SMED30025378

Overview
NameSMED30025378
Smed IDSMED30025378
Length (bp)753
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30025378 (SMED30025378) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30025378 (SMED30025378) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30025378 (SMED30025378) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30025378 (SMED30025378) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025378

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025378SMESG000002782.1 SmedASXL_012264SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30025378SMESG000002782.1 dd_Smed_v6_12067_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025378SMESG000002782.1 dd_Smed_v4_12067_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30025378 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000548:30388..31236 +3720
Homology
BLAST of SMED30025378 vs. Ensembl Human
Match: LRRC46 (leucine rich repeat containing 46 [Source:HGNC Symbol;Acc:HGNC:25047])

HSP 1 Score: 68.5514 bits (166), Expect = 1.743e-14
Identity = 44/102 (43.14%), Postives = 67/102 (65.69%), Query Frame = -1
Query:  385 LILHRNLSYNFQDLSTDEKL-KEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 687
            LI  RNL++  +D    EK+   +++L+ V LDRE I+ I NLE L  ++  ++LQ NKI++IENL  + +LR L L+ N I+++EN+  L  LQ LD+S N
Sbjct:   21 LITKRNLTFP-EDGELSEKMFHTLDELQTVRLDREGITTIRNLEGLQ-NLHSLYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSEN 120          

HSP 2 Score: 29.6462 bits (65), Expect = 1.743e-14
Identity = 16/41 (39.02%), Postives = 25/41 (60.98%), Query Frame = -2
Query:  195 LTIDEIPFSLLSINIKGNPCALSNTVGQL-SKSFPFLIVLD 314
            L +DE P SLL +N+ GN C   +   +L +++ P L+ LD
Sbjct:  125 LKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLD 165          
BLAST of SMED30025378 vs. Ensembl Human
Match: DNAAF1 (dynein axonemal assembly factor 1 [Source:HGNC Symbol;Acc:HGNC:30539])

HSP 1 Score: 58.5362 bits (140), Expect = 1.390e-9
Identity = 33/69 (47.83%), Postives = 48/69 (69.57%), Query Frame = -1
Query:  379 NISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 585
               +IENLE  +  +  ++LQ+N I+KIENLE+   LRCL L  NL++KIEN++ L+KL  L++S N I
Sbjct:  118 GFDRIENLEEYT-GLRCLWLQSNGIQKIENLEAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYI 185          

HSP 2 Score: 51.9878 bits (123), Expect = 2.029e-7
Identity = 43/116 (37.07%), Postives = 58/116 (50.00%), Query Frame = -1
Query:  370 IVVIYEMNFDLILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 717
            + +   +N  L LH      F+     E L+E   L  + L    I KIENLE  +  +  +FLQ N + KIENLE L  L  L LS N IK IEN+  L  L  L +++N +  V
Sbjct:  102 LYITPALNDTLYLH------FKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQT-ELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTLQMAHNHLETV 210          
BLAST of SMED30025378 vs. Ensembl Human
Match: DNAAF1 (dynein axonemal assembly factor 1 [Source:HGNC Symbol;Acc:HGNC:30539])

HSP 1 Score: 58.9214 bits (141), Expect = 1.728e-9
Identity = 33/72 (45.83%), Postives = 49/72 (68.06%), Query Frame = -1
Query:  370 NISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 585
               +IENLE  +  +  ++LQ+N I+KIENLE+   LRCL L  NL++KIEN++ L+KL  L++S N I  +
Sbjct:  118 GFDRIENLEEYT-GLRCLWLQSNGIQKIENLEAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTI 188          

HSP 2 Score: 50.447 bits (119), Expect = 1.076e-6
Identity = 43/116 (37.07%), Postives = 58/116 (50.00%), Query Frame = -1
Query:  370 IVVIYEMNFDLILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 717
            + +   +N  L LH      F+     E L+E   L  + L    I KIENLE  +  +  +FLQ N + KIENLE L  L  L LS N IK IEN+  L  L  L +++N +  V
Sbjct:  102 LYITPALNDTLYLH------FKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQT-ELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTLQMAHNHLETV 210          
BLAST of SMED30025378 vs. Ensembl Human
Match: DNAAF1 (dynein axonemal assembly factor 1 [Source:HGNC Symbol;Acc:HGNC:30539])

HSP 1 Score: 59.3066 bits (142), Expect = 1.782e-9
Identity = 33/72 (45.83%), Postives = 49/72 (68.06%), Query Frame = -1
Query:  370 NISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 585
               +IENLE  +  +  ++LQ+N I+KIENLE+   LRCL L  NL++KIEN++ L+KL  L++S N I  +
Sbjct:  118 GFDRIENLEEYT-GLRCLWLQSNGIQKIENLEAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTI 188          

HSP 2 Score: 49.6766 bits (117), Expect = 2.441e-6
Identity = 43/116 (37.07%), Postives = 58/116 (50.00%), Query Frame = -1
Query:  370 IVVIYEMNFDLILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 717
            + +   +N  L LH      F+     E L+E   L  + L    I KIENLE  +  +  +FLQ N + KIENLE L  L  L LS N IK IEN+  L  L  L +++N +  V
Sbjct:  102 LYITPALNDTLYLH------FKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQT-ELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTLQMAHNHLETV 210          
BLAST of SMED30025378 vs. Ensembl Human
Match: PPP1R7 (protein phosphatase 1 regulatory subunit 7 [Source:HGNC Symbol;Acc:HGNC:9295])

HSP 1 Score: 52.373 bits (124), Expect = 9.133e-8
Identity = 36/81 (44.44%), Postives = 52/81 (64.20%), Query Frame = -1
Query:  370 LEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 612
             + V L+   I KIE  E L   +  + L+ N I+ IENLE L +LR L L +N IKKIEN++ L +L+ILD+S+N + N+
Sbjct:   84 FQDVDLNHYRIGKIEGFEVLKK-VKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNI 163          
BLAST of SMED30025378 vs. Ensembl Celegans
Match: C06A8.6 (pep chromosome:WBcel235:II:7772499:7773914:1 gene:WBGene00015516.1 transcript:C06A8.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06A8.6)

HSP 1 Score: 55.0694 bits (131), Expect = 1.090e-8
Identity = 36/81 (44.44%), Postives = 53/81 (65.43%), Query Frame = -1
Query:  370 LEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 612
            +EH       I KIENL+ L+ ++TH+   +N+I K+ENL+SL+NL  L LS N I KIEN++ L KL+ L   +N+I  +
Sbjct:   56 VEHFSFRWNLIKKIENLDCLT-TLTHLEFYDNQITKVENLDSLVNLESLDLSFNRITKIENLEKLTKLKTLFFVHNKITKI 135          

HSP 2 Score: 48.521 bits (114), Expect = 1.970e-6
Identity = 37/101 (36.63%), Postives = 60/101 (59.41%), Query Frame = -1
Query:  370 NLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 672
            +L  +F  ++  E L+++ KL+ +      I+KIE L+ L+  + ++ L +N+I KIENL++ + L  L L  N I+ IENV  LKKL +L +  N I  V
Sbjct:  102 SLDLSFNRITKIENLEKLTKLKTLFFVHNKITKIEGLDTLT-ELEYLELGDNRIAKIENLDNNLKLDRLFLGANQIRLIENVDHLKKLTVLSLPANAITVV 201          
BLAST of SMED30025378 vs. Ensembl Celegans
Match: sds-22 (Protein phosphatase 1 regulatory subunit SDS22 homolog [Source:UniProtKB/Swiss-Prot;Acc:P45969])

HSP 1 Score: 53.1434 bits (126), Expect = 5.540e-8
Identity = 34/87 (39.08%), Postives = 57/87 (65.52%), Query Frame = -1
Query:  370 LKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 630
            L ++ KLE ++L    I KIENLE L+  +  + L +N+I+KIEN+  L+NL  L + +N I+++E V+ L+KL +L +  N I+ +
Sbjct:  121 LDKLTKLETLYLVSNKIEKIENLEALT-QLKLLELGDNRIKKIENIGHLVNLDELFIGKNKIRQLEGVETLQKLSVLSLPGNRIVKI 206          
BLAST of SMED30025378 vs. Ensembl Celegans
Match: K10D2.8 (pep chromosome:WBcel235:III:5188726:5190175:1 gene:WBGene00189952.1 transcript:K10D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10D2.8)

HSP 1 Score: 46.595 bits (109), Expect = 6.412e-6
Identity = 34/98 (34.69%), Postives = 57/98 (58.16%), Query Frame = -1
Query:  379 NLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 672
            ++SYN   ++  E L E+  LE +HL    I  IE LE  + ++ ++   +N+I+K+ENL  L+NL  L L  N I+KIE +  + +L+ L +  N +
Sbjct:   99 DVSYN--RITKIEGLSELINLEELHLVHNKIITIEGLE-TNTAMKYLEFGDNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNAL 193          
BLAST of SMED30025378 vs. Ensembl Fly
Match: sds22 (gene:FBgn0028992 transcript:FBtr0083436)

HSP 1 Score: 63.5438 bits (153), Expect = 1.920e-11
Identity = 42/100 (42.00%), Postives = 65/100 (65.00%), Query Frame = -1
Query:  370 LSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 669
            L  +F  L+  E L ++ KLE V+     I++IENL+ L+ ++T + L +NK++KIEN+E L+NLR L L +N I KIEN+  L  L+IL +  N I+ +
Sbjct:  110 LDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLT-NLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKI 208          

HSP 2 Score: 55.0694 bits (131), Expect = 1.217e-8
Identity = 41/97 (42.27%), Postives = 61/97 (62.89%), Query Frame = -1
Query:  367 DEKLKEIEKLE------HVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVS 639
            D KLK+IE +E       + L +  I+KIENL+ L  ++  + LQ N+I KIENLE L NLR L +SEN ++ IEN+    KL+ LD++ N +  ++
Sbjct:  158 DNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLV-NLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIA 253          

HSP 3 Score: 48.1358 bits (113), Expect = 2.608e-6
Identity = 34/79 (43.04%), Postives = 49/79 (62.03%), Query Frame = -1
Query:  370 HVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 606
             + L+   I K+EN E L+  I  +FL+ N I+KIENL SL  L  L L +N I KIEN+  L  L++LD+S+N +  +
Sbjct:   43 ELDLNHRRIEKLENFEPLT-RIERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKI 120          
BLAST of SMED30025378 vs. Ensembl Fly
Match: Ppr-Y (gene:FBgn0046697 transcript:FBtr0346721)

HSP 1 Score: 48.9062 bits (115), Expect = 2.163e-6
Identity = 35/81 (43.21%), Postives = 54/81 (66.67%), Query Frame = -1
Query:  379 IEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 621
            +E++  + L+  NI +I++L  L P++T + L  NKIE IEN+E L NL+ L LS N I+KIEN+  L  L++L +  N+I
Sbjct:   58 LEQILTMRLEFNNILRIDHLWIL-PNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLFSNKI 137          
BLAST of SMED30025378 vs. Ensembl Zebrafish
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 55.8398 bits (133), Expect = 3.747e-9
Identity = 35/66 (53.03%), Postives = 49/66 (74.24%), Query Frame = -1
Query:  385 ISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 582
            I KIE LE L  + T I L+ N I++IENLESL++LR L L +N I+K+EN++ L +L+ LDVS+N
Sbjct:   76 IGKIEGLEVLLKAKT-ISLRQNLIKRIENLESLVSLRELDLYDNQIRKLENLQALTELEQLDVSFN 140          
BLAST of SMED30025378 vs. Ensembl Zebrafish
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 55.4546 bits (132), Expect = 1.303e-8
Identity = 35/66 (53.03%), Postives = 49/66 (74.24%), Query Frame = -1
Query:  385 ISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 582
            I KIE LE L  + T I L+ N I++IENLESL++LR L L +N I+K+EN++ L +L+ LDVS+N
Sbjct:   73 IGKIEGLEVLLKAKT-ISLRQNLIKRIENLESLVSLRELDLYDNQIRKLENLQALTELEQLDVSFN 137          
BLAST of SMED30025378 vs. Ensembl Zebrafish
Match: dnaaf1 (dynein, axonemal, assembly factor 1 [Source:NCBI gene;Acc:386722])

HSP 1 Score: 47.7506 bits (112), Expect = 1.219e-6
Identity = 27/52 (51.92%), Postives = 36/52 (69.23%), Query Frame = -1
Query:  379 IFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 534
            ++L+ N I KIENLE+   LRCL L +NLI  +EN++ L KL  L+VS N I
Sbjct:   96 LWLECNGIRKIENLENQTELRCLFLHQNLIHTLENLEPLSKLCTLNVSNNYI 147          
BLAST of SMED30025378 vs. Ensembl Zebrafish
Match: dnaaf1 (dynein, axonemal, assembly factor 1 [Source:NCBI gene;Acc:386722])

HSP 1 Score: 48.9062 bits (115), Expect = 2.733e-6
Identity = 41/104 (39.42%), Postives = 56/104 (53.85%), Query Frame = -1
Query:  370 LHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 681
            L+  L  +F+  S  E L+E   L  + L+   I KIENLE  +  +  +FL  N I  +ENLE L  L  L +S N IK IEN+  L  L  L +S+N + NV
Sbjct:   75 LNDTLYLHFKGFSCIEGLEEYTGLRCLWLECNGIRKIENLENQT-ELRCLFLHQNLIHTLENLEPLSKLCTLNVSNNYIKVIENISSLSDLSTLQISHNTLENV 177          
BLAST of SMED30025378 vs. Ensembl Zebrafish
Match: lrguk (leucine-rich repeats and guanylate kinase domain containing [Source:ZFIN;Acc:ZDB-GENE-050419-232])

HSP 1 Score: 47.3654 bits (111), Expect = 8.436e-6
Identity = 38/105 (36.19%), Postives = 59/105 (56.19%), Query Frame = -1
Query:  358 NLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVSTGI 672
            N S+N   ++  + L     L  + LD  + S I  LE     ++H+ L +N I +I  L+ L  LR L L+ N+I KIEN++ L  LQ+LD+S N I ++ TG+
Sbjct:  100 NFSHN--QMTAMKDLSAYSSLTKLILDHNSFSVIRGLEKCK-RLSHLSLAHNNISRIRGLDHL-PLRELCLAGNMINKIENLQTLHNLQVLDLSCNRIQSL-TGL 199          
BLAST of SMED30025378 vs. Ensembl Xenopus
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:448394])

HSP 1 Score: 54.299 bits (129), Expect = 5.501e-8
Identity = 34/86 (39.53%), Postives = 59/86 (68.60%), Query Frame = -1
Query:  379 EKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 636
            E L  + +L+ + L +  I+K++NLE L+ ++T + +Q+N++ KIE L++L+NLR L LS+N I+ IE ++   KL  LD++ N I
Sbjct:  209 ENLDSLRELDSLFLGKNKITKLQNLETLT-NLTVLSVQSNRLTKIEGLQNLVNLRELYLSDNGIQVIEGLENNNKLTTLDLASNRI 293          

HSP 2 Score: 49.2914 bits (116), Expect = 2.769e-6
Identity = 33/75 (44.00%), Postives = 47/75 (62.67%), Query Frame = -1
Query:  385 EHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 609
            E V L+   I KI+  E L   +  + L+ N I+ IENLE L+ L  L L +N I+KI N++ L+ LQILD+S+N
Sbjct:   86 EDVDLNHFKIGKIQGFEVLK-KVKTLCLRQNLIKLIENLEQLVTLTELDLYDNQIRKIGNLETLRDLQILDLSFN 159          
BLAST of SMED30025378 vs. Ensembl Xenopus
Match: ENSXETT00000038727.1 (dynein axonemal assembly factor 1 [Source:NCBI gene;Acc:101730543])

HSP 1 Score: 51.2174 bits (121), Expect = 5.618e-7
Identity = 37/101 (36.63%), Postives = 58/101 (57.43%), Query Frame = -1
Query:  379 LHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 681
            L+  L  +++     E L+E   L+ + L+   ++KIENL+  +  +  +FL  N + KIENL+ L  L  L LS N IK IEN+  LK L  L ++YN++
Sbjct:   84 LNDTLYLHYKGFMCVENLEEYTGLKCLWLECNGLTKIENLDAQT-ELRCLFLHQNLVHKIENLDHLQKLDTLNLSNNCIKTIENLSCLKVLSTLQIAYNQL 183          
BLAST of SMED30025378 vs. Ensembl Xenopus
Match: ENSXETT00000038732.1 (dynein axonemal assembly factor 1 [Source:NCBI gene;Acc:101730543])

HSP 1 Score: 50.447 bits (119), Expect = 1.168e-6
Identity = 35/86 (40.70%), Postives = 52/86 (60.47%), Query Frame = -1
Query:  379 EKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 636
            E L+E   L+ + L+   ++KIENL+  +  +  +FL  N + KIENL+ L  L  L LS N IK IEN+  LK L  L ++YN++
Sbjct:   99 ENLEEYTGLKCLWLECNGLTKIENLDAQT-ELRCLFLHQNLVHKIENLDHLQKLDTLNLSNNCIKTIENLSCLKVLSTLQIAYNQL 183          
BLAST of SMED30025378 vs. Ensembl Xenopus
Match: rbpms2 (RNA binding protein with multiple splicing 2 [Source:Xenbase;Acc:XB-GENE-490341])

HSP 1 Score: 49.6766 bits (117), Expect = 2.526e-6
Identity = 43/123 (34.96%), Postives = 73/123 (59.35%), Query Frame = -1
Query:  370 VAIIIVVIYEMNFDLILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITH-IFLQ--NNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 729
            V I + V+Y + F L++     +  Q+L+    ++  E+L  ++L   +I++I+NL     S+ H IFL   +N IE+I  L SL +LR L+L +N I+KI N++ LK L +LD+  N+I  +
Sbjct:   77 VQIFVSVLYSILFRLLV--VCLFFRQNLTVCPIIEGEEQLRLLYLHHNSITRIQNLS----SLQHLIFLDLYDNNIEEISGLSSLRSLRVLMLGKNRIQKISNLENLKNLDVLDLHGNQIAKI 193          
BLAST of SMED30025378 vs. Ensembl Xenopus
Match: rbpms2 (RNA binding protein with multiple splicing 2 [Source:Xenbase;Acc:XB-GENE-490341])

HSP 1 Score: 48.521 bits (114), Expect = 5.008e-6
Identity = 35/86 (40.70%), Postives = 55/86 (63.95%), Query Frame = -1
Query:  370 EKLEHVHLDRENISKIENLEFLSPSITH-IFLQ--NNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 618
            E+L  ++L   +I++I+NL     S+ H IFL   +N IE+I  L SL +LR L+L +N I+KI N++ LK L +LD+  N+I  +
Sbjct:  101 EQLRLLYLHHNSITRIQNLS----SLQHLIFLDLYDNNIEEISGLSSLRSLRVLMLGKNRIQKISNLENLKNLDVLDLHGNQIAKI 182          
BLAST of SMED30025378 vs. Ensembl Mouse
Match: Lrrc46 (leucine rich repeat containing 46 [Source:MGI Symbol;Acc:MGI:1916547])

HSP 1 Score: 65.0846 bits (157), Expect = 8.183e-12
Identity = 42/101 (41.58%), Postives = 65/101 (64.36%), Query Frame = -1
Query:  385 LILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 687
            LI  RNL++   +  +++    + +LE V LD E I+ I NLE L  +I  ++LQ+NKI++IENL  + +LR L L+ N I+ +EN+  L+ LQ LD+S N
Sbjct:   25 LITKRNLTFPGDEDLSEKMFHTLGELETVRLDGEGITCIGNLEKLR-NIHSLYLQSNKIQRIENLACITSLRFLSLARNQIRHVENLLDLQYLQFLDLSEN 124          
BLAST of SMED30025378 vs. Ensembl Mouse
Match: Ppp1r7 (protein phosphatase 1, regulatory subunit 7 [Source:MGI Symbol;Acc:MGI:1913635])

HSP 1 Score: 53.9138 bits (128), Expect = 9.184e-9
Identity = 37/82 (45.12%), Postives = 52/82 (63.41%), Query Frame = -1
Query:  364 EHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVST 609
            E V L    I KIE LE L   +  + L+ N I+ IENLE L +LR L L +N IKKIEN++ L +L++LD+S+N + N+  
Sbjct:   36 EDVDLTHYRIGKIEGLEVLKK-VKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDISFNMLRNIEG 116          
BLAST of SMED30025378 vs. Ensembl Mouse
Match: Ppp1r7 (protein phosphatase 1, regulatory subunit 7 [Source:MGI Symbol;Acc:MGI:1913635])

HSP 1 Score: 53.9138 bits (128), Expect = 4.906e-8
Identity = 38/90 (42.22%), Postives = 57/90 (63.33%), Query Frame = -1
Query:  370 LEHVHLDRE---------NISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 612
            +E ++LDR+          I KIE LE L   +  + L+ N I+ IENLE L +LR L L +N IKKIEN++ L +L++LD+S+N + N+
Sbjct:   70 METINLDRDAEDVDLTHYRIGKIEGLEVLKK-VKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDISFNMLRNI 158          

HSP 2 Score: 53.1434 bits (126), Expect = 9.191e-8
Identity = 34/86 (39.53%), Postives = 58/86 (67.44%), Query Frame = -1
Query:  379 EKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 636
            E +  +  LE + L +  I+K++NL+ L+ ++T + +Q+N++ KIE L+SL+NLR L LS N I+ IE ++   KL +LD++ N I
Sbjct:  203 ENIDTLTNLESLFLGKNKITKLQNLDALT-NLTVLSVQSNRLAKIEGLQSLVNLRELYLSNNGIEVIEGLENNNKLTMLDIASNRI 287          
BLAST of SMED30025378 vs. Ensembl Mouse
Match: Dnaaf1 (dynein, axonemal assembly factor 1 [Source:MGI Symbol;Acc:MGI:1915520])

HSP 1 Score: 51.2174 bits (121), Expect = 5.030e-7
Identity = 30/69 (43.48%), Postives = 46/69 (66.67%), Query Frame = -1
Query:  379 NISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 585
               +IENLE  +  +  ++L+ N I++IENL++   LRCL L  NL+ KIEN++ L+KL  L++S N I
Sbjct:  112 GFDRIENLEEYT-GLRCLWLECNGIQRIENLQAQSELRCLFLQVNLLHKIENLEPLQKLDALNLSNNYI 179          

HSP 2 Score: 50.0618 bits (118), Expect = 1.165e-6
Identity = 43/117 (36.75%), Postives = 60/117 (51.28%), Query Frame = -1
Query:  367 IVVIYEMNFDLILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVS 717
            + V   +N  L LH      F+     E L+E   L  + L+   I +IENL+  S  +  +FLQ N + KIENLE L  L  L LS N IK IEN+  L  L  L +++N +  V+
Sbjct:   96 LYVTPALNDTLYLH------FKGFDRIENLEEYTGLRCLWLECNGIQRIENLQAQS-ELRCLFLQVNLLHKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTLQMAHNRLETVA 205          
BLAST of SMED30025378 vs. Ensembl Mouse
Match: Drc3 (dynein regulatory complex subunit 3 [Source:MGI Symbol;Acc:MGI:1921915])

HSP 1 Score: 47.7506 bits (112), Expect = 3.303e-6
Identity = 36/101 (35.64%), Postives = 59/101 (58.42%), Query Frame = -1
Query:  370 NLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 672
            +L  +FQ++   + L + E L+ + L+   I +IE L  L   +  + L  N IE IE L++L+NL  L LS N I K++++  L KLQ+L +  N+I N+
Sbjct:   47 SLQLDFQNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLI-HLVWLDLSFNNIEAIEGLDTLVNLEDLSLSNNRISKVDSLDALVKLQVLSLGNNQISNM 146          
BLAST of SMED30025378 vs. UniProt/SwissProt
Match: sp|Q96FV0|LRC46_HUMAN (Leucine-rich repeat-containing protein 46 OS=Homo sapiens OX=9606 GN=LRRC46 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 7.352e-14
Identity = 44/102 (43.14%), Postives = 67/102 (65.69%), Query Frame = -1
Query:  385 LILHRNLSYNFQDLSTDEKL-KEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 687
            LI  RNL++  +D    EK+   +++L+ V LDRE I+ I NLE L  ++  ++LQ NKI++IENL  + +LR L L+ N I+++EN+  L  LQ LD+S N
Sbjct:   21 LITKRNLTFP-EDGELSEKMFHTLDELQTVRLDREGITTIRNLEGLQ-NLHSLYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSEN 120          

HSP 2 Score: 29.6462 bits (65), Expect = 7.352e-14
Identity = 16/41 (39.02%), Postives = 25/41 (60.98%), Query Frame = -2
Query:  195 LTIDEIPFSLLSINIKGNPCALSNTVGQL-SKSFPFLIVLD 314
            L +DE P SLL +N+ GN C   +   +L +++ P L+ LD
Sbjct:  125 LKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLD 165          
BLAST of SMED30025378 vs. UniProt/SwissProt
Match: sp|Q4R747|LRC46_MACFA (Leucine-rich repeat-containing protein 46 OS=Macaca fascicularis OX=9541 GN=LRRC46 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.011e-13
Identity = 45/106 (42.45%), Postives = 67/106 (63.21%), Query Frame = -1
Query:  385 LILHRNLSYNFQDLSTDEKLKE-----IEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 687
            LI  RNL++       DE+L E     +++L+ V LDRE I+ I NLE L  ++  ++LQ NKI++IENL  + +LR L L+ N I+++EN+  L  LQ LD+S N
Sbjct:   21 LITKRNLTF-----PEDEELSEKMFHTLDELQTVRLDREGITTIRNLEGLK-NLHSLYLQGNKIQQIENLACVPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSEN 120          

HSP 2 Score: 29.6462 bits (65), Expect = 1.011e-13
Identity = 16/41 (39.02%), Postives = 25/41 (60.98%), Query Frame = -2
Query:  195 LTIDEIPFSLLSINIKGNPCALSNTVGQLS-KSFPFLIVLD 314
            L +DE P SLL +N+ GN C   ++  +L  ++ P L+ LD
Sbjct:  125 LKLDEFPQSLLILNLSGNSCTNQDSYRELVIEALPLLLDLD 165          
BLAST of SMED30025378 vs. UniProt/SwissProt
Match: sp|Q9DAP0|LRC46_MOUSE (Leucine-rich repeat-containing protein 46 OS=Mus musculus OX=10090 GN=Lrrc46 PE=1 SV=2)

HSP 1 Score: 65.0846 bits (157), Expect = 5.724e-11
Identity = 42/101 (41.58%), Postives = 65/101 (64.36%), Query Frame = -1
Query:  385 LILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 687
            LI  RNL++   +  +++    + +LE V LD E I+ I NLE L  +I  ++LQ+NKI++IENL  + +LR L L+ N I+ +EN+  L+ LQ LD+S N
Sbjct:   25 LITKRNLTFPGDEDLSEKMFHTLGELETVRLDGEGITCIGNLEKLR-NIHSLYLQSNKIQRIENLACITSLRFLSLARNQIRHVENLLDLQYLQFLDLSEN 124          
BLAST of SMED30025378 vs. UniProt/SwissProt
Match: sp|Q6AXZ2|LRC46_RAT (Leucine-rich repeat-containing protein 46 OS=Rattus norvegicus OX=10116 GN=Lrrc46 PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 7.126e-11
Identity = 42/101 (41.58%), Postives = 65/101 (64.36%), Query Frame = -1
Query:  385 LILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 687
            LI  RNL++   +  +++    ++ LE V LD E I+ I NLE L  +I  ++LQ+NKI++IENL  + +LR L L+ N I+ +EN+  L+ LQ LD+S N
Sbjct:   25 LITKRNLTFPEDEDLSEKMFHTLDDLETVRLDGEGITCIGNLERLR-NIHSLYLQSNKIQRIENLACITSLRFLSLAGNQIRHVENLLDLQYLQFLDLSEN 124          
BLAST of SMED30025378 vs. UniProt/SwissProt
Match: sp|Q8NEP3|DAAF1_HUMAN (Dynein assembly factor 1, axonemal OS=Homo sapiens OX=9606 GN=DNAAF1 PE=1 SV=5)

HSP 1 Score: 59.3066 bits (142), Expect = 8.557e-9
Identity = 33/72 (45.83%), Postives = 49/72 (68.06%), Query Frame = -1
Query:  370 NISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 585
               +IENLE  +  +  ++LQ+N I+KIENLE+   LRCL L  NL++KIEN++ L+KL  L++S N I  +
Sbjct:  118 GFDRIENLEEYT-GLRCLWLQSNGIQKIENLEAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTI 188          
BLAST of SMED30025378 vs. TrEMBL
Match: A0A210PSI9 (Leucine-rich repeat-containing protein 46 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19823 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.677e-18
Identity = 43/92 (46.74%), Postives = 64/92 (69.57%), Query Frame = -1
Query:  379 QDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 654
            Q  S +E ++ + K+ H+ LDRENI +I+NLE L   +T+++LQ NKI+ IENLE L NL  L L++N I+++E +  L KL  LD+S+N I
Sbjct:   39 QQKSQEEIVQALNKITHLRLDRENIGQIDNLELLGDKVTNVYLQKNKIQVIENLECLKNLTFLTLADNQIRQVEGLSHLNKLLFLDLSHNHI 130          

HSP 2 Score: 40.0466 bits (92), Expect = 7.677e-18
Identity = 30/114 (26.32%), Postives = 57/114 (50.00%), Query Frame = -2
Query:    6 IDEIPFSLLSINIKGNPC-ALSNTVGQLSKSFPFLIVLDREELETAK--------ISDVRKIEQDLTN----SDAGEISKDVTGMLNRSQQRVEENYRQRLLYNNDITDLKEKL 308
            IDE P S++ +N+K NPC +L +  G+L +    L +LD EE+  A+         SD  +  ++       +D   I    + +L  S+ R +E+ ++ + +  ++ D +EK 
Sbjct:  135 IDEFPESVMILNLKENPCTSLPDYRGRLIQDLEHLKILDEEEVTNAEKREAGFVVSSDEEEEVEEEEVVPVFTDGDSIGTCTSRILMHSKARTDEDLKKHMEHTTELDDYREKF 248          
BLAST of SMED30025378 vs. TrEMBL
Match: A0A2B4SPG0 (Leucine-rich repeat-containing protein 46 OS=Stylophora pistillata OX=50429 GN=Lrrc46 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.692e-17
Identity = 55/109 (50.46%), Postives = 74/109 (67.89%), Query Frame = -1
Query:  373 MNFDLILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIIN 699
            ++  LI  RNL  N QD S D+   E+ +L HV LDRE IS+I+NL+ L P +T+++LQ N+I +IENLE L  LR L L+EN I K+EN+K L  L+ LD+S N I N
Sbjct:    8 ISVSLIARRNL-LNKQDRSADDTAAELLELSHVRLDREKISEIDNLDCLGP-VTNLYLQKNEINRIENLEVLPKLRFLTLAENNISKLENLKTLANLKFLDLSDNNIEN 114          
BLAST of SMED30025378 vs. TrEMBL
Match: A0A2G8L8U7 (LRRcap domain-containing protein OS=Stichopus japonicus OX=307972 GN=BSL78_06410 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.774e-17
Identity = 52/106 (49.06%), Postives = 75/106 (70.75%), Query Frame = -1
Query:  370 LILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 687
            +I  RNL        +++ + ++ KL HV LDRENI +I+++E L P +T+++LQ N IEKIENLESL+ +R LVLS N IK +EN++LL KLQ LD++ N I N+
Sbjct:    1 MIAKRNLPPAIVSEGSEQLIHKMLKLTHVRLDRENIGEIDHMEVLGP-VTNLYLQQNFIEKIENLESLMEIRFLVLSGNKIKVVENIELLDKLQFLDLADNLIENL 105          
BLAST of SMED30025378 vs. TrEMBL
Match: A0A2C9KYD9 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106072306 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.315e-16
Identity = 51/103 (49.51%), Postives = 69/103 (66.99%), Query Frame = -1
Query:  391 MNFDLILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVS 699
            ++  LI+ R+L     + S +E +KE+ K   + LDRENI +I++ E LS  +TH++LQ NKI KIENLE L NL+ L+LSEN I  IEN+  L KL  LDVS
Sbjct:   35 LSLHLIVLRHLPPESSEWSHEEIIKELNKKRRIRLDRENIGQIDSCELLSADVTHLYLQFNKISKIENLECLPNLQVLILSENKITTIENIDHLNKLVFLDVS 137          

HSP 2 Score: 27.7202 bits (60), Expect = 1.315e-16
Identity = 14/44 (31.82%), Postives = 26/44 (59.09%), Query Frame = -2
Query:  183 TIDEIPFSLLSINIKGNPC-ALSNTVGQLSKSFPFLIVLDREEL 311
            +++ +P S++ +N+ GNPC + S+    + K  P L  LD  E+
Sbjct:  166 SVENLPQSIIILNLSGNPCVSQSSYKSNIIKRLPKLKHLDGAEI 209          
BLAST of SMED30025378 vs. TrEMBL
Match: A0A1S3H678 (leucine-rich repeat-containing protein 46 OS=Lingula unguis OX=7574 GN=LOC106151772 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 7.256e-16
Identity = 46/110 (41.82%), Postives = 69/110 (62.73%), Query Frame = -1
Query:  385 VVIYEMNFDLILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 714
            V    ++  +I+ R+L     D   D  ++ + K+ H+ LDRENI  I+ LE L  S+T+++LQ NKI++IENL+ L +LR L L+ N I+ IEN+  L KL  LD+S N
Sbjct:   20 VRPQRLSLHMIVRRHLPPEAADWPQDLIVESLNKITHLRLDRENIGDIDGLELLGKSVTNVYLQQNKIKRIENLDCLHSLRFLTLAGNKIRTIENLMCLPKLAFLDLSEN 129          

HSP 2 Score: 28.4906 bits (62), Expect = 7.256e-16
Identity = 31/124 (25.00%), Postives = 56/124 (45.16%), Query Frame = -2
Query:   15 LTIDEIPFSLLSINIKGNPCALSNTV-GQLSKSFPFLIVLDREELETAKISDVRK-IEQDLTNS-----------DAGEISKDV-----------TGMLNRSQQRVEENYRQRLLYNNDITDLK 314
            L ++E+P SL+ +++K N C   +    +L K  P L  LD  E+ T++   V   I  D               DA ++   +           + ML RSQQR+E+  ++  L+N ++  ++
Sbjct:  134 LDVEELPQSLIILSLKENQCTSEDGYRPRLIKELPKLRQLDGVEVRTSEKRAVGYVISSDEEEEEEEEEEENNVDDAADVEHTIEQIKGVFKTLTSDMLLRSQQRLEDTLKEHKLHNVELEAIR 257          
BLAST of SMED30025378 vs. Ensembl Cavefish
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:111191999])

HSP 1 Score: 54.6842 bits (130), Expect = 2.411e-8
Identity = 35/66 (53.03%), Postives = 48/66 (72.73%), Query Frame = -1
Query:  385 ISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 582
            I KIE LE L  + T + L+ N I+KIENLESL +LR L L +N I+K+EN++ L +L+ LDVS+N
Sbjct:   74 IGKIEGLEVLQKAKT-LSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLQALTELEQLDVSFN 138          

HSP 2 Score: 50.8322 bits (120), Expect = 4.582e-7
Identity = 33/86 (38.37%), Postives = 56/86 (65.12%), Query Frame = -1
Query:  379 EKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 636
            E L  +  L+ + L    I+K++NL+ L  ++T + +Q+N+I K+E L++++NLR L LS N I+ IE ++  KKL  LD++ N I
Sbjct:  188 ENLDALTSLDSLFLGTNKITKLQNLDGLH-NLTVLSIQSNRITKLEGLQNMVNLRELYLSHNGIEVIEGLENNKKLTTLDIAANRI 272          
BLAST of SMED30025378 vs. Ensembl Cavefish
Match: lrguk (leucine rich repeats and guanylate kinase domain containing [Source:NCBI gene;Acc:103023555])

HSP 1 Score: 51.2174 bits (121), Expect = 3.893e-7
Identity = 34/77 (44.16%), Postives = 50/77 (64.94%), Query Frame = -1
Query:  367 LDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVS 597
            LD  +I++I+ +E  S S+ H  + +NKI +I  L +L  L+ L L  NLIKKIEN+  L+ LQ LD+S N I ++S
Sbjct:  120 LDYNSITEIKGVEKCS-SLIHFSIAHNKISRISGLNNL-PLKHLCLRGNLIKKIENLHTLRALQFLDISSNRIHSLS 194          
BLAST of SMED30025378 vs. Ensembl Cavefish
Match: dnaaf1 (dynein axonemal assembly factor 1 [Source:NCBI gene;Acc:103025595])

HSP 1 Score: 48.521 bits (114), Expect = 3.202e-6
Identity = 30/65 (46.15%), Postives = 41/65 (63.08%), Query Frame = -1
Query:  379 IENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 573
            IE LE  +  +  ++LQ N I+KIENL++   LRCL L +NLI  +EN+  L  L  L+VS N I
Sbjct:   88 IEGLEEYT-GLRSLWLQCNGIKKIENLQNQTELRCLYLHQNLIHTLENLHPLTMLSTLNVSNNRI 151          
BLAST of SMED30025378 vs. Ensembl Cavefish
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:103025716])

HSP 1 Score: 47.3654 bits (111), Expect = 6.579e-6
Identity = 40/117 (34.19%), Postives = 61/117 (52.14%), Query Frame = -1
Query:  385 NFVAIIIVVIYEMNFDLILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 735
              + + I  I  +  DLI  R    N           EI  LE V L +++I +IE+++     +  ++LQNN I KIEN+  L NL  L L+ N I+ IEN++  + LQ LD++ N
Sbjct:    7 GILGVCIECISPVTEDLIRRRAEHNNC----------EIFTLEEVSLHQQDIERIEHIDKWCRDLKILYLQNNLIPKIENVGRLKNLEYLNLALNNIEVIENLEGCESLQKLDLTVN 113          
BLAST of SMED30025378 vs. Ensembl Sea Lamprey
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 53.9138 bits (128), Expect = 7.799e-9
Identity = 36/75 (48.00%), Postives = 49/75 (65.33%), Query Frame = -1
Query:  385 EHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 609
            E V L+   I KIE LE L   +  + L+ N I +IENLESL  LR L L +N++KKIEN+  L  L++LD+S+N
Sbjct:   59 EEVDLNHCRIGKIERLEILM-KVKVLCLRQNMIAQIENLESLTTLRELDLYDNVLKKIENLDTLVNLEMLDISFN 132          

HSP 2 Score: 51.6026 bits (122), Expect = 4.948e-8
Identity = 32/86 (37.21%), Postives = 59/86 (68.60%), Query Frame = -1
Query:  379 EKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 636
            E ++ ++ L+ + + +  I+K++NL+ L+ ++T + +Q+N+I KIE L SL+NL+ L LS N I+ IE ++  KKL  LD++ N +
Sbjct:  182 ENIETLKNLDSLFIGKNKITKLQNLDSLT-NLTVLSIQSNRITKIEGLSSLVNLQELYLSHNGIEVIEGLENNKKLTTLDIAANRV 266          

HSP 3 Score: 48.521 bits (114), Expect = 4.580e-7
Identity = 41/93 (44.09%), Postives = 57/93 (61.29%), Query Frame = -1
Query:  379 DEKLKEIEKLEH-VHLDRENIS-----KIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 639
            D  LK+IE L+  V+L+  +IS     KIE L+ L   +  +FL +NKI KIENL SL  LR L ++ N I+ IEN++ LK L  L +  N+I
Sbjct:  109 DNVLKKIENLDTLVNLEMLDISFNVLRKIEGLDTLR-KVRKLFLVSNKITKIENLNSLTELRMLEVASNRIRVIENIETLKNLDSLFIGKNKI 200          

HSP 4 Score: 45.8246 bits (107), Expect = 3.493e-6
Identity = 41/122 (33.61%), Postives = 75/122 (61.48%), Query Frame = -1
Query:  370 NFVAIIIVVIYEMNFDLILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 735
            N VA+ I  I E+N D      +  N   +   E+L+ + K++ + L +  I++IENLE L+ ++  + L +N ++KIENL++L+NL  L +S N+++KIE +  L+K++ L +  N+I  +
Sbjct:   43 NEVAVDIATI-ELNPD---DEEVDLNHCRIGKIERLEILMKVKVLCLRQNMIAQIENLESLT-TLRELDLYDNVLKKIENLDTLVNLEMLDISFNVLRKIEGLDTLRKVRKLFLVSNKITKI 159          
BLAST of SMED30025378 vs. Ensembl Sea Lamprey
Match: ppp1r42 (protein phosphatase 1, regulatory subunit 42 [Source:NCBI gene;Acc:431749])

HSP 1 Score: 48.1358 bits (113), Expect = 4.528e-7
Identity = 28/76 (36.84%), Postives = 45/76 (59.21%), Query Frame = -1
Query:  409 EKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKL 636
            E L     L  ++L    +S++ NL F S  +TH++LQNN +E++E L +L +L  L L  N I  +E V++L +L
Sbjct:    1 EDLSACRNLAVLYLYDNRLSRMPNLAFAS-HLTHLYLQNNALERMEGLATLRHLSKLYLGGNSISVVEGVEMLSEL 75          
BLAST of SMED30025378 vs. Ensembl Nematostella
Match: EDO28294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6W0])

HSP 1 Score: 75.8702 bits (185), Expect = 2.721e-17
Identity = 44/86 (51.16%), Postives = 61/86 (70.93%), Query Frame = -1
Query:  358 KLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVSTGI 615
            +L HV LDREN+  I+NLE L  ++T+++LQ+N IE IENLE+L  L  L L+ N I +++N+K L KL+ LD+S N I   STGI
Sbjct:    6 QLTHVRLDRENLKCIDNLECLG-NVTNLYLQHNNIEYIENLETLQQLNFLTLASNKISEVKNLKCLNKLKFLDLSDNNITEFSTGI 90          
BLAST of SMED30025378 vs. Ensembl Nematostella
Match: EDO45823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRU3])

HSP 1 Score: 69.3218 bits (168), Expect = 3.262e-16
Identity = 41/81 (50.62%), Postives = 57/81 (70.37%), Query Frame = -1
Query:  364 HVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVST 606
            HV LDREN+  I+NLE L  ++T+++LQ+N IE IENLE+L  L  L L+ N I +++N+K L KL+ LD+S N I   ST
Sbjct:   15 HVRLDRENLKCIDNLECLG-NVTNLYLQHNNIEYIENLETLQQLNFLTLASNKISEVKNLKCLNKLKFLDLSDNNITEFST 94          

HSP 2 Score: 32.3426 bits (72), Expect = 3.262e-16
Identity = 17/41 (41.46%), Postives = 23/41 (56.10%), Query Frame = -2
Query:  195 LTIDEIPFSLLSINIKGNPCALS-NTVGQLSKSFPFLIVLD 314
             + DE P  LL +N++GNPC  S N    + K+ P L  LD
Sbjct:   92 FSTDEFPSELLILNLQGNPCLQSENYRSCILKALPHLKQLD 132          
BLAST of SMED30025378 vs. Ensembl Nematostella
Match: EDO32918 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STQ2])

HSP 1 Score: 54.6842 bits (130), Expect = 5.111e-9
Identity = 33/97 (34.02%), Postives = 55/97 (56.70%), Query Frame = -1
Query:  367 FQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVS 657
            F+     E L+E   ++ + L+   I KIENL F+   +  ++LQ N ++K+ENLE L  L  L +S N+I+ IEN+  L  L  L +++N + +  
Sbjct:   29 FRGFGKIENLEEYTGVKCLWLECNGIEKIENLGFMK-ELKCLYLQQNMLKKVENLEELDGLDTLNVSNNIIRSIENIACLPVLNTLQIAHNRLASAG 124          

HSP 2 Score: 51.9878 bits (123), Expect = 3.957e-8
Identity = 31/73 (42.47%), Postives = 47/73 (64.38%), Query Frame = -1
Query:  385 VHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 603
            ++L      KIENLE  +  +  ++L+ N IEKIENL  +  L+CL L +N++KK+EN++ L  L  L+VS N
Sbjct:   25 LYLHFRGFGKIENLEEYT-GVKCLWLECNGIEKIENLGFMKELKCLYLQQNMLKKVENLEELDGLDTLNVSNN 96          
BLAST of SMED30025378 vs. Ensembl Nematostella
Match: EDO35299 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLU3])

HSP 1 Score: 50.8322 bits (120), Expect = 1.672e-7
Identity = 36/72 (50.00%), Postives = 47/72 (65.28%), Query Frame = -1
Query:  367 ISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVS 582
            ISKIE L+ L  ++ H+ L +N+I  IE L SL  LR L LS N I  +E ++ L+KL  LD+SYN I NVS
Sbjct:   46 ISKIEGLQHLQ-NLRHLDLSSNQISHIEGLTSLGYLRVLNLSCNRIYLVEGLENLRKLTKLDLSYNFIENVS 116          
BLAST of SMED30025378 vs. Ensembl Nematostella
Match: EDO44937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU20])

HSP 1 Score: 50.447 bits (119), Expect = 1.870e-7
Identity = 40/89 (44.94%), Postives = 57/89 (64.04%), Query Frame = -1
Query:  379 EKLKEIEKLEHVH---LDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 636
            +K++  E+L  V    L R  I K+ENLE L+ S+  +   +N+I KIENL+ L+NLR L LS N+IK IEN+  L KL+ L +  N+I
Sbjct:   40 DKIQNFERLRCVKSLCLRRNEIKKLENLETLT-SLEELDFYDNQISKIENLDRLVNLRILDLSFNVIKVIENLNSLTKLEKLYLVQNKI 127          
BLAST of SMED30025378 vs. Ensembl Medaka
Match: dnaaf1 (dynein, axonemal, assembly factor 1 [Source:NCBI gene;Acc:386722])

HSP 1 Score: 56.9954 bits (136), Expect = 3.508e-9
Identity = 38/93 (40.86%), Postives = 59/93 (63.44%), Query Frame = -1
Query:  379 QDLSTDEKLKEIEKL-EHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 654
            +DL    KL     L + ++L  +  S+IENLE  +  +  ++L NN +E+IENL++  +LRCL L++N I K+EN++ L KL  L+VS N I
Sbjct:   62 RDLCKQNKLYMTPHLNDTLYLHFKGFSRIENLEEYT-GLKSLWLHNNALERIENLDAQTDLRCLFLNDNQILKLENLQPLTKLCTLNVSNNYI 153          
BLAST of SMED30025378 vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 52.373 bits (124), Expect = 1.164e-7
Identity = 35/66 (53.03%), Postives = 47/66 (71.21%), Query Frame = -1
Query:  385 ISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 582
            I KIE LE L  + T + L+ N I+KIENLESL +LR L L +N I+K+EN+  L +L+ LDVS+N
Sbjct:   74 IGKIEGLEVLQKAKT-LSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFN 138          

HSP 2 Score: 49.2914 bits (116), Expect = 1.286e-6
Identity = 40/99 (40.40%), Postives = 65/99 (65.66%), Query Frame = -1
Query:  340 EKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVSTGI*T*KHF 636
            E L+ ++K + + L +  I KIENLE LS S+  + L +N+I K+ENL++L  L  L +S N+++KIEN++ L +L+ L + +N+I    TGI   +HF
Sbjct:   78 EGLEVLQKAKTLSLRQNLIKKIENLESLS-SLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKI----TGIANLEHF 171          

HSP 3 Score: 47.3654 bits (111), Expect = 6.878e-6
Identity = 34/78 (43.59%), Postives = 49/78 (62.82%), Query Frame = -1
Query:  379 LEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 612
            LE + L    I  IENL+ L+ S+T +FL  NKI K++NL++L NL  L +  N I KIE ++ L  L+ L +S+N I
Sbjct:  174 LEMLELGSNRIRVIENLDGLT-SLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGI 250          
BLAST of SMED30025378 vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 52.373 bits (124), Expect = 1.389e-7
Identity = 38/76 (50.00%), Postives = 51/76 (67.11%), Query Frame = -1
Query:  385 LEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 612
            L+ V L    I KIE LE L  + T + L+ N I+KIENLESL +LR L L +N I+K+EN+  L +L+ LDVS+N
Sbjct:  103 LQDVDLVHCRIGKIEGLEVLQKAKT-LSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFN 177          

HSP 2 Score: 48.9062 bits (115), Expect = 1.780e-6
Identity = 40/99 (40.40%), Postives = 65/99 (65.66%), Query Frame = -1
Query:  340 EKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVSTGI*T*KHF 636
            E L+ ++K + + L +  I KIENLE LS S+  + L +N+I K+ENL++L  L  L +S N+++KIEN++ L +L+ L + +N+I    TGI   +HF
Sbjct:  117 EGLEVLQKAKTLSLRQNLIKKIENLESLS-SLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKI----TGIANLEHF 210          

HSP 3 Score: 46.9802 bits (110), Expect = 9.471e-6
Identity = 34/78 (43.59%), Postives = 49/78 (62.82%), Query Frame = -1
Query:  379 LEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 612
            LE + L    I  IENL+ L+ S+T +FL  NKI K++NL++L NL  L +  N I KIE ++ L  L+ L +S+N I
Sbjct:  213 LEMLELGSNRIRVIENLDGLT-SLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGI 289          
BLAST of SMED30025378 vs. Ensembl Medaka
Match: drc3 (dynein regulatory complex subunit 3 [Source:NCBI gene;Acc:101162841])

HSP 1 Score: 48.9062 bits (115), Expect = 2.204e-6
Identity = 32/75 (42.67%), Postives = 54/75 (72.00%), Query Frame = -1
Query:  379 VHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEI 603
            + L+ +NI +I++L+  + S+  + L NN I+KI+ L+SLINL  L LS N I+KI+ +  L+KL++L++S N+I
Sbjct:   41 IKLEYQNIQRIDSLQEYT-SLVRLDLNNNLIKKIQGLDSLINLTWLNLSFNRIEKIQGLTSLQKLKVLNLSNNQI 114          
BLAST of SMED30025378 vs. Ensembl Medaka
Match: lrguk (leucine rich repeats and guanylate kinase domain containing [Source:NCBI gene;Acc:101165778])

HSP 1 Score: 48.521 bits (114), Expect = 3.529e-6
Identity = 39/105 (37.14%), Postives = 60/105 (57.14%), Query Frame = -1
Query:  358 NLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVSTGI 672
            N SYN   L+  + L   E L  + LD  +IS+I  LE     +TH+ L +NKI +I  L+ L  L  L L  N ++KI+ ++ +K LQ+LD+S N +  + TG+
Sbjct:  100 NFSYNL--LTEMKSLFAYESLSKLILDYNSISEITGLEQCY-RLTHLSLAHNKISRISGLDGL-PLTYLCLRGNQLQKIDGLENVKSLQVLDLSLNRVTCL-TGL 199          
BLAST of SMED30025378 vs. Planmine SMEST
Match: SMESG000002782.1 (SMESG000002782.1)

HSP 1 Score: 214.157 bits (544), Expect = 2.723e-111
Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = -1
Query:  364 MNFDLILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVST 699
            MNFDLILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVST
Sbjct:    1 MNFDLILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVST 112          

HSP 2 Score: 207.223 bits (526), Expect = 2.723e-111
Identity = 101/104 (97.12%), Postives = 103/104 (99.04%), Query Frame = -2
Query:    3 LTIDEIPFSLLSINIKGNPCALSNTVGQLSKSFPFLIVLDREELETAKISDVRKIEQDLTNSDAGEISKDVTGMLNRSQQRVEENYRQRLLYNNDITDLKEKLA 314
            ++ DEIPFSLLSINIKGNPCALSNTVGQLSKSFPFLIVLDREELETAKISDVRKIEQDLTNSDAGEISKDVTGMLNRSQQRVEENYRQRLLYNNDITDLKEKLA
Sbjct:  110 VSTDEIPFSLLSINIKGNPCALSNTVGQLSKSFPFLIVLDREELETAKISDVRKIEQDLTNSDAGEISKDVTGMLNRSQQRVEENYRQRLLYNNDITDLKEKLA 213          
BLAST of SMED30025378 vs. Planmine SMEST
Match: SMESG000026105.1 (SMESG000026105.1)

HSP 1 Score: 64.3142 bits (155), Expect = 8.618e-12
Identity = 40/89 (44.94%), Postives = 59/89 (66.29%), Query Frame = -1
Query:  370 EKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINV 636
            E L  + KL+ ++L +  ISK+ENL+F+  ++T + +Q N+I +I+ L++LINL  L LS N I KIEN+  L KL  LD+S N I  V
Sbjct:  151 ENLDSLTKLDQLYLGKNKISKLENLDFMK-NLTVLSIQGNRITQIDGLDNLINLEQLYLSHNGISKIENLGNLTKLTTLDLSSNRISKV 238          

HSP 2 Score: 48.9062 bits (115), Expect = 1.372e-6
Identity = 38/90 (42.22%), Postives = 53/90 (58.89%), Query Frame = -1
Query:  400 LSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQIL 669
            + +N   L   E L ++ K + + L    I KIENLE +S ++  + L +N+I KIENL+ L+NL  L LS N IK IEN+  L KL  L
Sbjct:   29 IDFNHARLERIENLDQLTKAKSLCLRNNLIKKIENLETISETLEELDLYDNQITKIENLDKLVNLSILDLSFNRIKLIENIDKLIKLTKL 118          
BLAST of SMED30025378 vs. Planmine SMEST
Match: SMESG000004112.1 (SMESG000004112.1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.349e-8
Identity = 34/74 (45.95%), Postives = 49/74 (66.22%), Query Frame = -1
Query:  385 VHLDRENISKIENL-EFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 603
            ++L  +  + IENL E++   +  +FL+ N I KIENLE L  LRCL LS+NLI +IEN+  L  L  +D+S+N
Sbjct:  184 LYLHYKGFAFIENLDEYVG--LRCLFLETNGISKIENLEMLTELRCLYLSKNLISRIENIATLVNLDSIDLSHN 255          

HSP 2 Score: 52.7582 bits (125), Expect = 8.310e-8
Identity = 36/90 (40.00%), Postives = 56/90 (62.22%), Query Frame = -1
Query:  367 EKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVS 636
            E L E   L  + L+   ISKIENLE L+  +  ++L  N I +IEN+ +L+NL  + LS NL+ KIEN++ L K   L +++N++  +S
Sbjct:  195 ENLDEYVGLRCLFLETNGISKIENLEMLT-ELRCLYLSKNLISRIENIATLVNLDSIDLSHNLVAKIENLRNLPKFTKLILAHNKVQKIS 283          
BLAST of SMED30025378 vs. Planmine SMEST
Match: SMESG000004112.1 (SMESG000004112.1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.477e-8
Identity = 34/74 (45.95%), Postives = 49/74 (66.22%), Query Frame = -1
Query:  385 VHLDRENISKIENL-EFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 603
            ++L  +  + IENL E++   +  +FL+ N I KIENLE L  LRCL LS+NLI +IEN+  L  L  +D+S+N
Sbjct:  184 LYLHYKGFAFIENLDEYVG--LRCLFLETNGISKIENLEMLTELRCLYLSKNLISRIENIATLVNLDSIDLSHN 255          

HSP 2 Score: 52.7582 bits (125), Expect = 8.626e-8
Identity = 36/90 (40.00%), Postives = 56/90 (62.22%), Query Frame = -1
Query:  367 EKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVS 636
            E L E   L  + L+   ISKIENLE L+  +  ++L  N I +IEN+ +L+NL  + LS NL+ KIEN++ L K   L +++N++  +S
Sbjct:  195 ENLDEYVGLRCLFLETNGISKIENLEMLT-ELRCLYLSKNLISRIENIATLVNLDSIDLSHNLVAKIENLRNLPKFTKLILAHNKVQKIS 283          
BLAST of SMED30025378 vs. Planmine SMEST
Match: SMESG000004118.1 (SMESG000004118.1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.600e-8
Identity = 34/74 (45.95%), Postives = 49/74 (66.22%), Query Frame = -1
Query:  385 VHLDRENISKIENL-EFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYN 603
            ++L  +  + IENL E++   +  +FL+ N I KIENLE L  LRCL LS+NLI +IEN+  L  L  +D+S+N
Sbjct:  184 LYLHYKGFAFIENLDEYVG--LRCLFLETNGISKIENLEMLTELRCLYLSKNLISRIENIATLVNLDSIDLSHN 255          

HSP 2 Score: 53.1434 bits (126), Expect = 7.710e-8
Identity = 36/90 (40.00%), Postives = 56/90 (62.22%), Query Frame = -1
Query:  367 EKLKEIEKLEHVHLDRENISKIENLEFLSPSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQILDVSYNEIINVS 636
            E L E   L  + L+   ISKIENLE L+  +  ++L  N I +IEN+ +L+NL  + LS NL+ KIEN++ L K   L +++N++  +S
Sbjct:  195 ENLDEYVGLRCLFLETNGISKIENLEMLT-ELRCLYLSKNLISRIENIATLVNLDSIDLSHNLVAKIENLRNLPKFTKLILAHNKVQKIS 283          
The following BLAST results are available for this feature:
BLAST of SMED30025378 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC461.743e-1443.14leucine rich repeat containing 46 [Source:HGNC Sym... [more]
DNAAF11.390e-947.83dynein axonemal assembly factor 1 [Source:HGNC Sym... [more]
DNAAF11.728e-945.83dynein axonemal assembly factor 1 [Source:HGNC Sym... [more]
DNAAF11.782e-945.83dynein axonemal assembly factor 1 [Source:HGNC Sym... [more]
PPP1R79.133e-844.44protein phosphatase 1 regulatory subunit 7 [Source... [more]
back to top
BLAST of SMED30025378 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C06A8.61.090e-844.44pep chromosome:WBcel235:II:7772499:7773914:1 gene:... [more]
sds-225.540e-839.08Protein phosphatase 1 regulatory subunit SDS22 hom... [more]
K10D2.86.412e-634.69pep chromosome:WBcel235:III:5188726:5190175:1 gene... [more]
back to top
BLAST of SMED30025378 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sds221.920e-1142.00gene:FBgn0028992 transcript:FBtr0083436[more]
Ppr-Y2.163e-643.21gene:FBgn0046697 transcript:FBtr0346721[more]
back to top
BLAST of SMED30025378 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r73.747e-953.03protein phosphatase 1, regulatory (inhibitor) subu... [more]
ppp1r71.303e-853.03protein phosphatase 1, regulatory (inhibitor) subu... [more]
dnaaf11.219e-651.92dynein, axonemal, assembly factor 1 [Source:NCBI g... [more]
dnaaf12.733e-639.42dynein, axonemal, assembly factor 1 [Source:NCBI g... [more]
lrguk8.436e-636.19leucine-rich repeats and guanylate kinase domain c... [more]
back to top
BLAST of SMED30025378 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r75.501e-839.53protein phosphatase 1 regulatory subunit 7 [Source... [more]
ENSXETT00000038727.15.618e-736.63dynein axonemal assembly factor 1 [Source:NCBI gen... [more]
ENSXETT00000038732.11.168e-640.70dynein axonemal assembly factor 1 [Source:NCBI gen... [more]
rbpms22.526e-634.96RNA binding protein with multiple splicing 2 [Sour... [more]
rbpms25.008e-640.70RNA binding protein with multiple splicing 2 [Sour... [more]
back to top
BLAST of SMED30025378 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrc468.183e-1241.58leucine rich repeat containing 46 [Source:MGI Symb... [more]
Ppp1r79.184e-945.12protein phosphatase 1, regulatory subunit 7 [Sourc... [more]
Ppp1r74.906e-842.22protein phosphatase 1, regulatory subunit 7 [Sourc... [more]
Dnaaf15.030e-743.48dynein, axonemal assembly factor 1 [Source:MGI Sym... [more]
Drc33.303e-635.64dynein regulatory complex subunit 3 [Source:MGI Sy... [more]
back to top
BLAST of SMED30025378 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96FV0|LRC46_HUMAN7.352e-1443.14Leucine-rich repeat-containing protein 46 OS=Homo ... [more]
sp|Q4R747|LRC46_MACFA1.011e-1342.45Leucine-rich repeat-containing protein 46 OS=Macac... [more]
sp|Q9DAP0|LRC46_MOUSE5.724e-1141.58Leucine-rich repeat-containing protein 46 OS=Mus m... [more]
sp|Q6AXZ2|LRC46_RAT7.126e-1141.58Leucine-rich repeat-containing protein 46 OS=Rattu... [more]
sp|Q8NEP3|DAAF1_HUMAN8.557e-945.83Dynein assembly factor 1, axonemal OS=Homo sapiens... [more]
back to top
BLAST of SMED30025378 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PSI97.677e-1846.74Leucine-rich repeat-containing protein 46 OS=Mizuh... [more]
A0A2B4SPG01.692e-1750.46Leucine-rich repeat-containing protein 46 OS=Stylo... [more]
A0A2G8L8U72.774e-1749.06LRRcap domain-containing protein OS=Stichopus japo... [more]
A0A2C9KYD91.315e-1649.51Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1S3H6787.256e-1641.82leucine-rich repeat-containing protein 46 OS=Lingu... [more]
back to top
BLAST of SMED30025378 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ppp1r72.411e-853.03protein phosphatase 1 regulatory subunit 7 [Source... [more]
lrguk3.893e-744.16leucine rich repeats and guanylate kinase domain c... [more]
dnaaf13.202e-646.15dynein axonemal assembly factor 1 [Source:NCBI gen... [more]
lrrc66.579e-634.19leucine rich repeat containing 6 [Source:NCBI gene... [more]
back to top
BLAST of SMED30025378 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ppp1r77.799e-948.00protein phosphatase 1, regulatory (inhibitor) subu... [more]
ppp1r424.528e-736.84protein phosphatase 1, regulatory subunit 42 [Sour... [more]
back to top
BLAST of SMED30025378 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025378 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO282942.721e-1751.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458233.262e-1650.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329185.111e-934.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352991.672e-750.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449371.870e-744.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30025378 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnaaf13.508e-940.86dynein, axonemal, assembly factor 1 [Source:NCBI g... [more]
ppp1r71.164e-753.03protein phosphatase 1 regulatory subunit 7 [Source... [more]
ppp1r71.389e-750.00protein phosphatase 1 regulatory subunit 7 [Source... [more]
drc32.204e-642.67dynein regulatory complex subunit 3 [Source:NCBI g... [more]
lrguk3.529e-637.14leucine rich repeats and guanylate kinase domain c... [more]
back to top
BLAST of SMED30025378 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002782.12.723e-111100.00SMESG000002782.1[more]
SMESG000026105.18.618e-1244.94SMESG000026105.1[more]
SMESG000004112.13.349e-845.95SMESG000004112.1[more]
SMESG000004112.13.477e-845.95SMESG000004112.1[more]
SMESG000004118.13.600e-845.95SMESG000004118.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025378 ID=SMED30025378|Name=SMED30025378|organism=Schmidtea mediterranea sexual|type=transcript|length=753bp
GCCGCTAATTTCTCCTTCAAATCTGTAATGTCGTTGTTATAGAGCAAGCG
TTGTCGATAATTCTCCTCAACGCGCTGCTGAGATCGGTTGAGCATGCCTG
TGACATCCTTACTGATCTCCCCGGCATCTGAATTAGTTAAATCTTGCTCG
ATTTTCCTAACATCACTTATTTTAGCCGTTTCCAATTCCTCACGATCTAA
TACTATAAGAAATGGAAAGGATTTTGACAATTGGCCAACTGTATTTGACA
AAGCACATGGATTGCCTTTGATGTTGATGGACAGAAGTGAGAAAGGTATT
TCATCTATTGTCAGTAGTAATTAGACAAACATCATTTACAAAATGTTTTT
ATGTCTAAATACCTGTTGAAACATTGATAATTTCATTATAAGAGACATCG
AGAATCTGTAATTTCTTCAACAGTTTTACGTTTTCTATTTTTTTAATCAG
ATTTTCTGATAGTACGAGACAACGTAAATTTATTAAACTTTCGAGATTTT
CAATTTTCTCGATTTTGTTATTTTGCAAAAATATGTGCGTTATTGACGGA
GAAAGAAATTCTAAATTTTCAATTTTAGAAATATTTTCTCGATCAAGATG
AACATGTTCCAGTTTTTCTATTTCCTTTAATTTTTCATCAGTCGATAAAT
CTTGGAAATTGTATGACAAATTTCGATGAAGAATTAGGTCAAAATTCATT
TCATAGATAACTACTATAATTATAGCAACAAAATTTAATTGATGTATTTA
AAG
back to top

protein sequence of SMED30025378-orf-1

>SMED30025378-orf-1 ID=SMED30025378-orf-1|Name=SMED30025378-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=115bp
MNFDLILHRNLSYNFQDLSTDEKLKEIEKLEHVHLDRENISKIENLEFLS
PSITHIFLQNNKIEKIENLESLINLRCLVLSENLIKKIENVKLLKKLQIL
DVSYNEIINVSTGI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR025875Leu-rich_rpt_4
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00365LRR_sd22_2coord: 72..93
e-value: 69.0
score: 8.7
coord: 50..71
e-value: 0.26
score: 20.4
coord: 94..112
e-value: 30.0
score: 11.7
NoneNo IPR availablePANTHERPTHR45973FAMILY NOT NAMEDcoord: 4..107
NoneNo IPR availablePANTHERPTHR45973:SF1LEUCINE-RICH REPEAT-CONTAINING PROTEIN 46coord: 4..107
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 14..112
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 4..112
e-value: 2.3E-16
score: 61.4
IPR025875Leucine rich repeat 4PFAMPF12799LRR_4coord: 51..90
e-value: 2.8E-6
score: 27.6
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 74..95
score: 8.659
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 52..73
score: 8.197
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 29..50
score: 7.342
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 96..114
score: 5.825