matrix metalloproteinase

Overview
Namematrix metalloproteinase (CCM73860.1)
Smed IDSMED30025379
Length (bp)1219
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of matrix metalloproteinase (SMED30025379) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for matrix metalloproteinase (SMED30025379) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025379

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025379SMESG000049445.1 Contig1109newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025379SMESG000049445.1 Contig1109uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025379SMESG000002706.1 Contig1109newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025379SMESG000002706.1 Contig1109uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
cephalic gangliaSMED30025379SMESG000049445.1 dd_Smed_v4_3902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025379SMESG000049445.1 dd_Smed_v4_3902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30025379SMESG000049445.1 dd_Smed_v4_3902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025379SMESG000049445.1 Contig48552newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025379SMESG000049445.1 Contig48552uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025379SMESG000049445.1 Contig6240newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025379SMESG000049445.1 Contig6240uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
muscle cellSMED30025379SMESG000049445.1 dd_Smed_v4_3902_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30025379SMESG000049445.1 HE998773.1smed_ncbi_20200123PMID:23405188
Isolani et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of matrix metalloproteinase vs. Ensembl Human
Match: MMP19 (matrix metallopeptidase 19 [Source:HGNC Symbol;Acc:HGNC:7165])

HSP 1 Score: 152.14 bits (383), Expect = 1.222e-40
Identity = 86/216 (39.81%), Postives = 121/216 (56.02%), Query Frame = 1
Query:  379 YLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRS-----MFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKF-SRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
            YL +YGY+  P          S    P+++++ ++ FQ+ + L V+G LD+ TR +   PRCG++D   +      + G+W++K+L ++ +  +   L     R A++ AF  W+ V PLTF EV      +  L F  R S      FDG    LAHA  P  G +HFD DE +TEG  RG NLRI+AAHE+GHALGL HS  S+ALMA  Y GY
Sbjct:   31 YLSQYGYLQKP-------LEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILN-LPSTLPPHTARAALRQAFQDWSNVAPLTFQEV-QAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGY 237          
BLAST of matrix metalloproteinase vs. Ensembl Human
Match: MMP19 (matrix metallopeptidase 19 [Source:HGNC Symbol;Acc:HGNC:7165])

HSP 1 Score: 143.28 bits (360), Expect = 1.567e-37
Identity = 86/211 (40.76%), Postives = 113/211 (53.55%), Query Frame = 1
Query:  379 YLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKF-SRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
            YL +YGY+  P          S    P+++++ ++ FQ+ + L V+G LD+ TR +   PRCG++D         + QK LKY  +            R A++ AF  W+ V PLTF EV      +  L F  R S      FDG    LAHA  P  G +HFD DE +TEG  RG NLRI+AAHE+GHALGL HS  S+ALMA  Y GY
Sbjct:   31 YLSQYGYLQKP-------LEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLED--------PFNQKTLKYLLL-----------ARAALRQAFQDWSNVAPLTFQEV-QAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGY 214          
BLAST of matrix metalloproteinase vs. Ensembl Human
Match: MMP13 (matrix metallopeptidase 13 [Source:HGNC Symbol;Acc:HGNC:7159])

HSP 1 Score: 141.354 bits (355), Expect = 1.762e-37
Identity = 86/201 (42.79%), Postives = 116/201 (57.71%), Query Frame = 1
Query:  466 VSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFG---KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTD---GRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQ 1050
            +++ ++  Q   GL+VTG LD+ T    + PRCGV D+   ++F    KW + NL Y+ V   T  +T S V +A + AF  W++VTPL FT + D    + ++ F    H D +PFDG  G LAHAF P     G  HFD DE +T    +GYNL +VAAHE GH+LGL HS D  ALM   Y  YT K+  +L +DD Q
Sbjct:   64 MTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVN-YTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDG-IADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTS-SSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYT-YTGKSHFMLPDDDVQ 260          
BLAST of matrix metalloproteinase vs. Ensembl Human
Match: MMP13 (matrix metallopeptidase 13 [Source:HGNC Symbol;Acc:HGNC:7159])

HSP 1 Score: 140.969 bits (354), Expect = 1.003e-36
Identity = 86/201 (42.79%), Postives = 116/201 (57.71%), Query Frame = 1
Query:  466 VSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFG---KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTD---GRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQ 1050
            +++ ++  Q   GL+VTG LD+ T    + PRCGV D+   ++F    KW + NL Y+ V   T  +T S V +A + AF  W++VTPL FT + D    + ++ F    H D +PFDG  G LAHAF P     G  HFD DE +T    +GYNL +VAAHE GH+LGL HS D  ALM   Y  YT K+  +L +DD Q
Sbjct:   64 MTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVN-YTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDG-IADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTS-SSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYT-YTGKSHFMLPDDDVQ 260          
BLAST of matrix metalloproteinase vs. Ensembl Human
Match: MMP13 (matrix metallopeptidase 13 [Source:HGNC Symbol;Acc:HGNC:7159])

HSP 1 Score: 140.969 bits (354), Expect = 1.261e-36
Identity = 86/201 (42.79%), Postives = 116/201 (57.71%), Query Frame = 1
Query:  466 VSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFG---KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTD---GRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQ 1050
            +++ ++  Q   GL+VTG LD+ T    + PRCGV D+   ++F    KW + NL Y+ V   T  +T S V +A + AF  W++VTPL FT + D    + ++ F    H D +PFDG  G LAHAF P     G  HFD DE +T    +GYNL +VAAHE GH+LGL HS D  ALM   Y  YT K+  +L +DD Q
Sbjct:   64 MTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVN-YTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDG-IADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSS-KGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYT-YTGKSHFMLPDDDVQ 260          
BLAST of matrix metalloproteinase vs. Ensembl Celegans
Match: zmp-3 (Matrix metalloproteinase-C [Source:UniProtKB/Swiss-Prot;Acc:G5EBU3])

HSP 1 Score: 137.502 bits (345), Expect = 2.219e-35
Identity = 88/241 (36.51%), Postives = 118/241 (48.96%), Query Frame = 1
Query:  370 GQMYLVKYGYISIPEKVNQTGFGRSTLLDPKE--VSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFG----KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEER------GYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKN----MPLLNEDD 1044
             + YL  +GY+  P    Q+  G +  +   E      I+ FQ+  G+  TG LD  T+ K  L RCGV D       G    KW +  L Y  +   +  L+   VR AI  A+  W++VTPL F+EV     ++  ++F   +H+D +PFDG  G LAHA  P  G  HFD DE +T  + R        +L  VA HE GH LGL HS D  A+MA FY   TD +     P L  DD
Sbjct:   57 ARSYLQTFGYVP-PSNSLQSRNGMAGDIQSAEQVFKSAIRKFQEFAGIAKTGFLDAATKAKMALSRCGVTDAPLALTSGSSQFKWSKTRLTYS-IESWSSDLSKDDVRRAISEAYGLWSKVTPLEFSEVPAGSTSDIKIRFGVRNHNDPWPFDGEGGVLAHATMPESGMFHFDDDENWTYKDARKIHNNEATDLLAVAIHEGGHTLGLEHSRDENAIMAPFYQKTTDSSGNYVYPNLKSDD 295          
BLAST of matrix metalloproteinase vs. Ensembl Celegans
Match: zmp-5 (Zinc MetalloProtease [Source:UniProtKB/TrEMBL;Acc:O17913])

HSP 1 Score: 108.227 bits (269), Expect = 8.340e-26
Identity = 60/149 (40.27%), Postives = 85/149 (57.05%), Query Frame = 1
Query:  604 WKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEV--FDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPT-DGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNED 1041
            W +  + Y+   P +Q +++S  +     AF  W E T L F  V   DE+K N  + F+   H+D  PFDG+   LAHAFFP   G +HFD DE+++  + +G +L  VA HEIGH+LGL HS +  ++MA FY  YT   M L  +D
Sbjct:   39 WGKSVITYRLKQP-SQRMSLSQQKAVFARAFATWEEHTRLWFVAVDDEDEQKANIDIVFAAGDHEDGEPFDGKGNILAHAFFPRYGGDVHFDEDELWSANKTKGVDLYAVAVHEIGHSLGLKHSSNHLSIMAPFYKQYTGAVMHLHQDD 186          
BLAST of matrix metalloproteinase vs. Ensembl Celegans
Match: zmp-6 (MMP-like protein; Zinc MetalloProtease [Source:UniProtKB/TrEMBL;Acc:G5ECC4])

HSP 1 Score: 102.449 bits (254), Expect = 1.434e-24
Identity = 54/136 (39.71%), Postives = 77/136 (56.62%), Query Frame = 1
Query:  601 KWKQKNLKYKFVGPVTQYLT---MSAVREAIQSAFNYWAEVTPLTFTEV----FDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALM 987
            +WK+  L ++     TQ L    +  VR  +  AFN W+ V+ + F E+      ++  +  + F +  H D FPFDG+DG +AHAF+P DGR+HFD++E ++     G NL   A HEIGH LGL HS D  A M
Sbjct:   48 RWKKHTLTWQLQ---TQNLLDPDVFIVRNTMHRAFNEWSTVSSVDFREIPPDLVTKQPPDIYIAFEKGEHSDGFPFDGQDGVVAHAFYPRDGRLHFDAEEQWSLNSVEGVNLFQTAVHEIGHLLGLEHSMDVRAAM 180          
BLAST of matrix metalloproteinase vs. Ensembl Celegans
Match: zmp-1 (Matrix metalloproteinase-A [Source:UniProtKB/Swiss-Prot;Acc:G5EGM1])

HSP 1 Score: 96.6709 bits (239), Expect = 1.588e-21
Identity = 75/223 (33.63%), Postives = 113/223 (50.67%), Query Frame = 1
Query:  379 YLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFG---------KWKQKNLKY--KFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGR--DGTLAHAFFPTDGRIHFDSDEIFTE---GEERGYN-LRIVAAHEIGHALGLPHSYDSEALMASF 996
            +L KYGY++  +  NQ        L  + +SD +K  Q+  GL+ TG LDE T +  E PRCG  D++               KWK+K + Y  K VG  T+ +++  +R  +  A + W+E   L   E+ +    N ++  S    ++ +P   R    TLAHAFFPT+G+IH +    F      E  G N L  V AHE+GHALG  HS D +++M ++
Sbjct:   29 FLQKYGYLTSGD--NQ--------LSSESLSDALKNMQRMAGLEETGELDERTIQMMERPRCGHPDVEDHQKSRGKRYAPPQFKWKEKIITYGCKAVGTSTR-ISLDDLRRTMHQAASQWSE---LADVEIVESSVKNPMMVISA-GRENHYPCTVRFDTKTLAHAFFPTNGQIHINDRVQFAMTNYTERMGANSLYSVVAHEMGHALGFSHSPDIDSVMFAY 236          
BLAST of matrix metalloproteinase vs. Ensembl Celegans
Match: zmp-2 (Matrix metalloproteinase-B [Source:UniProtKB/Swiss-Prot;Acc:O44836])

HSP 1 Score: 90.5077 bits (223), Expect = 1.949e-19
Identity = 84/273 (30.77%), Postives = 122/273 (44.69%), Query Frame = 1
Query:  370 GQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQ----------TRSMFGKWKQKN-----LKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVT--------PLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDG---------TLAHAFFP-----TDGRIHFDSDE---IFTEGEERGYNLRI---VAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPL----LNEDDK 1047
            GQM   KYGY+         G   S+   P+E    +  FQ+   ++ TG +DE T +    PRC   D++          T S   KW   +     LK+ ++   T  +     R+ ++ AF  W+  +         LTF E   +++ +  + ++  +H DE  FDG +G          LAH FFP      +G IHFD  E   I  +    G N R    V AHEIGHALGL HS  ++ALM  +Y     KN+P+    L+ DDK
Sbjct:   60 GQME--KYGYLK--------GIDHSS---PQEFRQALMFFQEVLEVEQTGNVDEMTVEAASKPRCTQTDVRQEQTKRTKRFTLSKRAKWAHASGQSVTLKW-YISDYTSDIDRLETRKVVEKAFKLWSSQSYIKNEKKVTLTFQEASSKDEADINILWAEGNHGDEHDFDGANGKIEGNKKENVLAHTFFPGYARPLNGDIHFDDAEDWEIDVDQVGHGSNKRFFPYVLAHEIGHALGLDHSQKADALMHPYY-----KNVPINEIQLDIDDK 313          
BLAST of matrix metalloproteinase vs. Ensembl Fly
Match: Mmp1 (gene:FBgn0035049 transcript:FBtr0306656)

HSP 1 Score: 143.28 bits (360), Expect = 1.301e-37
Identity = 105/263 (39.92%), Postives = 134/263 (50.95%), Query Frame = 1
Query:  370 GQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDI----QTRS-----MFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPT-DGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQ-------KNTTDLRS*TNFLCNSTIR 1107
             ++YL ++GY+    +   +    S L D +     I+ FQ   GL +TG LD ET K   LPRCGV+D      +RS        +W+ KNL YK +    + L    V   I  AF  W+E T LTFT        +  +KF    H D   FDG+ GTLAHAFFP   G  HFD  E++T G  RG NL  VAAHE GH+LGL HS  S ALMA FY G+  + +  L+EDDK        + T  LR  TN    +T R
Sbjct:   33 AEIYLSQFGYLPASARNPAS----SGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRVGTGDSRSKRYALQGSRWRVKNLTYK-ISKYPKRLKRVDVDAEIGRAFAVWSEDTDLTFTRK-TSGPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPVFGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGF--EPVFKLDEDDKAAIQSLYGRKTNQLRP-TNVYPATTQR 286          
BLAST of matrix metalloproteinase vs. Ensembl Fly
Match: Mmp1 (gene:FBgn0035049 transcript:FBtr0304010)

HSP 1 Score: 143.28 bits (360), Expect = 1.301e-37
Identity = 105/263 (39.92%), Postives = 134/263 (50.95%), Query Frame = 1
Query:  370 GQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDI----QTRS-----MFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPT-DGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQ-------KNTTDLRS*TNFLCNSTIR 1107
             ++YL ++GY+    +   +    S L D +     I+ FQ   GL +TG LD ET K   LPRCGV+D      +RS        +W+ KNL YK +    + L    V   I  AF  W+E T LTFT        +  +KF    H D   FDG+ GTLAHAFFP   G  HFD  E++T G  RG NL  VAAHE GH+LGL HS  S ALMA FY G+  + +  L+EDDK        + T  LR  TN    +T R
Sbjct:   33 AEIYLSQFGYLPASARNPAS----SGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRVGTGDSRSKRYALQGSRWRVKNLTYK-ISKYPKRLKRVDVDAEIGRAFAVWSEDTDLTFTRK-TSGPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPVFGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGF--EPVFKLDEDDKAAIQSLYGRKTNQLRP-TNVYPATTQR 286          
BLAST of matrix metalloproteinase vs. Ensembl Fly
Match: Mmp1 (gene:FBgn0035049 transcript:FBtr0304009)

HSP 1 Score: 143.28 bits (360), Expect = 1.430e-37
Identity = 105/263 (39.92%), Postives = 134/263 (50.95%), Query Frame = 1
Query:  370 GQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDI----QTRS-----MFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPT-DGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQ-------KNTTDLRS*TNFLCNSTIR 1107
             ++YL ++GY+    +   +    S L D +     I+ FQ   GL +TG LD ET K   LPRCGV+D      +RS        +W+ KNL YK +    + L    V   I  AF  W+E T LTFT        +  +KF    H D   FDG+ GTLAHAFFP   G  HFD  E++T G  RG NL  VAAHE GH+LGL HS  S ALMA FY G+  + +  L+EDDK        + T  LR  TN    +T R
Sbjct:   33 AEIYLSQFGYLPASARNPAS----SGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRVGTGDSRSKRYALQGSRWRVKNLTYK-ISKYPKRLKRVDVDAEIGRAFAVWSEDTDLTFTRK-TSGPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPVFGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGF--EPVFKLDEDDKAAIQSLYGRKTNQLRP-TNVYPATTQR 286          
BLAST of matrix metalloproteinase vs. Ensembl Fly
Match: Mmp1 (gene:FBgn0035049 transcript:FBtr0304011)

HSP 1 Score: 143.28 bits (360), Expect = 1.430e-37
Identity = 105/263 (39.92%), Postives = 134/263 (50.95%), Query Frame = 1
Query:  370 GQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDI----QTRS-----MFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPT-DGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQ-------KNTTDLRS*TNFLCNSTIR 1107
             ++YL ++GY+    +   +    S L D +     I+ FQ   GL +TG LD ET K   LPRCGV+D      +RS        +W+ KNL YK +    + L    V   I  AF  W+E T LTFT        +  +KF    H D   FDG+ GTLAHAFFP   G  HFD  E++T G  RG NL  VAAHE GH+LGL HS  S ALMA FY G+  + +  L+EDDK        + T  LR  TN    +T R
Sbjct:   33 AEIYLSQFGYLPASARNPAS----SGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRVGTGDSRSKRYALQGSRWRVKNLTYK-ISKYPKRLKRVDVDAEIGRAFAVWSEDTDLTFTRK-TSGPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPVFGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGF--EPVFKLDEDDKAAIQSLYGRKTNQLRP-TNVYPATTQR 286          
BLAST of matrix metalloproteinase vs. Ensembl Fly
Match: Mmp1 (gene:FBgn0035049 transcript:FBtr0304006)

HSP 1 Score: 143.28 bits (360), Expect = 1.533e-37
Identity = 105/263 (39.92%), Postives = 134/263 (50.95%), Query Frame = 1
Query:  370 GQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDI----QTRS-----MFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPT-DGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQ-------KNTTDLRS*TNFLCNSTIR 1107
             ++YL ++GY+    +   +    S L D +     I+ FQ   GL +TG LD ET K   LPRCGV+D      +RS        +W+ KNL YK +    + L    V   I  AF  W+E T LTFT        +  +KF    H D   FDG+ GTLAHAFFP   G  HFD  E++T G  RG NL  VAAHE GH+LGL HS  S ALMA FY G+  + +  L+EDDK        + T  LR  TN    +T R
Sbjct:   33 AEIYLSQFGYLPASARNPAS----SGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRVGTGDSRSKRYALQGSRWRVKNLTYK-ISKYPKRLKRVDVDAEIGRAFAVWSEDTDLTFTRK-TSGPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPVFGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGF--EPVFKLDEDDKAAIQSLYGRKTNQLRP-TNVYPATTQR 286          
BLAST of matrix metalloproteinase vs. Ensembl Zebrafish
Match: mmp19 (matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GENE-100308-3])

HSP 1 Score: 157.918 bits (398), Expect = 4.645e-43
Identity = 98/220 (44.55%), Postives = 126/220 (57.27%), Query Frame = 1
Query:  370 GQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKD------IQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDD-EFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
             Q YL ++GY+  P  +N      S+  D K     + LFQ+ +GL VTG LD  T  K   PRCGV+D       + R   G W++KNL Y+     T  +  SA + AI++AF YW++VTPL+FTE+         ++ S +  D    PFDG    LAHA  P  G +HFD DE +TEG+  G NLRIVAAHEIGHALGL HS  S ALMA+ Y GY
Sbjct:   32 AQTYLRRFGYLDTP--LNPEAQRDSSEWDMKV---ALSLFQRVSGLPVTGNLDRATVFKMREPRCGVEDPFNQKSFKYRRFGGYWRKKNLTYRIYN-YTPDMGKSATQTAIRTAFKYWSDVTPLSFTEIHFGTAD---IRISFHKRDGCPSPFDGPGHVLAHAEAPPSGIVHFDEDEFWTEGKYYGSNLRIVAAHEIGHALGLGHSQYSSALMAAHYTGY 242          
BLAST of matrix metalloproteinase vs. Ensembl Zebrafish
Match: mmp13a (matrix metallopeptidase 13a [Source:ZFIN;Acc:ZDB-GENE-031202-2])

HSP 1 Score: 139.813 bits (351), Expect = 1.572e-36
Identity = 83/195 (42.56%), Postives = 114/195 (58.46%), Query Frame = 1
Query:  478 IKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFG---KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDG---RIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDD 1044
            +K  QQ   LKV+G LD+ET +  + PRCGV DI+  S F    KWK+  L Y+ +   T  ++++ V ++I  A   WA+VTPL FT ++     + ++ F+   H D +PFDG +G LAHAF P +G     HFD DE F+    + YNL +VAAHE GH+LGL HS D  ALM   Y  Y D +  +L  DD
Sbjct:   67 LKEMQQFFKLKVSGKLDQETLEVMKKPRCGVPDIKAYSTFAGDYKWKKHQLTYR-IENYTPDMSVAEVDDSISKALKVWADVTPLRFTRIY-SGTADIMISFATGDHRDGYPFDGPNGFLAHAFPPFEGIGGDAHFDDDETFSYRSPQYYNLFLVAAHEFGHSLGLEHSQDPGALMYPTYV-YRDVDRFVLPRDD 258          
BLAST of matrix metalloproteinase vs. Ensembl Zebrafish
Match: mmp19 (matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GENE-100308-3])

HSP 1 Score: 136.346 bits (342), Expect = 1.715e-35
Identity = 81/168 (48.21%), Postives = 101/168 (60.12%), Query Frame = 1
Query:  523 LDEETRKKFELPRCGVKD-IQTRSM----FGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDD-EFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
            LD  T  K   PRCGV+D    +S     FG W++KNL Y+     T  +  SA + AI++AF YW++VTPL+FTE+         ++ S +  D    PFDG    LAHA  P  G +HFD DE +TEG+  G NLRIVAAHEIGHALGL HS  S ALMA+ Y GY
Sbjct:    1 LDRATVFKMREPRCGVEDPFNQKSFKYRRFGYWRKKNLTYRIYN-YTPDMGKSATQTAIRTAFKYWSDVTPLSFTEIHFGTAD---IRISFHKRDGCPSPFDGPGHVLAHAEAPPSGIVHFDEDEFWTEGKYYGSNLRIVAAHEIGHALGLGHSQYSSALMAAHYTGY 164          
BLAST of matrix metalloproteinase vs. Ensembl Zebrafish
Match: mmp13a (matrix metallopeptidase 13a [Source:ZFIN;Acc:ZDB-GENE-031202-2])

HSP 1 Score: 134.42 bits (337), Expect = 1.729e-34
Identity = 83/200 (41.50%), Postives = 115/200 (57.50%), Query Frame = 1
Query:  463 EVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFG---KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDG---RIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDD 1044
            ++S  +K  QQ   LKVTG LD+ET +  + PRCGV DI+  S F    KWK+  L Y+ +   T  ++++ V ++I  A   WA+VTPL FT ++     + ++ F+   H D +PFDG +G LAHA+ P +G     HFD DE F+    + Y L  VAAHE GH+LGL HS D  ALM   Y  Y D +  +L  DD
Sbjct:   63 DMSLRLKEMQQFFKLKVTGKLDQETLEVMKKPRCGVPDIKAYSTFPGDYKWKKHQLTYR-IENYTLDMSVAEVDDSISRALKVWADVTPLRFTRIY-SGTADIMIFFATGDHGDGYPFDGPNGFLAHAYPPYEGVGGDAHFDDDETFSYRSPQYYTLFSVAAHEFGHSLGLGHSRDPGALMYPTYV-YRDMDRFILPRDD 259          
BLAST of matrix metalloproteinase vs. Ensembl Zebrafish
Match: mmp20b (matrix metallopeptidase 20b (enamelysin) [Source:ZFIN;Acc:ZDB-GENE-100603-3])

HSP 1 Score: 131.724 bits (330), Expect = 1.883e-33
Identity = 83/202 (41.09%), Postives = 113/202 (55.94%), Query Frame = 1
Query:  469 SDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMF--GKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTD---GRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQKNT 1059
            S  +K  Q   GL  TG L+ +T      PRCGV D++  S     +WK+  + Y  VG  T  L ++AV + I SA + WA+ +PLTF   +  +  + +++F    H D FPFDG DGTLAHAF P +   G +HFD  E++T G   G+NL +VAAHE GHALGL HS   E++M   Y      N+ L +ED    NT
Sbjct:   69 SSKLKNMQGFFGLNGTGTLNADTLAVMRTPRCGVSDVEDYSHRRGNRWKKNIITYG-VGRYTNDLPVNAVDDLISSALDVWAKASPLTFLRSYSHQ-ADIMVEFVGKEHGDFFPFDGPDGTLAHAFGPGEGIGGDVHFDEAEVWTAGYN-GFNLYVVAAHEFGHALGLKHSQLPESVMYPTYKRRKTHNL-LSSEDIININT 266          
BLAST of matrix metalloproteinase vs. Ensembl Xenopus
Match: ENSXETT00000046574.1 (matrix metallopeptidase 8 [Source:NCBI gene;Acc:100494588])

HSP 1 Score: 149.828 bits (377), Expect = 4.044e-40
Identity = 95/216 (43.98%), Postives = 122/216 (56.48%), Query Frame = 1
Query:  415 KVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMF---GKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTD---GRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDD 1044
            KV + G  RS LLD       I+  Q   GL+VT  L+EET    + PRCGV DI   S F     WK+K+L Y+ +   T  +T + V  AI+ AF  W++V PLTFT ++D   ++  + F+   H D  PFDG  G LAHAF P D   G +HFD DE +T G   G NL +VAAHE+GH+LGL HS D  ALM   Y  Y + N   L +DD
Sbjct:   35 KVRKLGTSRSALLDK------IQKMQNFFGLEVTARLNEETIDVMKQPRCGVPDIARFSTFSGNAVWKKKDLTYRILN-YTPDMTRNDVDRAIEKAFKVWSDVVPLTFTRIYDR-VSDIEMLFAYRDHKDSLPFDGPSGILAHAFAPGDNIGGDVHFDEDEKWTSGSA-GTNLFLVAAHELGHSLGLDHSNDPNALMYPTYH-YINPNTFQLPQDD 240          
BLAST of matrix metalloproteinase vs. Ensembl Xenopus
Match: ENSXETT00000046498.1 (matrix metalloproteinase-18-like [Source:NCBI gene;Acc:100489735])

HSP 1 Score: 148.673 bits (374), Expect = 7.809e-40
Identity = 85/195 (43.59%), Postives = 116/195 (59.49%), Query Frame = 1
Query:  478 IKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFGK---WKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTD---GRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDD 1044
            I+  Q   GL+VT  +D+E  +  + PRCGV +I   S F +   WK+K+L Y+ +   T ++T   V  AI+ AF  W++V PLTFT ++D   ++  + F+   H D FPFDG  G LAH F P D   G +HFD+DE +T G   G NL +VAAHE+GH+LGL HS D  ALM   Y  Y + N   L+EDD
Sbjct:   66 IRWMQDVLGLEVTARMDKENIEAMKQPRCGVPNIGRFSAFPRNPVWKKKDLTYRILN-YTSHMTRDEVDRAIEKAFKVWSDVVPLTFTRIYDR-VSDIEMSFASGDHKDAFPFDGPAGILAHTFAPGDNTGGDVHFDADETWTSGSA-GTNLFLVAAHELGHSLGLDHSNDPSALMYPTYH-YINPNTLQLSEDD 256          
BLAST of matrix metalloproteinase vs. Ensembl Xenopus
Match: ENSXETT00000046522.1 (matrix metalloproteinase-18-like [Source:NCBI gene;Acc:100489735])

HSP 1 Score: 148.288 bits (373), Expect = 1.061e-39
Identity = 85/195 (43.59%), Postives = 116/195 (59.49%), Query Frame = 1
Query:  478 IKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFGK---WKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTD---GRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDD 1044
            I+  Q   GL+VT  +D+E  +  + PRCGV +I   S F +   WK+K+L Y+ +   T ++T   V  AI+ AF  W++V PLTFT ++D   ++  + F+   H D FPFDG  G LAH F P D   G +HFD+DE +T G   G NL +VAAHE+GH+LGL HS D  ALM   Y  Y + N   L+EDD
Sbjct:   37 IRWMQDVLGLEVTARMDKENIEAMKQPRCGVPNIGRFSAFPRNPVWKKKDLTYRILN-YTSHMTRDEVDRAIEKAFKVWSDVVPLTFTRIYDRV-SDIEMSFASGDHKDAFPFDGPAGILAHTFAPGDNTGGDVHFDADETWTSGSA-GTNLFLVAAHELGHSLGLDHSNDPSALMYPTYH-YINPNTLQLSEDD 227          
BLAST of matrix metalloproteinase vs. Ensembl Xenopus
Match: ENSXETT00000046328.1 (matrix metalloproteinase-18-like [Source:NCBI gene;Acc:100489735])

HSP 1 Score: 148.288 bits (373), Expect = 2.273e-39
Identity = 85/195 (43.59%), Postives = 116/195 (59.49%), Query Frame = 1
Query:  478 IKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFGK---WKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTD---GRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDD 1044
            I+  Q   GL+VT  +D+E  +  + PRCGV +I   S F +   WK+K+L Y+ +   T ++T   V  AI+ AF  W++V PLTFT ++D   ++  + F+   H D FPFDG  G LAH F P D   G +HFD+DE +T G   G NL +VAAHE+GH+LGL HS D  ALM   Y  Y + N   L+EDD
Sbjct:   57 IRWMQDVLGLEVTARMDKENIEAMKQPRCGVPNIGRFSAFPRNPVWKKKDLTYRILN-YTSHMTRDEVDRAIEKAFKVWSDVVPLTFTRIYDR-VSDIEMSFASGDHKDAFPFDGPAGILAHTFAPGDNTGGDVHFDADETWTSGSA-GTNLFLVAAHELGHSLGLDHSNDPSALMYPTYH-YINPNTLQLSEDD 247          
BLAST of matrix metalloproteinase vs. Ensembl Xenopus
Match: ENSXETT00000027926.1 (matrix metalloproteinase-18-like [Source:NCBI gene;Acc:100491214])

HSP 1 Score: 147.517 bits (371), Expect = 2.820e-39
Identity = 93/210 (44.29%), Postives = 119/210 (56.67%), Query Frame = 1
Query:  433 FGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMF---GKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTD---GRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDD 1044
            F RS LLD       I+  Q   GL+VT  L+EET    + PRCGV DI   S F     WK+K+L Y+ +   T  +T + V  AI+ AF  W++V PLTFT ++D   ++  + F+   H D  PFDG  G LAHAF P D   G +HFD DE +T G   G NL +VAAHE+GH+LGL HS D  ALM   Y  Y + N   L +DD
Sbjct:   51 FNRSALLD------KIQKMQNFFGLEVTARLNEETIDVMKQPRCGVPDIARFSTFSGNAVWKKKDLTYRILN-YTPDMTRNDVDRAIEKAFKVWSDVVPLTFTRIYDR-VSDIEMLFAYRDHKDSLPFDGPSGILAHAFAPGDNIGGDVHFDEDERWTSGSA-GTNLFLVAAHELGHSLGLDHSNDPNALMYPTYH-YINPNTFQLPQDD 250          
BLAST of matrix metalloproteinase vs. Ensembl Mouse
Match: Mmp19 (matrix metallopeptidase 19 [Source:MGI Symbol;Acc:MGI:1927899])

HSP 1 Score: 160.229 bits (404), Expect = 1.327e-43
Identity = 89/218 (40.83%), Postives = 131/218 (60.09%), Query Frame = 1
Query:  379 YLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRS-----MFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEV---FDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
            YL++YGY+  P +    G     L D   +++ ++ FQ+ +GL ++G +D+ TR + + PRCG++D   +      + G W++KNL ++    V   L++  VR A+  AF YW+ V PLTF EV   + + + +F  + S Y  +    FDG    LAHA  P  G IHFD DE++TEG  +G NLRI+AAHE+GHALGL HS  ++ALMA  YAGY
Sbjct:   32 YLLQYGYLQKPLE----GADDFRLED---ITEALRTFQEASGLPISGQMDDATRARMKQPRCGLEDPFNQKSLKYLLLGHWRKKNLTFRIFN-VPSTLSLPRVRAALHQAFKYWSSVAPLTFREVKAGWADIRLSFHGRQSLYCSNT---FDGPGKVLAHADIPELGSIHFDKDELWTEGTYQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGY 238          
BLAST of matrix metalloproteinase vs. Ensembl Mouse
Match: Mmp13 (matrix metallopeptidase 13 [Source:MGI Symbol;Acc:MGI:1340026])

HSP 1 Score: 147.517 bits (371), Expect = 3.193e-39
Identity = 88/199 (44.22%), Postives = 115/199 (57.79%), Query Frame = 1
Query:  472 DGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFG---KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTD---GRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQ 1050
            D ++  Q   GL+VTG LD+ T      PRCGV D+   ++F    KW Q NL Y+ V   T  ++ S V +A + AF  W++VTPL FT ++D    + ++ F    H D +PFDG  G LAHAF P     G  HFD DE +T    +GYNL IVAAHE+GH+LGL HS D  ALM   Y  YT K+  +L +DD Q
Sbjct:   67 DRLREMQSFFGLEVTGKLDDPTLDIMRKPRCGVPDVGEYNVFPRTLKWSQTNLTYRIVN-YTPDMSHSEVEKAFRKAFKVWSDVTPLNFTRIYDG-TADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSS-KGYNLFIVAAHELGHSLGLDHSKDPGALMFPIYT-YTGKSHFMLPDDDVQ 261          
BLAST of matrix metalloproteinase vs. Ensembl Mouse
Match: Mmp19 (matrix metallopeptidase 19 [Source:MGI Symbol;Acc:MGI:1927899])

HSP 1 Score: 140.969 bits (354), Expect = 4.718e-37
Identity = 75/170 (44.12%), Postives = 104/170 (61.18%), Query Frame = 1
Query:  523 LDEETRKKFELPRCGVKDIQTRS-----MFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEV---FDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
            +D+ TR + + PRCG++D   +      + G W++KNL ++    V   L++  VR A+  AF YW+ V PLTF EV   + + + +F  + S Y  +    FDG    LAHA  P  G IHFD DE++TEG  +G NLRI+AAHE+GHALGL HS  ++ALMA  YAGY
Sbjct:    1 MDDATRARMKQPRCGLEDPFNQKSLKYLLLGHWRKKNLTFRIFN-VPSTLSLPRVRAALHQAFKYWSSVAPLTFREVKAGWADIRLSFHGRQSLYCSNT---FDGPGKVLAHADIPELGSIHFDKDELWTEGTYQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGY 166          
BLAST of matrix metalloproteinase vs. Ensembl Mouse
Match: Mmp1b (matrix metallopeptidase 1b (interstitial collagenase) [Source:MGI Symbol;Acc:MGI:1933847])

HSP 1 Score: 140.198 bits (352), Expect = 1.204e-36
Identity = 85/205 (41.46%), Postives = 122/205 (59.51%), Query Frame = 1
Query:  460 KEV-SDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMF---GKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFP---TDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQK 1053
            KEV ++ ++  QQ  GLKVTG  D ET +  + PRCGV D+   ++     +W + +L Y  +   T YL+ + V +AI  AF  W++VTPLTF  VF+EE  + +L F R  H D + FDG     AHAF P     G +H+D D+ +T+  E  +NL  V AHE+GH+LGL HS D EALM   Y  +++K+  +LN+DD  +
Sbjct:   54 KEVMAEKLRQMQQLFGLKVTGNSDPETLRAMKKPRCGVPDVAPYAITHNNPRWTKTHLTYSILN-YTPYLSKAVVEDAIARAFRVWSDVTPLTFQRVFEEEG-DIVLSFHRGDHGDLYTFDGSKYHFAHAFLPGLGLGGNVHYDLDQKWTDNNE-DFNLFYVTAHELGHSLGLSHSNDEEALMFPSYT-WSNKDF-VLNQDDINR 253          
BLAST of matrix metalloproteinase vs. Ensembl Mouse
Match: Mmp24 (matrix metallopeptidase 24 [Source:MGI Symbol;Acc:MGI:1341867])

HSP 1 Score: 137.502 bits (345), Expect = 4.517e-35
Identity = 94/245 (38.37%), Postives = 130/245 (53.06%), Query Frame = 1
Query:  370 GQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKD---IQTR------SMFG-KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEV------FDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFP---TDGRIHFDSDEIFTEGEER--GYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNED 1041
            GQ +L  YGY+ +P +        S L   K +   +   QQ  G+ VTG+LD+ T +  + PRCGV D   +  R      ++ G KW+QK++ Y  +   T  +     R+AI+ AF+ W +VTPLTF EV       D ++ + ++ F+   H D  PFDG  G LAHA+FP     G  HFDSDE +T G     G +L +VA HE+GHALGL HS D  A+MA FY      N  L  +D
Sbjct:   54 GQNWLKSYGYL-LPYESRA-----SALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYS-IHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDD 291          
BLAST of matrix metalloproteinase vs. UniProt/SwissProt
Match: sp|Q9JHI0|MMP19_MOUSE (Matrix metalloproteinase-19 OS=Mus musculus OX=10090 GN=Mmp19 PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 9.279e-43
Identity = 89/218 (40.83%), Postives = 131/218 (60.09%), Query Frame = 1
Query:  379 YLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRS-----MFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEV---FDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
            YL++YGY+  P +    G     L D   +++ ++ FQ+ +GL ++G +D+ TR + + PRCG++D   +      + G W++KNL ++    V   L++  VR A+  AF YW+ V PLTF EV   + + + +F  + S Y  +    FDG    LAHA  P  G IHFD DE++TEG  +G NLRI+AAHE+GHALGL HS  ++ALMA  YAGY
Sbjct:   32 YLLQYGYLQKPLE----GADDFRLED---ITEALRTFQEASGLPISGQMDDATRARMKQPRCGLEDPFNQKSLKYLLLGHWRKKNLTFRIFN-VPSTLSLPRVRAALHQAFKYWSSVAPLTFREVKAGWADIRLSFHGRQSLYCSNT---FDGPGKVLAHADIPELGSIHFDKDELWTEGTYQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGY 238          
BLAST of matrix metalloproteinase vs. UniProt/SwissProt
Match: sp|Q99542|MMP19_HUMAN (Matrix metalloproteinase-19 OS=Homo sapiens OX=9606 GN=MMP19 PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 5.869e-40
Identity = 86/216 (39.81%), Postives = 121/216 (56.02%), Query Frame = 1
Query:  379 YLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRS-----MFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKF-SRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
            YL +YGY+  P          S    P+++++ ++ FQ+ + L V+G LD+ TR +   PRCG++D   +      + G+W++K+L ++ +  +   L     R A++ AF  W+ V PLTF EV      +  L F  R S      FDG    LAHA  P  G +HFD DE +TEG  RG NLRI+AAHE+GHALGL HS  S+ALMA  Y GY
Sbjct:   31 YLSQYGYLQKP-------LEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILN-LPSTLPPHTARAALRQAFQDWSNVAPLTFQEV-QAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGY 237          
BLAST of matrix metalloproteinase vs. UniProt/SwissProt
Match: sp|P33435|MMP13_MOUSE (Collagenase 3 OS=Mus musculus OX=10090 GN=Mmp13 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 2.234e-38
Identity = 88/199 (44.22%), Postives = 115/199 (57.79%), Query Frame = 1
Query:  472 DGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFG---KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTD---GRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQ 1050
            D ++  Q   GL+VTG LD+ T      PRCGV D+   ++F    KW Q NL Y+ V   T  ++ S V +A + AF  W++VTPL FT ++D    + ++ F    H D +PFDG  G LAHAF P     G  HFD DE +T    +GYNL IVAAHE+GH+LGL HS D  ALM   Y  YT K+  +L +DD Q
Sbjct:   67 DRLREMQSFFGLEVTGKLDDPTLDIMRKPRCGVPDVGEYNVFPRTLKWSQTNLTYRIVN-YTPDMSHSEVEKAFRKAFKVWSDVTPLNFTRIYDG-TADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSS-KGYNLFIVAAHELGHSLGLDHSKDPGALMFPIYT-YTGKSHFMLPDDDVQ 261          
BLAST of matrix metalloproteinase vs. UniProt/SwissProt
Match: sp|P23097|MMP13_RAT (Collagenase 3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Mmp13 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 7.458e-38
Identity = 88/199 (44.22%), Postives = 113/199 (56.78%), Query Frame = 1
Query:  472 DGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFG---KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFP---TDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQ 1050
            D ++  Q   GL VTG LD+ T      PRCGV D+   ++F    KW Q NL Y+ V   T  ++ S V +A + AF  W++VTPL FT + D    + ++ F    H D +PFDG  G LAHAF P     G  HFD DE +T    +GYNL IVAAHE+GH+LGL HS D  ALM   Y  YT K+  +L +DD Q
Sbjct:   61 DRLREMQSFFGLDVTGKLDDPTLDIMRKPRCGVPDVGVYNVFPRTLKWSQTNLTYRIVN-YTPDISHSEVEKAFRKAFKVWSDVTPLNFTRIHDG-TADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNLGGDAHFDDDETWTS-SSKGYNLFIVAAHELGHSLGLDHSKDPGALMFPIYT-YTGKSHFMLPDDDVQ 255          
BLAST of matrix metalloproteinase vs. UniProt/SwissProt
Match: sp|O77656|MMP13_BOVIN (Collagenase 3 OS=Bos taurus OX=9913 GN=MMP13 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 7.654e-38
Identity = 94/234 (40.17%), Postives = 125/234 (53.42%), Query Frame = 1
Query:  367 FGQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFG---KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTD---GRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQ 1050
            F + YL  Y Y   P  + +     S +       D ++  Q   GL+VTG LD+ T    + PRCGV D+   ++F    KW + NL Y+ V   T  LT S V +A + AF  W++VTPL FT + +    + ++ F    H D +PFDG  G LAHAF P     G  HFD DE +T    +GYNL +VAAHE GH+LGL HS D  ALM   Y  YT K+  +L +DD Q
Sbjct:   38 FAESYLKSYYYPQNPAGILKKTAASSVI-------DRLREMQSFFGLEVTGRLDDNTLDIMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVN-YTPDLTHSEVEKAFRKAFKVWSDVTPLNFTRIHNG-TADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTS-SSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYT-YTGKSHFMLPDDDVQ 260          
BLAST of matrix metalloproteinase vs. TrEMBL
Match: A0A090C5X6 (Matrix metalloproteinase OS=Schmidtea mediterranea OX=79327 GN=mmpb PE=2 SV=1)

HSP 1 Score: 518.464 bits (1334), Expect = 1.780e-177
Identity = 264/264 (100.00%), Postives = 264/264 (100.00%), Query Frame = 1
Query:  262 MNPVFYRLIKWILIFGNXXXXXXXXXXXXXXXRKLFGQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQK 1053
            MNPVFYRLIKWILIFGNVVSVSVAATTPSPSSRKLFGQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQK
Sbjct:    1 MNPVFYRLIKWILIFGNVVSVSVAATTPSPSSRKLFGQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQK 264          

HSP 2 Score: 59.6918 bits (143), Expect = 7.906e-6
Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 2
Query: 1049 KKIQQIYGRKPISSVTPRSEKSTKRRRMXXXXXXXXXXXXXXQDLV 1186
            +KIQQIYGRKPISSVTPRSEKSTKRRRMTRLTTDSTTNPSTTQDLV
Sbjct:  263 QKIQQIYGRKPISSVTPRSEKSTKRRRMTRLTTDSTTNPSTTQDLV 308          
BLAST of matrix metalloproteinase vs. TrEMBL
Match: W5M9J9 (Matrix metallopeptidase 19 OS=Lepisosteus oculatus OX=7918 PE=3 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 4.845e-47
Identity = 100/227 (44.05%), Postives = 132/227 (58.15%), Query Frame = 1
Query:  379 YLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMF-----GKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDD 1044
            YL +YGY+S P     +GF       P+E+ + +++FQ+   L VTG +D+ T      PRCG++D   +  F     G+W++KNL Y+ +   T  L ++  R AIQSAF+YW+EV PLTF EV    + +  + F R SH     FDG    LAHA  P  G +HFD DE +TEG  RG NLRI+AAHEIGHALGL HS    ALM   Y GY  K+   L+ DD
Sbjct:   34 YLKQYGYLSTPLDPQASGF------QPEEIEEALRVFQRVTQLPVTGTIDKATLAMMRRPRCGIEDPFNQKTFKYRLLGRWRKKNLTYR-IHNHTPDLGLAETRAAIQSAFHYWSEVAPLTFQEV-TGGRADIKISFHRRSHACSVAFDGPGRVLAHADVPESGIVHFDEDEYWTEGTSRGANLRIIAAHEIGHALGLGHSQYPSALMGPVYNGY--KSNFWLHPDD 250          
BLAST of matrix metalloproteinase vs. TrEMBL
Match: A0A3P9ANV0 (ZnMc domain-containing protein OS=Esox lucius OX=8010 PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 3.928e-46
Identity = 92/218 (42.20%), Postives = 128/218 (58.72%), Query Frame = 1
Query:  373 QMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKD------IQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
            Q+YL  YGY+  P        G + +   +E+++ +K+FQ+   L V+G L+E T    + PRCG++D      ++ R +   W++K L Y+     T  L ++  R A+QSAF YW+EV+PLTF EV    + +  + F +       PFDG  G LAHA  P  G +HFD DE++TEG+  G NLRIVAAHEIGHALGL HS  S ALM   Y+GY
Sbjct:   18 QVYLRTYGYLHRP-----LDSGMNHVHQAEEITEALKIFQKATNLTVSGTLNEATMSMMKQPRCGIRDSFSDKSLKYRVLGSIWRKKRLTYRIYSYTTD-LGLAKTRAALQSAFRYWSEVSPLTFQEVLFPGRADIKISFHKKDRSCPVPFDGPGGVLAHADNPESGIVHFDEDELWTEGKSSGPNLRIVAAHEIGHALGLGHSQYSNALMGPVYSGY 229          
BLAST of matrix metalloproteinase vs. TrEMBL
Match: A0A3B4BFY4 (ZnMc domain-containing protein OS=Periophthalmus magnuspinnatus OX=409849 PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.020e-45
Identity = 96/220 (43.64%), Postives = 126/220 (57.27%), Query Frame = 1
Query:  367 FGQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKD------IQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
              Q YL KYGY+ IP       +       P+E+S+ ++ FQ+   L V+GI D  T +  + PRCG++D      ++ R M G+WK+K L Y+     +  L     R AIQ+AF YW+EV+PL F E++   K +  + F R       PFDGR   LAHA  P  G IHFD+DE++TEG   G NLRIVAAHEIGHALGL HS    ALM   Y+GY
Sbjct:   20 LNQAYLQKYGYLHIPLSAKPLNY------RPEELSNALRTFQKTTNLSVSGIFDVATLRMMDKPRCGLEDSGSDETLRYRVM-GQWKKKFLTYRIYNFASD-LGQGKTRSAIQAAFRYWSEVSPLRFRELY-SGKADIKISFHRKEKSCPVPFDGRGHVLAHADAPESGLIHFDADELWTEGRSSGSNLRIVAAHEIGHALGLGHSQYYSALMGPVYSGY 230          
BLAST of matrix metalloproteinase vs. TrEMBL
Match: A0A3P8Z9P3 (ZnMc domain-containing protein OS=Esox lucius OX=8010 PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 2.348e-45
Identity = 91/217 (41.94%), Postives = 127/217 (58.53%), Query Frame = 1
Query:  376 MYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKD------IQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
            +YL  YGY+  P        G + +   +E+++ +K+FQ+   L V+G L+E T    + PRCG++D      ++ R +   W++K L Y+     T  L ++  R A+QSAF YW+EV+PLTF EV    + +  + F +       PFDG  G LAHA  P  G +HFD DE++TEG+  G NLRIVAAHEIGHALGL HS  S ALM   Y+GY
Sbjct:   33 VYLRTYGYLHRP-----LDSGMNHVHQAEEITEALKIFQKATNLTVSGTLNEATMSMMKQPRCGIRDSFSDKSLKYRVLGSIWRKKRLTYRIYSYTTD-LGLAKTRAALQSAFRYWSEVSPLTFQEVLFPGRADIKISFHKKDRSCPVPFDGPGGVLAHADNPESGIVHFDEDELWTEGKSSGPNLRIVAAHEIGHALGLGHSQYSNALMGPVYSGY 243          
BLAST of matrix metalloproteinase vs. Ensembl Cavefish
Match: ENSAMXT00000007864.2 (matrix metalloproteinase-19 [Source:NCBI gene;Acc:103027674])

HSP 1 Score: 156.762 bits (395), Expect = 8.973e-43
Identity = 97/233 (41.63%), Postives = 133/233 (57.08%), Query Frame = 1
Query:  373 QMYLVKYGYI--SIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKD-IQTRSM----FGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDD--EFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDD 1044
            Q+YL KYGY+  S+    +Q G         K++S+ +++FQ+   L V+G LD  T    + PRCG+KD    R++     G W++K L Y+     +  L ++  R AIQ+AF YW+EV+PL F E+    K +  +K S +  D     PFDG    LAHA  P  G +HFD +E++TEG+  G NLRIVAAHEIGHALGL HS    ALM   Y GY  +N   L+ DD
Sbjct:   11 QVYLTKYGYLPTSLHHPKDQDG-------QVKQISEALRVFQKVMELPVSGRLDNATLVMMKQPRCGLKDPFNNRTLKYRVLGHWRKKTLSYRIYNHASS-LGVAKTRAAIQTAFRYWSEVSPLRFHEL---NKGHPDIKISFHGRDRVCPVPFDGPGEVLAHADSPESGLVHFDEEELWTEGKSTGSNLRIVAAHEIGHALGLGHSQYRSALMGPVYTGY--RNNFRLHPDD 230          
BLAST of matrix metalloproteinase vs. Ensembl Cavefish
Match: ENSAMXT00000030273.1 (matrix metalloproteinase-19 [Source:NCBI gene;Acc:103027674])

HSP 1 Score: 154.451 bits (389), Expect = 6.179e-42
Identity = 96/232 (41.38%), Postives = 132/232 (56.90%), Query Frame = 1
Query:  376 MYLVKYGYI--SIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKD-IQTRSM----FGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDD--EFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDD 1044
            +YL KYGY+  S+    +Q G         K++S+ +++FQ+   L V+G LD  T    + PRCG+KD    R++     G W++K L Y+     +  L ++  R AIQ+AF YW+EV+PL F E+    K +  +K S +  D     PFDG    LAHA  P  G +HFD +E++TEG+  G NLRIVAAHEIGHALGL HS    ALM   Y GY  +N   L+ DD
Sbjct:   39 VYLTKYGYLPTSLHHPKDQDG-------QVKQISEALRVFQKVMELPVSGRLDNATLVMMKQPRCGLKDPFNNRTLKYRVLGHWRKKTLSYRIYNHASS-LGVAKTRAAIQTAFRYWSEVSPLRFHEL---NKGHPDIKISFHGRDRVCPVPFDGPGEVLAHADSPESGLVHFDEEELWTEGKSTGSNLRIVAAHEIGHALGLGHSQYRSALMGPVYTGY--RNNFRLHPDD 257          
BLAST of matrix metalloproteinase vs. Ensembl Cavefish
Match: mmp19 (matrix metalloproteinase-19 [Source:NCBI gene;Acc:103033524])

HSP 1 Score: 154.066 bits (388), Expect = 8.706e-42
Identity = 90/219 (41.10%), Postives = 127/219 (57.99%), Query Frame = 1
Query:  379 YLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKD------IQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDE---FPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
            YL ++GY+  P  +             +E+ + + LFQ+ + L +TG +DE T  +   PRCGV+D      ++ R+  G W++++L Y+     T  +  +A + AI+SAF YW++VTPL+F E+ D  + +  + F    H  E    PFDG    LAHA  PT G +HFD DE +TEG+  G NLRIVAAHEIGHALGL HS    ALMA+ Y GY
Sbjct:   35 YLKQFGYLDTPLDLEVQAHWSD-----EEIKEALSLFQRVSELPITGQIDEATIGQMRQPRCGVEDPFNQKSMRYRTFGGVWRRRSLTYRIYN-YTPDMGKAATQRAIRSAFKYWSDVTPLSFKEI-DYGRADIRISF----HTREGCPSPFDGPGHVLAHAEAPTSGIVHFDEDEFWTEGKYYGSNLRIVAAHEIGHALGLGHSQYKSALMAAHYTGY 242          
BLAST of matrix metalloproteinase vs. Ensembl Cavefish
Match: mmp19 (matrix metalloproteinase-19 [Source:NCBI gene;Acc:103033524])

HSP 1 Score: 154.066 bits (388), Expect = 8.706e-42
Identity = 90/219 (41.10%), Postives = 127/219 (57.99%), Query Frame = 1
Query:  379 YLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKD------IQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDE---FPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
            YL ++GY+  P  +             +E+ + + LFQ+ + L +TG +DE T  +   PRCGV+D      ++ R+  G W++++L Y+     T  +  +A + AI+SAF YW++VTPL+F E+ D  + +  + F    H  E    PFDG    LAHA  PT G +HFD DE +TEG+  G NLRIVAAHEIGHALGL HS    ALMA+ Y GY
Sbjct:   35 YLKQFGYLDTPLDLEVQAHWSD-----EEIKEALSLFQRVSELPITGQIDEATIGQMRQPRCGVEDPFNQKSMRYRTFGGVWRRRSLTYRIYN-YTPDMGKAATQRAIRSAFKYWSDVTPLSFKEI-DYGRADIRISF----HTREGCPSPFDGPGHVLAHAEAPTSGIVHFDEDEFWTEGKYYGSNLRIVAAHEIGHALGLGHSQYKSALMAAHYTGY 242          
BLAST of matrix metalloproteinase vs. Ensembl Cavefish
Match: MMP1 (collagenase 3-like [Source:NCBI gene;Acc:111195015])

HSP 1 Score: 150.599 bits (379), Expect = 1.766e-40
Identity = 92/230 (40.00%), Postives = 126/230 (54.78%), Query Frame = 1
Query:  373 QMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFG---KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPT---DGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDD 1044
            Q YL K+   ++ E+      GR+       +S+ I   Q+  GL VTG +D+ET +  + PRCGV ++   + FG   KW++  L Y+ V   T  L+ + V   ++ A   WA VTPL FT +      + ++ F   SH D +PFDG  GTLAHAF P+    G  HFD DE+FT    +GY L +VAAHE GH+LGL HS D  ALM   Y+ Y D N  +L  DD
Sbjct:   35 QSYLKKF--YNLTEQTGPHSKGRT-----NHMSEKIAEMQKFFGLTVTGTVDQETLQVMKKPRCGVPEVAQYTTFGAGLKWQKNQLTYRIVN-YTPDLSQAEVDSVLEKALQVWARVTPLKFTRI-SSGDADIMISFGAGSHGDYYPFDGPGGTLAHAFAPSAGIGGDAHFDEDELFTSSSTKGYLLFLVAAHEFGHSLGLSHSSDPGALMYPTYS-YRDPNTFVLPRDD 254          
BLAST of matrix metalloproteinase vs. Ensembl Sea Lamprey
Match: mmp19 (matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GENE-100308-3])

HSP 1 Score: 134.806 bits (338), Expect = 2.037e-35
Identity = 72/151 (47.68%), Postives = 90/151 (59.60%), Query Frame = 1
Query:  574 DIQTRSMF---GKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDK 1017
            D  T S F   G+W++  L Y F+  +T  L  + V++ I  AF+ W+ VTPL F E     K +  ++FSR  H D  PFDG    LAHA+FP DGR HFD DE ++EG  +G NL IVA HE GH LGL HS +  ALMA FY GY  K
Sbjct:   96 DKPTASCFVSGGRWRKTTLAYHFLN-LTPDLKGNEVKKIIARAFHEWSRVTPLRFYETPTSPKADIHIQFSRLQHGDFAPFDGPGRVLAHAYFPEDGRAHFDEDEQWSEGTAQGINLHIVATHEFGHLLGLGHSKEQAALMAPFYMGYRPK 245          
BLAST of matrix metalloproteinase vs. Ensembl Sea Lamprey
Match: mmp19 (matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GENE-100308-3])

HSP 1 Score: 132.88 bits (333), Expect = 3.254e-35
Identity = 68/140 (48.57%), Postives = 86/140 (61.43%), Query Frame = 1
Query:  598 GKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDK 1017
            G+W++  L Y F+  +T  L  + V++ I  AF+ W+ VTPL F E     K +  ++FSR  H D  PFDG    LAHA+FP DGR HFD DE ++EG  +G NL IVA HE GH LGL HS +  ALMA FY GY  K
Sbjct:    3 GRWRKTTLAYHFLN-LTPDLKGNEVKKIIARAFHEWSRVTPLRFYETPTSPKADIHIQFSRLQHGDFAPFDGPGRVLAHAYFPEDGRAHFDEDEQWSEGTAQGINLHIVATHEFGHLLGLGHSKEQAALMAPFYMGYRPK 141          
BLAST of matrix metalloproteinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001966.1 (pep scaffold:Pmarinus_7.0:GL476330:946825:981591:-1 gene:ENSPMAG00000001746.1 transcript:ENSPMAT00000001966.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.191 bits (339), Expect = 3.933e-35
Identity = 89/248 (35.89%), Postives = 128/248 (51.61%), Query Frame = 1
Query:  379 YLVKYGYISIPEKVNQTGFGR-STLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFG------------KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEE------KTNFILKFSRYSHDDEFPFDGRDGTLAHAFFP---TDGRIHFDSDEIFT--EGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQ 1050
            +L +YGY+         G  R ST+  P  +S  +   Q+  G+ VTG +D +T +  + PRCGV D   + +              +W+QK++ Y      T  +  +  R A++ AF+ W +VTPL F EV + E      + + ++ F+  +H D  PFDG  G LAHA+FP     G  HFD+DE +T   G   G +L +VA HE+GHALGL HS D  A+MA FY  Y D    +L  DD Q
Sbjct:    1 WLQRYGYLP-------GGDARMSTIRSPGVMSAAVSAMQRFYGINVTGTVDADTLRWMKRPRCGVPDRIDQGLQAGLRRKRYALTGQRWQQKHITYSLQN-YTPKVGEADTRRALRRAFDVWQQVTPLVFEEVSNHEIRSSRREADIMIFFASGNHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDADEPWTLGNGNAGGNDLFLVAIHELGHALGLEHSNDPAAIMAPFYQ-YMDTENFVLPRDDLQ 239          
BLAST of matrix metalloproteinase vs. Ensembl Sea Lamprey
Match: MMP14 (matrix metallopeptidase 14 [Source:HGNC Symbol;Acc:HGNC:7160])

HSP 1 Score: 130.568 bits (327), Expect = 1.946e-34
Identity = 93/248 (37.50%), Postives = 127/248 (51.21%), Query Frame = 1
Query:  373 QMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFG------------KWKQKNLKY---KFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKT----NFILKFSRYSHDDEFPFDGRDGTLAHAFFP---TDGRIHFDSDEIFTEG--EERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDD 1044
            Q +L +YGY+  P    Q    RS  +    +S+ +   Q   G+ VTG +DE TR+  + PRCGV D    ++              KW  +++ Y    +   V +Y T  A+R A    F+ W  VTPLTFT+V   + +    + I+ F+   H D  PFDG  G LAHA+FP     G  HFD+DE +T G  +  G +L IVA HE+GHALGL HS D  A+MA FY  Y D +   L  DD
Sbjct:    3 QTWLQQYGYL--PAGDLQMATYRSGQM----LSEAVSSMQAFYGIPVTGTMDELTRQWMQKPRCGVPDRYGTTVTAGSRHKRYAINHLKWHHQHITYDIQNYTPKVGEYETHQAIRHA----FDVWQAVTPLTFTQVSGRDGSGNDADIIIFFASGYHGDRSPFDGVGGFLAHAYFPGKGIGGDTHFDADEPWTLGGHDYTGNDLFIVAVHELGHALGLEHSNDPSAIMAPFYQ-YMDTDDFQLPYDD 239          
BLAST of matrix metalloproteinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005331.1 (pep scaffold:Pmarinus_7.0:GL476741:9169:28768:-1 gene:ENSPMAG00000004733.1 transcript:ENSPMAT00000005331.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 2.213e-30
Identity = 69/168 (41.07%), Postives = 100/168 (59.52%), Query Frame = 1
Query:  562 CGVKDIQTRSMF---GKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDG---RIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDK 1047
            CGV +  + S++    KW +KNL Y+FV      ++     +A+  AF+ W  V+ LTF ++  E + + ++ F R  H DEFPFDG  G LAHA+ P+ G    +HFD +E ++ G   GYNLR+VAAHE+GHALGL HS +  ++M   Y  +     P L+EDDK
Sbjct:   11 CGVPNPNSFSLYPSRNKWLKKNLTYRFVN-YPSGMSRERAEDALAEAFDLWRSVSTLTF-QMLREGEADIMISFERRYHGDEFPFDGPHGVLAHAYEPSPGLGGDLHFDDEEQWSVGLI-GYNLRVVAAHELGHALGLQHSNERGSIMNPSYQVWIH---PYLSEDDK 172          
BLAST of matrix metalloproteinase vs. Ensembl Nematostella
Match: EDO41167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S526])

HSP 1 Score: 155.606 bits (392), Expect = 1.482e-42
Identity = 95/236 (40.25%), Postives = 130/236 (55.08%), Query Frame = 1
Query:  373 QMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRS-----------MFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPT-DGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDD 1044
            Q YL +YGY+  P +  +TG  RS     +++S  I+ FQ+  GL+ TGI+D  T+ K E PRCG+ DI   S              +W++  + Y+F       L+ +AVR     A   W++   L   E  D  K +F + F+ Y H D  PFDG  GTLAHAFFP   G +HFD  E +TEG++ G NL  VAAHE+GH LGL HS   +++MA +Y GY  K    L+EDD
Sbjct:   24 QDYLTRYGYLDAPNR--KTGAIRSR----QDLSRAIRQFQRYTGLQETGIMDAATKSKMEQPRCGLPDIVGTSENARRKRRYALQGSRWEKSEITYRFAS-YGNDLSRTAVRRIFARAAKLWSDKMQLNIKETSDA-KADFTVSFNSYDHGDGDPFDGPGGTLAHAFFPQYGGDLHFDDSETYTEGKDAGVNLLFVAAHELGHTLGLSHSDVWQSVMAPYYPGY--KANLELHEDD 249          
BLAST of matrix metalloproteinase vs. Ensembl Nematostella
Match: EDO34801 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNA9])

HSP 1 Score: 136.732 bits (343), Expect = 2.688e-38
Identity = 80/197 (40.61%), Postives = 110/197 (55.84%), Query Frame = 1
Query:  475 GIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQ---TRSMFG----KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDE-FPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNED 1041
             I+LFQ+   L VTG LDE + KK    RCG  DI+     S +     KW + +L Y F       +T +     +  AF+ W++ + LTFT V D    +  + F   +H +  +PFDG+   LAHAFFPTDG +HFD DE FT+G   G NL  VA HEIGH LG+ HS ++ ++M   Y+GY D N+ L  +D
Sbjct:    1 AIELFQRYMHLPVTGQLDEASIKKMHQKRCGFPDIEEDEDTSEYAVAPTKWNKTSLTYAFEN-YGDDMTSATQENILARAFSMWSDNSNLTFTLVSDASNADIKIAFVTGTHSNCIYPFDGQGSVLAHAFFPTDGSLHFDDDEDFTDGVATGTNLLAVAVHEIGHILGVGHSSETNSVMNPNYSGY-DPNLALHADD 195          
BLAST of matrix metalloproteinase vs. Ensembl Nematostella
Match: EDO49974 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RET8])

HSP 1 Score: 136.346 bits (342), Expect = 5.140e-38
Identity = 80/223 (35.87%), Postives = 116/223 (52.02%), Query Frame = 1
Query:  379 YLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSM-FGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEF-PFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNED 1041
            +L KY Y+S   + N             ++   I+++Q+   L V+G LD  T+   + PRCGV D++      GKW   +L Y F    T  LT +  +  I  AF  W++V+P  FT   D+ K +  + F   +H +    FDG    +AHA++P+DGR+HFD DE FT+G   G NL  +A HEIGH LG+ HS D  ++M   Y  Y   N+ L  ED
Sbjct:    3 FLKKYHYLSSHVRGNH------------DMQTAIEIYQRYMNLPVSGRLDNATQVSMDEPRCGVPDLEIDDPGLGKWLNTSLLYAF-ETYTADLTQTVQKAVIAKAFKMWSDVSPFIFTLTTDKTKAHIKILFGTNTHGNCLKAFDGPGKVIAHAYYPSDGRLHFDDDETFTDGVNTGTNLLAIAVHEIGHILGIAHSTDKNSVMYPKYETY-KPNLQLHAED 211          
BLAST of matrix metalloproteinase vs. Ensembl Nematostella
Match: EDO38677 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCE7])

HSP 1 Score: 134.42 bits (337), Expect = 1.918e-37
Identity = 86/219 (39.27%), Postives = 110/219 (50.23%), Query Frame = 1
Query:  373 QMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQT-RSMFG-KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSH----DDE----FPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFY 999
            Q YL ++ YIS     N              V   ++ FQ   GL VTG +D  T  + ++PRCG+ D    R   G KW +K+L Y       Q L+ S        A +YWA V+ LTF+   D E  +  + F   SH    D E    +PFDG  G LAHAFFP +GR HFD DE FT+G   G NL  VA HE GH+LGL HS   +A+M  +Y
Sbjct:    1 QKYLNQFHYISPARSGNHN------------VKTALEKFQSFAGLPVTGEIDAATIAQMKMPRCGMPDDNYFRYKLGSKWNKKHLTYHISH--GQDLSSSVQDRVFAKALDYWARVSGLTFSRTMDGENADLKISFGPKSHGGTHDPEGTCSYPFDGPGGVLAHAFFPRNGRAHFDEDEDFTDGTYEGTNLLWVATHEFGHSLGLHHSDVRDAVMYPYY 205          
BLAST of matrix metalloproteinase vs. Ensembl Nematostella
Match: EDO29931 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T286])

HSP 1 Score: 131.724 bits (330), Expect = 2.898e-36
Identity = 78/212 (36.79%), Postives = 106/212 (50.00%), Query Frame = 1
Query:  391 YGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDE------FPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
            Y YIS     NQ            +V   IK FQ+  GL+VTG LD+ T  + ++PRCG  D+       +W +  L Y       + L  S      + A  +W++ + L+F+ V D  K +  + F   SH+         PFDG    LAHA+FP++GR HFD DE +T+G   G NL  VA HE GHALGL HS    A+M  +Y GY
Sbjct:    1 YNYISNSRSGNQ------------DVETAIKNFQRFAGLEVTGELDDATIAQMKMPRCGDADVDDNG--DRWNKNALTYHL--SYGKDLPNSVQDRVFEKALKFWSDGSALSFSRVSDVSKADLKISFGSRSHNGPGESRCGSPFDGPGRVLAHAYFPSNGRCHFDEDERYTDGASSGINLLWVATHEFGHALGLHHSDVRNAVMYPYYTGY 196          
BLAST of matrix metalloproteinase vs. Ensembl Medaka
Match: mmp19 (matrix metallopeptidase 19 [Source:NCBI gene;Acc:101162361])

HSP 1 Score: 161.77 bits (408), Expect = 1.079e-44
Identity = 95/221 (42.99%), Postives = 124/221 (56.11%), Query Frame = 1
Query:  370 GQMYLVKYGYISIPEKVNQTGFGRSTLLDP---KEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKD-----IQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
             + YL +YGY++ P              DP   +EV + +++FQ+ N L  +G LDE T      PRCG++D     +    + G+W++KNL Y+     T  +  S V  AI+SAF YW++VTPLTF EV D  + +  + F +       PFDGR   LAHA  P  G +HFD DE +TE    G NLRIVAAHEIGHALGL HS    ALMA  YAGY
Sbjct:   33 AKAYLRQYGYLNDPANPE----------DPFYLEEVIEALRVFQRVNDLPPSGELDEATLAVMRQPRCGMEDPFNKKLHKFRIMGRWRKKNLTYRIYN-YTPDMKQSDVSAAIRSAFKYWSDVTPLTFKEV-DYGRADIKISFHKKDGHCSVPFDGRGHVLAHAESPESGIVHFDEDEFWTEQSYYGTNLRIVAAHEIGHALGLGHSQFRSALMAPVYAGY 241          
BLAST of matrix metalloproteinase vs. Ensembl Medaka
Match: ENSORLT00000039885.1 (matrix metalloproteinase-19-like [Source:NCBI gene;Acc:101156575])

HSP 1 Score: 159.844 bits (403), Expect = 5.945e-44
Identity = 85/216 (39.35%), Postives = 126/216 (58.33%), Query Frame = 1
Query:  379 YLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKD------IQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
            YL K+GY+ IP       +       P+++++ +++FQ+   ++++G LD  T       RCG++D      +  R M G W++K L Y+     T +L +   R+AIQSAF  W++V+PL F E+  + + +  + F R       PFDGR   LAHA  P  G +HFD+DE++TEG+  G++LRIVAAHEIGHALGL HS    ALM   Y+GY
Sbjct:   33 YLQKFGYLHIPLDSKDVNY------PPEKIAEALRIFQKVTNMQMSGNLDSATLAMMNRARCGLEDSFIDNSLSYRVM-GYWRKKMLTYRIYN-YTPHLGLEKTRQAIQSAFKLWSDVSPLRFKEL-QQGRPDIKISFHRKDKSCPVPFDGRGRVLAHADAPESGIVHFDADELWTEGKSHGFSLRIVAAHEIGHALGLAHSQYYSALMGPIYSGY 239          
BLAST of matrix metalloproteinase vs. Ensembl Medaka
Match: ENSORLT00000018958.2 (matrix metalloproteinase-19-like [Source:NCBI gene;Acc:101156575])

HSP 1 Score: 152.14 bits (383), Expect = 1.852e-41
Identity = 78/190 (41.05%), Postives = 116/190 (61.05%), Query Frame = 1
Query:  457 PKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKD------IQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGY 1008
            P+++++ +++FQ+   ++++G LD  T       RCG++D      +  R M G W++K L Y+     T +L +   R+AIQSAF  W++V+PL F E+  + + +  + F R       PFDGR   LAHA  P  G +HFD+DE++TEG+  G++LRIVAAHEIGHALGL HS    ALM   Y+GY
Sbjct:   13 PEKIAEALRIFQKVTNMQMSGNLDSATLAMMNRARCGLEDSFIDNSLSYRVM-GYWRKKMLTYRIYN-YTPHLGLEKTRQAIQSAFKLWSDVSPLRFKEL-QQGRPDIKISFHRKDKSCPVPFDGRGRVLAHADAPESGIVHFDADELWTEGKSHGFSLRIVAAHEIGHALGLAHSQYYSALMGPIYSGY 199          
BLAST of matrix metalloproteinase vs. Ensembl Medaka
Match: ENSORLT00000025461.2 (collagenase 3-like [Source:NCBI gene;Acc:101159886])

HSP 1 Score: 146.362 bits (368), Expect = 4.987e-39
Identity = 86/202 (42.57%), Postives = 116/202 (57.43%), Query Frame = 1
Query:  436 GRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTR--SMFG---KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDG---RIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYA-GYTD 1014
            G S       +S  ++  Q+  GL+VTG LD +T +  + PRCG+ DI     S FG   KW++  L Y+ V   T  ++ + V+++IQ A   WA VTPL FT   +    + ++ F R +H D +PFDG  GTLAHAF P+ G    +HFD DE FT    +GY L +VAAHE GH+LGL HS D  ALM   Y+ GY D
Sbjct:   46 GPSARWGVSPMSRRLREMQRFFGLQVTGTLDTDTLEVMKKPRCGIPDINIGQFSTFGNNVKWQKNTLTYRIVN-YTPDMSQAEVQDSIQRALQVWASVTPLRFTRT-NSGPADIMVSFGRGAHGDYYPFDGPHGTLAHAFSPSSGIGGDVHFDDDETFTFRSSKGYVLFMVAAHEFGHSLGLSHSSDRGALMYPLYSFGYPD 245          
BLAST of matrix metalloproteinase vs. Ensembl Medaka
Match: coll (collagenase [Source:NCBI gene;Acc:100049293])

HSP 1 Score: 140.969 bits (354), Expect = 4.507e-37
Identity = 84/203 (41.38%), Postives = 113/203 (55.67%), Query Frame = 1
Query:  460 KEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKD--IQTRSMFG---KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDG---RIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDD 1044
             +V+  +   Q   GL++TG LD ET    + PRCGV D  +   S FG   KW++ +L Y+     T  ++   V E+I+ A   WA VTPL FT+++     + ++ F + +H D +PFDG DGTLAHAF P  G     HFD DE FT     GY L +VAAHE GH+LGL HS D  ALM   Y+ Y +    +L  DD
Sbjct:   53 SQVTSKLIEMQTFFGLQITGTLDAETLAMMKKPRCGVSDSRVARFSTFGNNLKWEKNSLTYRITN-YTPDMSKEEVDESIEKALQVWARVTPLRFTKIY-SSTADIMVSFGQRAHGDYYPFDGPDGTLAHAFAPAPGIGGDAHFDDDETFTFRSNTGYVLFMVAAHEFGHSLGLSHSDDPGALMYPIYS-YRNPETFVLPRDD 252          
BLAST of matrix metalloproteinase vs. Planmine SMEST
Match: SMESG000049445.1 (SMESG000049445.1)

HSP 1 Score: 514.998 bits (1325), Expect = 6.692e-180
Identity = 263/264 (99.62%), Postives = 263/264 (99.62%), Query Frame = 1
Query:  262 MNPVFYRLIKWILIFGNXXXXXXXXXXXXXXXRKLFGQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQK 1053
            MNPVFY LIKWILIFGNVVSVSVAATTPSPSSRKLFGQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQK
Sbjct:    1 MNPVFYGLIKWILIFGNVVSVSVAATTPSPSSRKLFGQMYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQK 264          

HSP 2 Score: 59.6918 bits (143), Expect = 2.160e-9
Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 2
Query: 1049 KKIQQIYGRKPISSVTPRSEKSTKRRRMXXXXXXXXXXXXXXQDLV 1186
            +KIQQIYGRKPISSVTPRSEKSTKRRRMTRLTTDSTTNPSTTQDLV
Sbjct:  263 QKIQQIYGRKPISSVTPRSEKSTKRRRMTRLTTDSTTNPSTTQDLV 308          
BLAST of matrix metalloproteinase vs. Planmine SMEST
Match: SMESG000049445.1 (SMESG000049445.1)

HSP 1 Score: 478.019 bits (1229), Expect = 7.789e-166
Identity = 226/226 (100.00%), Postives = 226/226 (100.00%), Query Frame = 1
Query:  376 MYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQK 1053
            MYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQK
Sbjct:    1 MYLVKYGYISIPEKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQK 226          

HSP 2 Score: 59.6918 bits (143), Expect = 2.085e-9
Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 2
Query: 1049 KKIQQIYGRKPISSVTPRSEKSTKRRRMXXXXXXXXXXXXXXQDLV 1186
            +KIQQIYGRKPISSVTPRSEKSTKRRRMTRLTTDSTTNPSTTQDLV
Sbjct:  225 QKIQQIYGRKPISSVTPRSEKSTKRRRMTRLTTDSTTNPSTTQDLV 270          
BLAST of matrix metalloproteinase vs. Planmine SMEST
Match: SMESG000014326.1 (SMESG000014326.1)

HSP 1 Score: 122.094 bits (305), Expect = 3.072e-30
Identity = 80/219 (36.53%), Postives = 115/219 (52.51%), Query Frame = 1
Query:  463 EVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDI-----QTRSMFGKWKQKNLKYKFV-----GPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHD------------DEFPFDGRDG-TLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQ 1050
            ++SD +K  Q+  GL   G + +E     E  RCG KD      +  +   KW  K   Y+F       P T  +++  ++ A+  A NYW+    + F +V  ++ + F L F+   H             D +P D   G  LAHAFFP  G +HFDS E +TEG++ G NLR+VAAHE+GHA+GL HS D +ALMA +Y GY  ++   L +DD Q
Sbjct:   44 KLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKW-DKGQTYRFYIHDERHPTT--MSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQ 259          
BLAST of matrix metalloproteinase vs. Planmine SMEST
Match: SMESG000014326.1 (SMESG000014326.1)

HSP 1 Score: 122.094 bits (305), Expect = 3.419e-30
Identity = 80/219 (36.53%), Postives = 115/219 (52.51%), Query Frame = 1
Query:  463 EVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDI-----QTRSMFGKWKQKNLKYKFV-----GPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHD------------DEFPFDGRDG-TLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQ 1050
            ++SD +K  Q+  GL   G + +E     E  RCG KD      +  +   KW  K   Y+F       P T  +++  ++ A+  A NYW+    + F +V  ++ + F L F+   H             D +P D   G  LAHAFFP  G +HFDS E +TEG++ G NLR+VAAHE+GHA+GL HS D +ALMA +Y GY  ++   L +DD Q
Sbjct:   44 KLSDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYNAAQSKW-DKGQTYRFYIHDERHPTT--MSLGEIQRALIIALNYWSTAADIYFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFPKSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQ 259          
BLAST of matrix metalloproteinase vs. Planmine SMEST
Match: SMESG000040780.1 (SMESG000040780.1)

HSP 1 Score: 120.553 bits (301), Expect = 1.154e-29
Identity = 74/214 (34.58%), Postives = 109/214 (50.93%), Query Frame = 1
Query:  466 VSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKDIQTR-----SMFGKWKQKNLKYKF---VGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFDEEKTNFILKFSRYSHD------------DEFPFDGR-DGTLAHAFFPTDGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDD 1044
            + D +K  Q+  G++  G L +E        RCG KD   +     +   KW  + + YK+   +  + + ++ + VR AIQ A +YW +V+ L F    D+    F + F+   H+            D  P D    G LAH F+P +G +H+D+ E +TEG + G NLRIV AHE+GHA+GL HS D  ALMA +Y GY  +    L  DD
Sbjct:   59 LKDSLKDLQKMAGIEADGKLSDEVISHMNKGRCGDKDKDKKSKRYVAHAKKW-DRGVTYKYYLHLDWMPRTMSEAEVRRAIQVALDYWVQVSNLGFAASRDKAGCMFSVSFAGRDHELYDVYNNFQSRKDHIPLDNVPSGVLAHGFYPKNGNLHYDNAETWTEGTDSGINLRIVTAHEMGHAIGLKHSNDPSALMAPWYGGYISEADYRLPNDD 271          
The following BLAST results are available for this feature:
BLAST of matrix metalloproteinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MMP191.222e-4039.81matrix metallopeptidase 19 [Source:HGNC Symbol;Acc... [more]
MMP191.567e-3740.76matrix metallopeptidase 19 [Source:HGNC Symbol;Acc... [more]
MMP131.762e-3742.79matrix metallopeptidase 13 [Source:HGNC Symbol;Acc... [more]
MMP131.003e-3642.79matrix metallopeptidase 13 [Source:HGNC Symbol;Acc... [more]
MMP131.261e-3642.79matrix metallopeptidase 13 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of matrix metalloproteinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zmp-32.219e-3536.51Matrix metalloproteinase-C [Source:UniProtKB/Swis... [more]
zmp-58.340e-2640.27Zinc MetalloProtease [Source:UniProtKB/TrEMBL;Acc... [more]
zmp-61.434e-2439.71MMP-like protein; Zinc MetalloProtease [Source:Un... [more]
zmp-11.588e-2133.63Matrix metalloproteinase-A [Source:UniProtKB/Swis... [more]
zmp-21.949e-1930.77Matrix metalloproteinase-B [Source:UniProtKB/Swis... [more]
back to top
BLAST of matrix metalloproteinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mmp11.301e-3739.92gene:FBgn0035049 transcript:FBtr0306656[more]
Mmp11.301e-3739.92gene:FBgn0035049 transcript:FBtr0304010[more]
Mmp11.430e-3739.92gene:FBgn0035049 transcript:FBtr0304009[more]
Mmp11.430e-3739.92gene:FBgn0035049 transcript:FBtr0304011[more]
Mmp11.533e-3739.92gene:FBgn0035049 transcript:FBtr0304006[more]
back to top
BLAST of matrix metalloproteinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mmp194.645e-4344.55matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GE... [more]
mmp13a1.572e-3642.56matrix metallopeptidase 13a [Source:ZFIN;Acc:ZDB-G... [more]
mmp191.715e-3548.21matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GE... [more]
mmp13a1.729e-3441.50matrix metallopeptidase 13a [Source:ZFIN;Acc:ZDB-G... [more]
mmp20b1.883e-3341.09matrix metallopeptidase 20b (enamelysin) [Source:Z... [more]
back to top
BLAST of matrix metalloproteinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000046574.14.044e-4043.98matrix metallopeptidase 8 [Source:NCBI gene;Acc:10... [more]
ENSXETT00000046498.17.809e-4043.59matrix metalloproteinase-18-like [Source:NCBI gene... [more]
ENSXETT00000046522.11.061e-3943.59matrix metalloproteinase-18-like [Source:NCBI gene... [more]
ENSXETT00000046328.12.273e-3943.59matrix metalloproteinase-18-like [Source:NCBI gene... [more]
ENSXETT00000027926.12.820e-3944.29matrix metalloproteinase-18-like [Source:NCBI gene... [more]
back to top
BLAST of matrix metalloproteinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mmp191.327e-4340.83matrix metallopeptidase 19 [Source:MGI Symbol;Acc:... [more]
Mmp133.193e-3944.22matrix metallopeptidase 13 [Source:MGI Symbol;Acc:... [more]
Mmp194.718e-3744.12matrix metallopeptidase 19 [Source:MGI Symbol;Acc:... [more]
Mmp1b1.204e-3641.46matrix metallopeptidase 1b (interstitial collagena... [more]
Mmp244.517e-3538.37matrix metallopeptidase 24 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of matrix metalloproteinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JHI0|MMP19_MOUSE9.279e-4340.83Matrix metalloproteinase-19 OS=Mus musculus OX=100... [more]
sp|Q99542|MMP19_HUMAN5.869e-4039.81Matrix metalloproteinase-19 OS=Homo sapiens OX=960... [more]
sp|P33435|MMP13_MOUSE2.234e-3844.22Collagenase 3 OS=Mus musculus OX=10090 GN=Mmp13 PE... [more]
sp|P23097|MMP13_RAT7.458e-3844.22Collagenase 3 (Fragment) OS=Rattus norvegicus OX=1... [more]
sp|O77656|MMP13_BOVIN7.654e-3840.17Collagenase 3 OS=Bos taurus OX=9913 GN=MMP13 PE=2 ... [more]
back to top
BLAST of matrix metalloproteinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A090C5X61.780e-177100.00Matrix metalloproteinase OS=Schmidtea mediterranea... [more]
W5M9J94.845e-4744.05Matrix metallopeptidase 19 OS=Lepisosteus oculatus... [more]
A0A3P9ANV03.928e-4642.20ZnMc domain-containing protein OS=Esox lucius OX=8... [more]
A0A3B4BFY41.020e-4543.64ZnMc domain-containing protein OS=Periophthalmus m... [more]
A0A3P8Z9P32.348e-4541.94ZnMc domain-containing protein OS=Esox lucius OX=8... [more]
back to top
BLAST of matrix metalloproteinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000007864.28.973e-4341.63matrix metalloproteinase-19 [Source:NCBI gene;Acc:... [more]
ENSAMXT00000030273.16.179e-4241.38matrix metalloproteinase-19 [Source:NCBI gene;Acc:... [more]
mmp198.706e-4241.10matrix metalloproteinase-19 [Source:NCBI gene;Acc:... [more]
mmp198.706e-4241.10matrix metalloproteinase-19 [Source:NCBI gene;Acc:... [more]
MMP11.766e-4040.00collagenase 3-like [Source:NCBI gene;Acc:111195015... [more]
back to top
BLAST of matrix metalloproteinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mmp192.037e-3547.68matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GE... [more]
mmp193.254e-3548.57matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000001966.13.933e-3535.89pep scaffold:Pmarinus_7.0:GL476330:946825:981591:-... [more]
MMP141.946e-3437.50matrix metallopeptidase 14 [Source:HGNC Symbol;Acc... [more]
ENSPMAT00000005331.12.213e-3041.07pep scaffold:Pmarinus_7.0:GL476741:9169:28768:-1 g... [more]
back to top
BLAST of matrix metalloproteinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of matrix metalloproteinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO411671.482e-4240.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348012.688e-3840.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499745.140e-3835.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386771.918e-3739.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299312.898e-3636.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of matrix metalloproteinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mmp191.079e-4442.99matrix metallopeptidase 19 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000039885.15.945e-4439.35matrix metalloproteinase-19-like [Source:NCBI gene... [more]
ENSORLT00000018958.21.852e-4141.05matrix metalloproteinase-19-like [Source:NCBI gene... [more]
ENSORLT00000025461.24.987e-3942.57collagenase 3-like [Source:NCBI gene;Acc:101159886... [more]
coll4.507e-3741.38collagenase [Source:NCBI gene;Acc:100049293][more]
back to top
BLAST of matrix metalloproteinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049445.16.692e-18099.62SMESG000049445.1[more]
SMESG000049445.17.789e-166100.00SMESG000049445.1[more]
SMESG000014326.13.072e-3036.53SMESG000014326.1[more]
SMESG000014326.13.419e-3036.53SMESG000014326.1[more]
SMESG000040780.11.154e-2934.58SMESG000040780.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30025379
GenBankCCM73860.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025379 ID=SMED30025379|Name=matrix metalloproteinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1219bp
TCTGTGTAGAATTCCCGTGTGAATGTAAATAAAATGAAAAATTTCACATC
TTGCGATAGAATTTTTAGGGGCAAAAATTATCTAAAAAATCAATTTCACT
TTTAACATAAATTTTGGGATTTGTGAATGACTGAAACGACGAAAAAAGGG
GAAAATTTGACTTATATTTATTCTAATTGATATCAATTGGAAATTTGGCA
TTTCCATACTTTCATATTAATACGTTGATTTCATTAGAAGGATCAAAATA
AACAAAATTTTATGAATCCTGTTTTCTACAGACTTATCAAATGGATCTTG
ATATTTGGCAATGTCGTCTCTGTTTCGGTGGCCGCAACGACTCCGAGCCC
AAGCTCAAGGAAATTATTTGGACAAATGTATCTTGTAAAATACGGATATA
TATCCATTCCTGAAAAAGTAAACCAAACCGGGTTCGGAAGAAGCACTTTG
CTAGATCCGAAAGAAGTTAGTGATGGAATTAAACTTTTCCAGCAAAAGAA
CGGCTTAAAAGTCACGGGAATATTAGATGAAGAGACTAGGAAAAAATTTG
AACTGCCAAGATGTGGAGTAAAAGACATTCAAACTCGTTCAATGTTTGGT
AAATGGAAACAAAAAAATCTAAAATATAAATTTGTCGGTCCAGTCACTCA
ATATTTAACTATGTCTGCCGTCCGCGAAGCCATACAGAGTGCTTTCAATT
ATTGGGCCGAAGTGACTCCTCTGACTTTTACTGAAGTGTTTGATGAGGAA
AAGACGAATTTTATTTTAAAATTCAGCCGATATAGCCATGACGATGAATT
TCCATTCGACGGACGCGATGGGACATTGGCTCATGCGTTTTTCCCTACCG
ATGGCAGAATTCATTTTGATTCTGATGAAATATTTACAGAAGGAGAAGAG
AGGGGATATAATTTACGGATTGTTGCAGCTCATGAAATAGGACACGCGCT
AGGTCTGCCTCATTCATACGATTCTGAAGCGTTGATGGCTTCATTTTACG
CTGGATATACTGATAAAAACATGCCTTTACTCAATGAAGACGATAAGCAA
AAAAATACAACAGATTTACGGTCGTAAACCAATTTCCTCTGTAACTCCAC
GATCAGAAAAATCAACCAAACGTCGGAGAATGACGAGATTGACTACAGAT
TCAACAACTAACCCCAGCACAACCCAAGACCTAGTGACAACCACACCTGA
ACCGACAACAACACCGGAA
back to top

protein sequence of SMED30025379-orf-1

>SMED30025379-orf-1 ID=SMED30025379-orf-1|Name=SMED30025379-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=272bp
MNPVFYRLIKWILIFGNVVSVSVAATTPSPSSRKLFGQMYLVKYGYISIP
EKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPR
CGVKDIQTRSMFGKWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAE
VTPLTFTEVFDEEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPTDGRI
HFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYT
DKNMPLLNEDDKQKNTTDLRS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR033739M10A_MMP
IPR036365PGBD-like_sf
IPR021190Pept_M10A
IPR006026Peptidase_Metallo
IPR024079MetalloPept_cat_dom_sf
IPR001818Pept_M10_metallopeptidase
IPR002477Peptidoglycan-bd-like
Vocabulary: cellular component
TermDefinition
GO:0031012extracellular matrix
Vocabulary: molecular function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0008270zinc ion binding
GO:0008237metallopeptidase activity
GO:0005509calcium ion binding
GO:0008233peptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021190Peptidase M10APRINTSPR00138MATRIXINcoord: 96..109
score: 41.9
coord: 221..246
score: 63.79
coord: 141..156
score: 51.52
coord: 257..270
score: 52.79
coord: 165..193
score: 44.28
IPR006026Peptidase, metallopeptidaseSMARTSM00235col_5coord: 111..271
e-value: 3.4E-36
score: 136.2
IPR002477Peptidoglycan binding-likePFAMPF01471PG_binding_1coord: 37..95
e-value: 1.5E-8
score: 34.7
IPR024079Metallopeptidase, catalytic domain superfamilyGENE3DG3DSA:3.40.390.10coord: 27..271
e-value: 1.0E-73
score: 249.8
IPR001818Peptidase M10, metallopeptidasePFAMPF00413Peptidase_M10coord: 114..270
e-value: 5.1E-48
score: 162.9
NoneNo IPR availablePANTHERPTHR10201MATRIX METALLOPROTEINASEcoord: 38..270
NoneNo IPR availablePANTHERPTHR10201:SF237MATRIX METALLOPROTEINASE-RELATEDcoord: 38..270
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.756
NoneNo IPR availableSUPERFAMILYSSF55486Metalloproteases ("zincins"), catalytic domaincoord: 99..269
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR033739Peptidase M10A, catalytic domainCDDcd04278ZnMc_MMPcoord: 114..270
e-value: 4.48905E-70
score: 211.294
IPR036365PGBD-like superfamilySUPERFAMILYSSF47090PGBD-likecoord: 27..106