHEVPSEVKKPRNDKDGPSLNSVVQITKGRTRDDALIELKNKENPKEKERCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEIVKAVKYSESHLEGGNMKIENLNMDIIDRETIMNKDPSDINNIISNHNDENKKARSRSPVDSLASEDYEDMIEEIEISMHDENPTVHEDDHHNQPPVNHQSPAEQCQPIEGGINEEISGENHVVNVKEETDRPLESMIVPEICSQD
Sbjct:    1 MDLTELKRTISLCKEGINTADQNLIKLTGRSYDKTENLPNQRFNKRRINVEHEVPSEVKKPRNDKDGPSLNSVVQITKGRTRDDALIELKNKENPKEKERCKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQKEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTPFVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEIVKAVKYSESHLEGGNMKIENLNMDIIDRETIMNKDPSDINNIISNHNDENKKARSRSPVDSLASEDYEDMIEEIEISMHDENPTVHEDDHHNQPPVNHQSPAEQCQPIEGGINEEISGENHVVNVKEETDRPLESMIVPEICSQD 384          
The following BLAST results are available for this feature:
BLAST of Pinin, desmosome associated protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PNN3.443e-1130.77pinin, desmosome associated protein [Source:HGNC S... [more]
back to top
BLAST of Pinin, desmosome associated protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pnn-11.641e-629.71PiNiN nuclear speckle-associated protein and splic... [more]
back to top
BLAST of Pinin, desmosome associated protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pnn2.114e-825.71gene:FBgn0037737 transcript:FBtr0113210[more]
Pnn2.119e-825.71gene:FBgn0037737 transcript:FBtr0082126[more]
back to top
BLAST of Pinin, desmosome associated protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pnn3.906e-828.57pinin, desmosome associated protein [Source:ZFIN;A... [more]
back to top
BLAST of Pinin, desmosome associated protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pnn1.123e-1031.76pinin, desmosome associated protein [Source:NCBI g... [more]
pnn1.126e-1031.76pinin, desmosome associated protein [Source:NCBI g... [more]
pnn1.183e-1031.76pinin, desmosome associated protein [Source:NCBI g... [more]
back to top
BLAST of Pinin, desmosome associated protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Pnn1.864e-1130.77pinin [Source:MGI Symbol;Acc:MGI:1100514][more]
back to top
BLAST of Pinin, desmosome associated protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35691|PININ_MOUSE8.717e-1130.77Pinin OS=Mus musculus OX=10090 GN=Pnn PE=1 SV=4[more]
sp|Q9H307|PININ_HUMAN1.653e-1030.77Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5[more]
sp|Q5R5X0|PININ_PONAB2.133e-1030.77Pinin OS=Pongo abelii OX=9601 GN=PNN PE=2 SV=1[more]
sp|P79149|PININ_CANLF3.949e-930.26Pinin OS=Canis lupus familiaris OX=9615 GN=PNN PE=... [more]
sp|P79122|PININ_BOVIN4.625e-828.72Pinin OS=Bos taurus OX=9913 GN=PNN PE=2 SV=3[more]
back to top
BLAST of Pinin, desmosome associated protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2CWX56.599e-3133.07Pinin OS=Schistosoma japonicum OX=6182 GN=EWB00_00... [more]
A0A095BX459.388e-2734.60Pinin OS=Schistosoma haematobium OX=6185 GN=MS3_01... [more]
A0A183KA051.041e-2532.81Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A3Q0KUH45.446e-2432.53Pinn, putative OS=Schistosoma mansoni OX=6183 PE=4... [more]
Q5DEZ43.884e-2338.30SJCHGC01029 protein OS=Schistosoma japonicum OX=61... [more]
back to top
BLAST of Pinin, desmosome associated protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pnn9.597e-1030.18pinin, desmosome associated protein [Source:NCBI g... [more]
back to top
BLAST of Pinin, desmosome associated protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pnn4.616e-931.17pinin, desmosome associated protein [Source:ZFIN;A... [more]
back to top
BLAST of Pinin, desmosome associated protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pinin, desmosome associated protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO440584.601e-724.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pinin, desmosome associated protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pnn2.799e-827.46pinin, desmosome associated protein [Source:ZFIN;A... [more]
back to top
BLAST of Pinin, desmosome associated protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000043585.10.000e+0100.00SMESG000043585.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025387 ID=SMED30025387|Name=Pinin, desmosome associated protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1458bp
CATGGATCTTACTGAGTTAAAACGGACAATAAGTTTATGCAAAGAAGGCA
TTAATACTGCTGATCAAAATTTGATAAAATTAACTGGTAGAAGTTATGAC
AAAACTGAAAATTTACCAAATCAAAGATTTAACAAACGACGTATTAATGT
TGAACACGAAGTTCCAAGCGAGGTTAAAAAACCAAGAAATGACAAAGATG
GTCCATCATTAAATTCCGTTGTCCAAATTACCAAAGGCCGTACTCGCGAT
GATGCTTTAATAGAATTGAAAAATAAAGAAAATCCCAAAGAAAAAGAACG
ATGCAAAAGGCTTTTTGGTCATTTGATGGGCACATTAAATAGTATAAAAA
AAGATGCAGAAAAATCAACAAATGATCCTCAAAACATAACTCGCTTAAAA
ATTGAGAAAAAAGTCGAAGAGGGCAATAAATTGATCAACGAAACAATTCA
AAAAGAACAAAATGAATTGTTGAGATCAAAACGTGAAAGACAAAATGATT
TGAAAATTTTAAACCAACGCTATCGAGCCGCAGAAGCTTTTGATCGATGG
AGAAGTGAAAAAGAAAAAATGAAAGGCTATATTAGAACAACTAAAACTCC
TTTTGTATTTTATAAACCGACCATTATTAATGAAGAAACCCAATTGAGAA
TCGATCAGACAGCTCGAGAGATTGATGCAATGATTGAAACGAGAAAGAAA
AAATTGGAAATCGAAATTGTGAAAGCCGTTAAATACAGCGAGTCTCATTT
GGAAGGCGGAAACATGAAGATAGAAAACCTAAACATGGATATTATCGATA
GAGAAACAATTATGAATAAAGATCCGAGTGATATAAATAATATAATATCA
AATCACAACGATGAGAATAAAAAAGCCAGAAGTCGCAGCCCAGTCGATTC
GTTGGCCAGTGAAGATTACGAAGATATGATTGAGGAAATCGAGATCTCAA
TGCACGATGAGAATCCGACAGTTCACGAAGACGATCATCACAATCAGCCG
CCGGTTAATCACCAGTCACCGGCGGAACAATGCCAACCGATCGAAGGCGG
TATTAATGAGGAAATCAGTGGTGAAAATCACGTTGTAAATGTCAAAGAAG
AGACAGATCGACCATTGGAATCAATGATTGTTCCTGAGATTTGTTCACAA
GATTGATTCATTAGTTTATTTTTTGTAGTTTTCAATATTTTAAAATATAT
AAAGGCTAAATATCAAATTTTGGTCTGGTTGTCGACTGAATCCCATTTTT
GATGAATTTGCGTAGTGTTTTTCGAATTTTGTGCTATTTATTGTCTGTTT
TATAATTTGATCATTTCATTGGTTAATAATGAATGATTTTGATTGGCTGT
AATTATTGTCATTGACAATTTGATTTATTTTTAAAAAAAACTTAATGAAC
CACTTGAATGCAATTTATTTTTGTCAGTATTTTTATAATAAACGATAAAT
GTTTTAAT
back to top

protein sequence of SMED30025387-orf-1

>SMED30025387-orf-1 ID=SMED30025387-orf-1|Name=SMED30025387-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=385bp
MDLTELKRTISLCKEGINTADQNLIKLTGRSYDKTENLPNQRFNKRRINV
EHEVPSEVKKPRNDKDGPSLNSVVQITKGRTRDDALIELKNKENPKEKER
CKRLFGHLMGTLNSIKKDAEKSTNDPQNITRLKIEKKVEEGNKLINETIQ
KEQNELLRSKRERQNDLKILNQRYRAAEAFDRWRSEKEKMKGYIRTTKTP
FVFYKPTIINEETQLRIDQTAREIDAMIETRKKKLEIEIVKAVKYSESHL
EGGNMKIENLNMDIIDRETIMNKDPSDINNIISNHNDENKKARSRSPVDS
LASEDYEDMIEEIEISMHDENPTVHEDDHHNQPPVNHQSPAEQCQPIEGG
INEEISGENHVVNVKEETDRPLESMIVPEICSQD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0014033neural crest cell differentiation
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006397mRNA processing
GO:0007155cell adhesion
GO:0008380RNA splicing
GO:0016337single organismal cell-cell adhesion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR039853Pinin
IPR006786Pinin_SDK_MemA
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005681spliceosomal complex
GO:0005737cytoplasm
GO:0005911cell-cell junction
GO:0016020membrane
GO:0016607nuclear speck
GO:0030054cell junction
GO:0030057desmosome
GO:0035145exon-exon junction complex
GO:0071013catalytic step 2 spliceosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 210..230
NoneNo IPR availableCOILSCoilCoilcoord: 142..162
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 324..345
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 283..303
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 284..302
IPR006786Pinin/SDK/MemA proteinPFAMPF04696Pinin_SDK_memAcoord: 96..220
e-value: 2.8E-21
score: 75.9
IPR039853PininPANTHERPTHR12707PINNcoord: 61..327