Golgi-associated plant pathogenesis-related protein 1

Overview
NameGolgi-associated plant pathogenesis-related protein 1
Smed IDSMED30025368
Length (bp)845
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Golgi-associated plant pathogenesis-related protein 1 (SMED30025368) t-SNE clustered cells

Violin plots show distribution of expression levels for Golgi-associated plant pathogenesis-related protein 1 (SMED30025368) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Golgi-associated plant pathogenesis-related protein 1 (SMED30025368) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Golgi-associated plant pathogenesis-related protein 1 (SMED30025368) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025368

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025368SMESG000063559.1 Contig1497GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30025368SMESG000063559.1 dd_Smed_v4_2929_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025368SMESG000063559.1 dd_Smed_v4_2929_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30025368SMESG000063559.1 dd_Smed_v4_2929_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Human
Match: GLIPR2 (GLI pathogenesis related 2 [Source:HGNC Symbol;Acc:HGNC:18007])

HSP 1 Score: 102.834 bits (255), Expect = 1.442e-26
Identity = 63/153 (41.18%), Postives = 88/153 (57.52%), Query Frame = 1
Query:   52 HNDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHS--KSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENIPSP 498
            HN+V    LK HN+ R  H VP L +  NL + AQ+Y+E LA T    HS   S G+ GENLA +      Y  +G+     WY EIK+Y F Q+       GHF+ +VWK+TK  G G+A +++G+  +V +Y PAGN +  G F+EN+  P
Sbjct:   10 HNEV----LKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWA-----SYDQTGKEVADRWYSEIKNYNF-QQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENVLPP 152          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Human
Match: GLIPR2 (GLI pathogenesis related 2 [Source:HGNC Symbol;Acc:HGNC:18007])

HSP 1 Score: 80.8777 bits (198), Expect = 1.979e-18
Identity = 56/155 (36.13%), Postives = 77/155 (49.68%), Query Frame = 1
Query:   52 HNDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHS--KSEGKYGENLASSFNSKPGYVFSGEAATQNW--YDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENIPSP 498
            HN+V    LK HN+ R  H VP L +  NL + AQ+Y+E LA T    HS   S G+ GENLA                   W  YD+                GHF+ +VWK+TK  G G+A +++G+  +V +Y PAGN +  G F+EN+  P
Sbjct:   10 HNEV----LKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLA-------------------WASYDQT---------------GHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENVLPP 126          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 62.003 bits (149), Expect = 1.075e-10
Identity = 54/170 (31.76%), Postives = 78/170 (45.88%), Query Frame = 1
Query:   37 ALNNDHNDVNVSALKHHNKLRALHRVP---NLTIDWNLAKTAQEYAEKLAKTNSFCHS-----KSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQ-NEKIGHFSQVVWKDTKAAGFGRAKSTNGN---FIIVGQYKPAGNFIGKFKENIPSPIGAP 510
            AL      V    +  HN+LR     P    L ++W+   T    A++ A   +  HS     K+  + GENL  S  S P    S  +A Q+WYDEI D+ +    +  N  +GH++Q+VW  T   G G A   N +   +  V QY PAGN +   ++N P   G P
Sbjct:   28 ALLTTQLQVQREIVNKHNELRKAVSPPASNMLKMEWSREVTTN--AQRWANKCTLQHSDPEDRKTSTRCGENLYMS--SDPT---SWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGNNMN--RKNTPYQQGTP 188          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 62.003 bits (149), Expect = 1.075e-10
Identity = 54/170 (31.76%), Postives = 78/170 (45.88%), Query Frame = 1
Query:   37 ALNNDHNDVNVSALKHHNKLRALHRVP---NLTIDWNLAKTAQEYAEKLAKTNSFCHS-----KSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQ-NEKIGHFSQVVWKDTKAAGFGRAKSTNGN---FIIVGQYKPAGNFIGKFKENIPSPIGAP 510
            AL      V    +  HN+LR     P    L ++W+   T    A++ A   +  HS     K+  + GENL  S  S P    S  +A Q+WYDEI D+ +    +  N  +GH++Q+VW  T   G G A   N +   +  V QY PAGN +   ++N P   G P
Sbjct:   28 ALLTTQLQVQREIVNKHNELRKAVSPPASNMLKMEWSREVTTN--AQRWANKCTLQHSDPEDRKTSTRCGENLYMS--SDPT---SWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGNNMN--RKNTPYQQGTP 188          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Human
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 60.077 bits (144), Expect = 5.376e-10
Identity = 55/170 (32.35%), Postives = 75/170 (44.12%), Query Frame = 1
Query:   37 ALNNDHNDVNVSALKHHNKLRALHRVP---NLTIDWNLAKTAQEYAEKLAKTNSFCHS-----KSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQ-NEKIGHFSQVVWKDTKAAGFGRAKSTNGNFI---IVGQYKPAGNFIGKFKENIPSPIGAP 510
            AL      V    +  HN+LR     P    L ++WN  K A   A+K A   ++ HS      +  K GENL  S  S      S   A Q+W+DE  D+ F    +  N  +GH++QVVW  +   G G A   N   +    V QY PAGN+  +    +P   GAP
Sbjct:   43 ALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWN--KEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASS-----SWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLY--VPYEQGAP 203          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Celegans
Match: F57B7.2 (pep chromosome:WBcel235:V:11441925:11443484:-1 gene:WBGene00010192.1 transcript:F57B7.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57B7.2)

HSP 1 Score: 71.2478 bits (173), Expect = 4.001e-14
Identity = 50/145 (34.48%), Postives = 73/145 (50.34%), Query Frame = 1
Query:   70 SALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFI-IVGQYKPAG--NFIGKFKENIPS 495
            S L  HN+ R  +   NL     LA+ A  +A KLA      + +  G  GENL     ++  ++ +G+   Q W  E + + F++  + N K   FSQVVWKDT   G  R  +T  N + +V  Y+PAG  N  G+F  N+PS
Sbjct:  116 SCLDAHNECRQRYGNENLCWSTELAEMAHAWAVKLADRGRVLYPELPG-IGENLILKEANEQSHLPTGQEVIQEWEKEAQFFDFDK-PRWNPKCQRFSQVVWKDTTELGAARYWNTANNCVAVVCFYRPAGNSNAPGEFASNVPS 258          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Celegans
Match: F57B7.2 (pep chromosome:WBcel235:V:11441925:11443603:-1 gene:WBGene00010192.1 transcript:F57B7.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57B7.2)

HSP 1 Score: 70.4774 bits (171), Expect = 1.097e-13
Identity = 50/145 (34.48%), Postives = 73/145 (50.34%), Query Frame = 1
Query:   70 SALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFI-IVGQYKPAG--NFIGKFKENIPS 495
            S L  HN+ R  +   NL     LA+ A  +A KLA      + +  G  GENL     ++  ++ +G+   Q W  E + + F++  + N K   FSQVVWKDT   G  R  +T  N + +V  Y+PAG  N  G+F  N+PS
Sbjct:  157 SCLDAHNECRQRYGNENLCWSTELAEMAHAWAVKLADRGRVLYPELPG-IGENLILKEANEQSHLPTGQEVIQEWEKEAQFFDFDK-PRWNPKCQRFSQVVWKDTTELGAARYWNTANNCVAVVCFYRPAGNSNAPGEFASNVPS 299          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Celegans
Match: C07A4.3 (pep chromosome:WBcel235:X:10174985:10175896:1 gene:WBGene00007398.1 transcript:C07A4.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C07A4.3)

HSP 1 Score: 67.3958 bits (163), Expect = 3.420e-13
Identity = 48/148 (32.43%), Postives = 76/148 (51.35%), Query Frame = 1
Query:   85 HNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSK-PGYVFSGEAATQNWYDEIKDYKFNQETQQN----EKIGHFSQVVWKDTKAAGFGRAKSTNG---NFIIVGQYKPAGNFIGK--FKENIPSP 498
            HNK RA H  P +T+D NL   AQ++++++A        +   KYGENL S  +SK P       A    +Y E   Y FN  T+ N     K+GHF+Q++WK+++  G G + +  G   +  +  +Y P GN      + +N+ +P
Sbjct:   52 HNKYRAHHSSPAVTVDSNLTNLAQKWSDEMAFHKKCLVHEQPSKYGENLTSFASSKFPSPKTCAAALIHGFYTE--GYGFNY-TRFNPGSWSKVGHFTQLLWKNSRKIGVGVSVAKRGTMYHVYVCIKYDPPGNMQTSEAYMDNVRAP 196          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Celegans
Match: F09B9.5 (pep chromosome:WBcel235:X:10154821:10156856:1 gene:WBGene00008604.1 transcript:F09B9.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F09B9.5)

HSP 1 Score: 65.0846 bits (157), Expect = 1.561e-12
Identity = 54/190 (28.42%), Postives = 80/190 (42.11%), Query Frame = 1
Query:   34 MALNNDHNDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRA--------------------------KSTNGNF------IIVGQYKPAG--NFIGKFKENIPSPI 501
            M +  D  +     L  HN  R +H  PNL     L++ AQ++A+KLAK      S+  G  GEN+  +F          E+  ++WY E + Y++     Q     +F+QV+W+ TK  G G A                           S+NG        +IV  Y+PAG  N  G+F  N+  PI
Sbjct:    1 MTIPEDEKEFVDQMLLEHNTRRKMHSAPNLECSEELSEMAQQWADKLAKQAHISFSELSG-IGENI--TFFPPD---IDAESVVEHWYQEHEKYEYETPGWQT-GTNYFTQVIWRSTKEIGVGCAYVRKSHENDEDNTSCSNGSVCKSMTSLSSNGKLAAEGDKVIVAFYRPAGNNNRSGQFASNVLKPI 183          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Celegans
Match: scl-1 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20608])

HSP 1 Score: 54.6842 bits (130), Expect = 9.609e-9
Identity = 53/169 (31.36%), Postives = 73/169 (43.20%), Query Frame = 1
Query:   70 SALKHHNKLRAL----------------HRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKP-GYVFS-GEAATQNWYDEIKDYKFNQETQQ----NEKIGHFSQVVWKDTKAAGFG------RAKSTNGNFI-IVGQYKPAGNFIGK--FKE 483
            S +  HNKLR+                   +  + +D  +A +AQ YA          HSK  G YGENL  S+ S   G + S GE A   W  E +D+ +          N  IGH +Q+ W +T + G G       A   N N I +V QY P GN +G+  +KE
Sbjct:   23 SIVDAHNKLRSAIAKSTYVAKGTKKEPATDMRKMVVDSTVAASAQNYANTCPTG----HSKGTG-YGENLYWSWTSADVGSLDSYGEIAAAAWEKEFQDFGWKSNAMDTTLFNSGIGHATQMAWANTSSIGCGVKNCGRDASMRNMNKIAVVCQYSPPGNTMGRPIYKE 186          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Fly
Match: CG31482 (gene:FBgn0051482 transcript:FBtr0081679)

HSP 1 Score: 102.449 bits (254), Expect = 3.014e-26
Identity = 59/149 (39.60%), Postives = 79/149 (53.02%), Query Frame = 1
Query:   58 DVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGK-YGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGKFKENIPSPI 501
            D+    L  HN+LR  H  P LT+D  L K  +EYA+ LA      HS S G+ YGENL     +            Q+WYDEI DY F ++ Q     GHF+ +VWK+ K  G G+AK   G + +V +Y P  N  G+F+EN+  PI
Sbjct:   21 DLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQNYGENLCMRSQTPL-------QCVQDWYDEIADYDF-EKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNVNGQFEENVLPPI 161          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Fly
Match: CG4270 (gene:FBgn0031407 transcript:FBtr0077754)

HSP 1 Score: 92.4337 bits (228), Expect = 1.114e-22
Identity = 51/135 (37.78%), Postives = 74/135 (54.81%), Query Frame = 1
Query:   88 NKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGKFKENIP 492
            NK RA+H  P +TI+  L K AQE+A  L   N+  H +   KYGEN+  S     G   +G+   + WY EI  Y FN+  Q     GHF+Q++WK +   G G A+  +  +++   Y P GN +G FK+N+P
Sbjct:   40 NKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAH-RPNPKYGENIFLSG----GMDVTGDLPVEMWYREINSYDFNK-AQFVPTAGHFTQLIWKSSVEMGSGVARKADRTWVVC-NYNPPGNVVGLFKDNVP 167          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Fly
Match: CG4270 (gene:FBgn0031407 transcript:FBtr0077755)

HSP 1 Score: 72.0182 bits (175), Expect = 2.232e-15
Identity = 42/108 (38.89%), Postives = 58/108 (53.70%), Query Frame = 1
Query:   88 NKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAK 411
            NK RA+H  P +TI+  L K AQE+A  L   N+  H +   KYGEN+  S     G   +G+   + WY EI  Y FN+  Q     GHF+Q++WK +   G G A+
Sbjct:   40 NKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAH-RPNPKYGENIFLS----GGMDVTGDLPVEMWYREINSYDFNK-AQFVPTAGHFTQLIWKSSVEMGSGVAR 141          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Fly
Match: CG16995 (gene:FBgn0031412 transcript:FBtr0077758)

HSP 1 Score: 71.633 bits (174), Expect = 3.463e-15
Identity = 51/145 (35.17%), Postives = 73/145 (50.34%), Query Frame = 1
Query:   73 ALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGEN--LASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGKFKENIPSPI 501
             L+ HN  RA H    LT+   L + A E+A  L   N   H ++ G YGEN  +AS  N K      G  A ++WY+EI+ Y +N  + Q    GHF+QVVWK +   G G AKS +  +++     P       F+EN+  P+
Sbjct:   10 VLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSG-YGENIYMASGGNLK------GADAVRSWYEEIRQYNWNSPSFQG-NTGHFTQVVWKSSTELGVGFAKSGSTIYVVCNYNPPGNY-NNLFRENVAPPM 145          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Fly
Match: CG34049 (gene:FBgn0054049 transcript:FBtr0302372)

HSP 1 Score: 72.4034 bits (176), Expect = 2.085e-14
Identity = 46/140 (32.86%), Postives = 70/140 (50.00%), Query Frame = 1
Query:   70 SALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGKFKENI 489
            + L+  NK R LH    L +D  L   AQE+A+ LA  N    ++    YGEN+     SK    FS +   + WY E  +Y +  +   N   GHF+Q+VW++++  G G A   +  +I+   Y P GN    F+EN+
Sbjct:  148 AVLRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKL-ETRPNPLYGENIMRVRRSK----FSVDQILKLWYQEKYNYDY-LKPGFNLYTGHFTQLVWRESEFLGVGVACDVSSIWIVCN-YHPPGNVSEHFRENV 280          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Zebrafish
Match: CR855258.3 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33042518:33044681:-1 gene:ENSDARG00000113775.1 transcript:ENSDART00000180085.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855258.3)

HSP 1 Score: 102.834 bits (255), Expect = 1.218e-26
Identity = 71/161 (44.10%), Postives = 98/161 (60.87%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFI-IVGQYKPAGNF--IGKFKENIPSPIGAPPKLTEEKKSAASD 549
            L+ HN  R  H  P LT + NL ++AQ++AE L  T +  HS     YGENL  +++S    + +G  A  +WY EIKDY F++    + K GHF+QVVWKDTK  G G A  T+GN I +VGQY PAGN    G F++N+  P G+  KL ++K + AS+
Sbjct:   10 LQVHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAHSNK--GYGENLYYAWSSANKKL-TGHEAVDSWYGEIKDYNFSRP-GFSSKTGHFTQVVWKDTKELGVGLA--TDGNTIFVVGQYLPAGNIANAGYFEKNVL-PTGS--KL-DQKSTGASE 160          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Zebrafish
Match: AL929549.2 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_26:33034715:33037880:-1 gene:ENSDARG00000113959.1 transcript:ENSDART00000189171.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL929549.2)

HSP 1 Score: 102.449 bits (254), Expect = 1.968e-26
Identity = 71/161 (44.10%), Postives = 98/161 (60.87%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFI-IVGQYKPAGNF--IGKFKENIPSPIGAPPKLTEEKKSAASD 549
            L+ HN  R  H  P LT + NL ++AQ++AE L  T +  HS     YGENL  +++S    + +G  A  +WY EIKDY F++    + K GHF+QVVWKDTK  G G A  T+GN I +VGQY PAGN    G F++N+  P G+  KL ++K + AS+
Sbjct:    7 LQVHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAHSNK--GYGENLYYAWSSANKKL-TGNEAVDSWYGEIKDYNFSRP-GFSSKTGHFTQVVWKDTKELGVGLA--TDGNTIFVVGQYLPAGNIANAGYFEKNVL-PTGS--KL-DQKPTGASE 157          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Zebrafish
Match: CR855258.3 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33042518:33047654:-1 gene:ENSDARG00000113775.1 transcript:ENSDART00000179830.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855258.3)

HSP 1 Score: 102.064 bits (253), Expect = 2.173e-26
Identity = 70/158 (44.30%), Postives = 96/158 (60.76%), Query Frame = 1
Query:   85 HNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFI-IVGQYKPAGNF--IGKFKENIPSPIGAPPKLTEEKKSAASD 549
            HN  R  H  P LT + NL ++AQ++AE L  T +  HS     YGENL  +++S    + +G  A  +WY EIKDY F++    + K GHF+QVVWKDTK  G G A  T+GN I +VGQY PAGN    G F++N+  P G+  KL ++K + AS+
Sbjct:    7 HNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAHSNK--GYGENLYYAWSSANKKL-TGHEAVDSWYGEIKDYNFSRP-GFSSKTGHFTQVVWKDTKELGVGLA--TDGNTIFVVGQYLPAGNIANAGYFEKNVL-PTGS--KL-DQKSTGASE 154          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Zebrafish
Match: CR855258.2 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33040981:33045706:-1 gene:ENSDARG00000111579.1 transcript:ENSDART00000192095.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855258.2)

HSP 1 Score: 101.293 bits (251), Expect = 8.457e-26
Identity = 58/140 (41.43%), Postives = 85/140 (60.71%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENI 489
            L+ HN  R  H  P LTI+ NL+++AQ++AE L    +  HS   G +GEN+  ++NS      +G  A ++WY+EIK+Y F++    + K GHF+QVVWKD+K  G G A   + +F +VGQY P GN    G F+ N+
Sbjct:    7 LQTHNAYRKHHGAPPLTININLSRSAQKWAEHLLSIRTLMHSN--GDHGENVYYAYNS-ANKKLTGREAVESWYNEIKEYNFSRP-GFSSKTGHFTQVVWKDSKELGVGLATDGSTSF-VVGQYLPGGNITNAGYFERNV 141          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Zebrafish
Match: im:7150988 (im:7150988 [Source:ZFIN;Acc:ZDB-GENE-050309-169])

HSP 1 Score: 98.2117 bits (243), Expect = 5.440e-25
Identity = 60/141 (42.55%), Postives = 85/141 (60.28%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFI-IVGQYKPAGNFI--GKFKENI 489
            L+ HN+ R  H+ P L    +L + AQ++AE +    S  HS++E   GEN+  SF+S      +G+ A  +WY EIKDY F +   Q  K GHF+QVVWK +K  G G A  T+GN + +VGQYKPAGN    G +++N+
Sbjct:   11 LQTHNQYRHQHQAPPLVYREDLCRAAQKWAEHMLSKKSLGHSETEN--GENVYYSFSSVKK-TPTGKEAVDSWYSEIKDYNFAKSGHQ-PKTGHFTQVVWKSSKELGVGLA--TDGNTVFVVGQYKPAGNITNAGYYEQNV 145          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Xenopus
Match: echdc1 (ethylmalonyl-CoA decarboxylase 1 [Source:Xenbase;Acc:XB-GENE-958554])

HSP 1 Score: 111.309 bits (277), Expect = 6.101e-30
Identity = 60/141 (42.55%), Postives = 82/141 (58.16%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGKFKENIPSP 498
            L+ HNK R  H VP + ++  L+K+AQ +A  L   N   HS   G  GENL  S++S+      G  A   WY+E+KDY +N+   +    GHF+QVVWKD+K  G G A    G F +VG+Y P GN IG+F+EN+  P
Sbjct:   12 LEAHNKYRKKHNVPPMRLNAELSKSAQTWANHLLSINKMQHS---GAGGENLYYSYSSR------GNVAVDAWYNEVKDYDYNKPGFK-AATGHFTQVVWKDSKELGVGVATDGKGTFYVVGRYSPPGNVIGQFQENVLRP 142          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Xenopus
Match: trappc3 (trafficking protein particle complex 3 [Source:Xenbase;Acc:XB-GENE-1003911])

HSP 1 Score: 98.9821 bits (245), Expect = 1.160e-22
Identity = 62/172 (36.05%), Postives = 89/172 (51.74%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENI-PS-----------PIGAPPKLTEEKKSAASD 549
            L  HN  R  H  P L +  +L ++AQ++A+ L    +  HS   G  GENL   ++S       G+     WYDEIK+Y F +   ++   GHF+QVVWKD+K  G G A   NG + +VGQY PAGN    G F++N+ P+           P G PP+   E +  +S+
Sbjct:   23 LAAHNTYRRKHGAPPLQLSRDLCRSAQQWADHLLSIRTLEHSG--GNTGENLYYKYSSV-ARELPGQEPVDAWYDEIKNYDFGRPGFRS-NTGHFTQVVWKDSKEVGVGVATDGNGLYFVVGQYNPAGNITNPGYFEKNVLPAGSSPGPDSYREPTGEPPRSFREPEKTSSN 190          

HSP 2 Score: 96.6709 bits (239), Expect = 5.785e-22
Identity = 59/148 (39.86%), Postives = 79/148 (53.38%), Query Frame = 1
Query:   73 ALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENIPSPIGAP 510
            AL  HNK R  H  P L +   L  ++Q++A+ L   N+  HS +    GENL   +NS      SG    + WY+EIKDY F +   Q+   GHF+QVVWKD++  G  +A    G  I V QY PAGN    G F++N+  P G P
Sbjct:  210 ALDAHNKYRRQHGAPQLQLSRELCDSSQKWADHLLSINALQHSNTAN--GENLWYKWNSSMRDA-SGAEVVETWYNEIKDYSFGRPGFQS-NTGHFTQVVWKDSREVGVAKAVDGKGMVIAVAQYSPAGNITNPGYFQKNV-LPKGTP 352          

HSP 3 Score: 80.8777 bits (198), Expect = 1.316e-16
Identity = 49/149 (32.89%), Postives = 78/149 (52.35%), Query Frame = 1
Query:   49 DHNDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENI 489
            D  +  +  LK +N  R+ H    L ++  +++ AQ +AE L    +  HS +   +GEN+ +  +  P    +G+    +WY E K+Y F++   Q +  GHF+Q+VWK +K  G G A S  G  I+V QY P+GN    G +  NI
Sbjct:  382 DSREFALEFLKANNVYRSRHGAKPLQLNSKISQEAQRWAEHLLNLKTLKHSDTS--HGENIWAK-SGGPSITVTGQEVADSWYKEEKNYNFSKPGYQAD-TGHFTQMVWKASKEVGVGLASSGKGMLIVVAQYNPSGNITNPGFYGRNI 526          

HSP 4 Score: 72.0182 bits (175), Expect = 1.589e-13
Identity = 44/140 (31.43%), Postives = 74/140 (52.86%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENI 489
            L  HN+ R LH    L +   L++ AQ++A+ L    +  +S +   +GENL   + +    + +G+   ++WY+E   Y F     Q+   G+F+Q++WK +   GFG +    G +I VG Y PAGN    G F++N+
Sbjct:  568 LSEHNQYRKLHGAGALQLSVALSQDAQKWADHLVGKRALQNSDTH--HGENLWYRWGTNTS-LPTGKEVAESWYNENAKYSFATPGFQSGS-GNFTQMIWKSSSQVGFGLSTDNKGMYIAVGFYDPAGNIANKGYFEDNV 703          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Xenopus
Match: trappc3 (trafficking protein particle complex 3 [Source:Xenbase;Acc:XB-GENE-1003911])

HSP 1 Score: 96.6709 bits (239), Expect = 7.347e-22
Identity = 59/148 (39.86%), Postives = 79/148 (53.38%), Query Frame = 1
Query:   73 ALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENIPSPIGAP 510
            AL  HNK R  H  P L +   L  ++Q++A+ L   N+  HS +    GENL   +NS      SG    + WY+EIKDY F +   Q+   GHF+QVVWKD++  G  +A    G  I V QY PAGN    G F++N+  P G P
Sbjct:  199 ALDAHNKYRRQHGAPQLQLSRELCDSSQKWADHLLSINALQHSNTAN--GENLWYKWNSSMRDA-SGAEVVETWYNEIKDYSFGRPGFQS-NTGHFTQVVWKDSREVGVAKAVDGKGMVIAVAQYSPAGNITNPGYFQKNV-LPKGTP 341          

HSP 2 Score: 92.8189 bits (229), Expect = 1.370e-20
Identity = 55/141 (39.01%), Postives = 78/141 (55.32%), Query Frame = 1
Query:   97 RALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENIPSPIGAPP 513
            R  H  P L +  +L ++AQ++A+ L    +  HS   G  GENL   ++S       G+     WYDEIK+Y F +   ++   GHF+QVVWKD+K  G G A   NG + +VGQY PAGN    G F++N+  P G+ P
Sbjct:    2 RRKHGAPPLQLSRDLCRSAQQWADHLLSIRTLEHSG--GNTGENLYYKYSSV-ARELPGQEPVDAWYDEIKNYDFGRPGFRS-NTGHFTQVVWKDSKEVGVGVATDGNGLYFVVGQYNPAGNITNPGYFEKNV-LPAGSSP 137          

HSP 3 Score: 80.8777 bits (198), Expect = 1.346e-16
Identity = 49/149 (32.89%), Postives = 78/149 (52.35%), Query Frame = 1
Query:   49 DHNDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENI 489
            D  +  +  LK +N  R+ H    L ++  +++ AQ +AE L    +  HS +   +GEN+ +  +  P    +G+    +WY E K+Y F++   Q +  GHF+Q+VWK +K  G G A S  G  I+V QY P+GN    G +  NI
Sbjct:  371 DSREFALEFLKANNVYRSRHGAKPLQLNSKISQEAQRWAEHLLNLKTLKHSDTS--HGENIWAK-SGGPSITVTGQEVADSWYKEEKNYNFSKPGYQAD-TGHFTQMVWKASKEVGVGLASSGKGMLIVVAQYNPSGNITNPGFYGRNI 515          

HSP 4 Score: 71.633 bits (174), Expect = 1.717e-13
Identity = 44/140 (31.43%), Postives = 74/140 (52.86%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENI 489
            L  HN+ R LH    L +   L++ AQ++A+ L    +  +S +   +GENL   + +    + +G+   ++WY+E   Y F     Q+   G+F+Q++WK +   GFG +    G +I VG Y PAGN    G F++N+
Sbjct:  557 LSEHNQYRKLHGAGALQLSVALSQDAQKWADHLVGKRALQNSDTH--HGENLWYRWGTNTS-LPTGKEVAESWYNENAKYSFATPGFQSGS-GNFTQMIWKSSSQVGFGLSTDNKGMYIAVGFYDPAGNIANKGYFEDNV 692          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Xenopus
Match: pi15 (peptidase inhibitor 15 [Source:NCBI gene;Acc:100489915])

HSP 1 Score: 50.8322 bits (120), Expect = 6.742e-7
Identity = 47/176 (26.70%), Postives = 73/176 (41.48%), Query Frame = 1
Query:   55 NDVNVSALKHHNKLRALHRVPN-----LTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEK---------IGHFSQVVWKDTKAAGFGRAKSTNGN---------FIIVGQYKPAGNFIGKFKENIPSPIGAPP 513
            ND+ ++ +++HN++R     P      +  D NLAK A+ +A     T  + H  S     + L  + + + G   S     + WYDE+KDY F    + N +           H++Q+VW  T   G       N N           +V  Y P GN+IG+    I  P  A P
Sbjct:   65 NDM-IAIVEYHNQVRGKVFPPAANMEYMVWDENLAKLAEAWAA----TCIWDHGPS--YLLKFLGQNLSVRTGRYKSILQLVKPWYDEVKDYAFPYPQECNPRCPLRCYGPMCTHYTQMVWATTNRIGCAIHTCHNMNVWGAVWRRAVYLVCNYSPKGNWIGEAPYTIGVPCSACP 233          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000021732.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:144837652:144848955:1 gene:ENSXETG00000011357.1 transcript:ENSXETT00000021732.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 8.963e-7
Identity = 38/123 (30.89%), Postives = 60/123 (48.78%), Query Frame = 1
Query:  121 LTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKY--GENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQ-NEKIGHFSQVVWKDTKAAGFGRAKSTNG--NFIIVGQYKPAGNFIGK 474
            L ++WN    A + AE  A+T +  H+ +   +  G+NL  +      Y  + EAA   W+DEIKD+ F +  +     IGH++Q  W +++  G    +  N    +  V  Y PAGN  GK
Sbjct:   42 LKMEWN--DEAAKKAEIWARTCNQFHNPASQHFSCGQNLFMA-----SYSTTWEAAVTAWFDEIKDFDFGKGPKTFGALIGHYTQGAWYNSRMVGCYEFECPNAEYRYYYVCHYCPAGNIEGK 157          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Mouse
Match: Glipr2 (GLI pathogenesis-related 2 [Source:MGI Symbol;Acc:MGI:1917770])

HSP 1 Score: 105.145 bits (261), Expect = 1.745e-27
Identity = 62/149 (41.61%), Postives = 85/149 (57.05%), Query Frame = 1
Query:   64 NVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHS--KSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENIPSP 498
            N   LK HN+ RA H VP L +   L + AQ+Y+E LA T    HS   S G+ GENLA +      Y  +G+     WY EIK Y F Q+       GHF+ +VWK+TK  G G+A +++G+  +V +Y PAGN +  G F+EN+P P
Sbjct:   10 NNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTRILKHSPESSRGQCGENLAWA-----SYDQTGKDVADRWYSEIKSYNF-QQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENVPPP 152          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Mouse
Match: Glipr2 (GLI pathogenesis-related 2 [Source:MGI Symbol;Acc:MGI:1917770])

HSP 1 Score: 69.3218 bits (168), Expect = 7.942e-15
Identity = 34/79 (43.04%), Postives = 49/79 (62.03%), Query Frame = 1
Query:  268 SGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENIPSP 498
            SG+     WY EIK Y F Q+       GHF+ +VWK+TK  G G+A +++G+  +V +Y PAGN +  G F+EN+P P
Sbjct:    4 SGKDVADRWYSEIKSYNF-QQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENVPPP 81          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Mouse
Match: Crisp1 (cysteine-rich secretory protein 1 [Source:MGI Symbol;Acc:MGI:102553])

HSP 1 Score: 61.6178 bits (148), Expect = 1.064e-10
Identity = 46/143 (32.17%), Postives = 68/143 (47.55%), Query Frame = 1
Query:   85 HNKLRALHRVPN----LTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGK-----YGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQ-NEKIGHFSQVVWKDT--KAAGFGRAKSTNGNFIIVGQYKPAGNFIGKF 477
            HN+LR +   P+    L ++WN    AQ  A++ A   +F HS  E +      GENL  S      Y+ S  +A Q WY+E KD  ++   +Q +  +GH++QVVW  T   A G          +  V  Y P GN+ G+ 
Sbjct:   46 HNQLRRMVS-PSGSDLLKMEWNY--DAQVNAQQWADKCTFSHSPIELRTTNLRCGENLFMS-----SYLASWSSAIQGWYNEYKDLTYDVGPKQPDSVVGHYTQVVWNSTFQVACGVAECPKNPLRYYYVCHYCPVGNYQGRL 180          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 59.3066 bits (142), Expect = 1.760e-9
Identity = 53/179 (29.61%), Postives = 80/179 (44.69%), Query Frame = 1
Query:   37 ALNNDHNDVNVSALKHHNKLRALHRVPN---LTIDWN--LAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEA-----ATQNWYDEIKDYKFNQET-QQNEKIGHFSQVVWKDTKAAGFGR--AKSTNGN-----FIIVGQYKPAGNFIGK--FKENIP---SPIG 504
            AL  D     V     HN+ RA    P    L + W+  LA  A+ YA+K      + H+K  G+ GENL         +  + E      A  NW++E + Y F+  T   N+  GH++QVVW  T+  G G    ++  G       ++V  Y+P GN  G+  ++E  P    P+G
Sbjct:   29 ALTEDEKQTMVDL---HNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCV----WGHNKERGRRGENL---------FAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLG 191          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 58.151 bits (139), Expect = 2.153e-9
Identity = 53/192 (27.60%), Postives = 86/192 (44.79%), Query Frame = 1
Query:   85 HNKLRALHRVPN---LTIDWN--LAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQET-QQNEKIGHFSQVVWKDTKAAGFGR--AKSTNGN-----FIIVGQYKPAGNFIGK--FKENIP---SPIG-------------------APPKLTEEKKSAASD 549
            HN+ RA    P    L + W+  LA  A+ YA+K      + H+K  G+ GENL +  +           A  NW++E + Y F+  T   N+  GH++QVVW  T+  G G    ++  G       ++V  Y+P GN  G+  ++E  P    P+G                   +PP++TE   + A++
Sbjct:   42 HNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCV----WGHNKERGRRGENLFAITDEG----MDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLCEPMRNPEKAQDSPPRVTEVPSTRATE 225          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. UniProt/SwissProt
Match: sp|Q9CYL5|GAPR1_MOUSE (Golgi-associated plant pathogenesis-related protein 1 OS=Mus musculus OX=10090 GN=Glipr2 PE=1 SV=3)

HSP 1 Score: 105.145 bits (261), Expect = 1.221e-26
Identity = 62/149 (41.61%), Postives = 85/149 (57.05%), Query Frame = 1
Query:   64 NVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHS--KSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENIPSP 498
            N   LK HN+ RA H VP L +   L + AQ+Y+E LA T    HS   S G+ GENLA +      Y  +G+     WY EIK Y F Q+       GHF+ +VWK+TK  G G+A +++G+  +V +Y PAGN +  G F+EN+P P
Sbjct:   10 NNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTRILKHSPESSRGQCGENLAWA-----SYDQTGKDVADRWYSEIKSYNF-QQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENVPPP 152          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. UniProt/SwissProt
Match: sp|Q9H4G4|GAPR1_HUMAN (Golgi-associated plant pathogenesis-related protein 1 OS=Homo sapiens OX=9606 GN=GLIPR2 PE=1 SV=3)

HSP 1 Score: 102.834 bits (255), Expect = 6.923e-26
Identity = 63/153 (41.18%), Postives = 88/153 (57.52%), Query Frame = 1
Query:   52 HNDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHS--KSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENIPSP 498
            HN+V    LK HN+ R  H VP L +  NL + AQ+Y+E LA T    HS   S G+ GENLA +      Y  +G+     WY EIK+Y F Q+       GHF+ +VWK+TK  G G+A +++G+  +V +Y PAGN +  G F+EN+  P
Sbjct:   10 HNEV----LKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWA-----SYDQTGKEVADRWYSEIKNYNF-QQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENVLPP 152          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. UniProt/SwissProt
Match: sp|P47032|PRY1_YEAST (Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRY1 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.916e-19
Identity = 54/141 (38.30%), Postives = 75/141 (53.19%), Query Frame = 1
Query:   76 LKHHNKLRALHR-VPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFG--RAKSTNGNFIIVGQYKPAGNFIGKFKENI 489
            L  HNK RALH+  P L+    LA  AQ+YA+    + +  HS   G YGENLA  ++        G AA   WY+EI +Y F+     +   GHF+QVVWK T   G G        G+++I   Y PAGN+ G++ +N+
Sbjct:  167 LAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSG--GPYGENLALGYD--------GPAAVDAWYNEISNYDFSNP-GFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVIC-SYDPAGNYEGEYADNV 295          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. UniProt/SwissProt
Match: sp|P11670|PRB1_TOBAC (Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum OX=4097 PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.934e-18
Identity = 49/133 (36.84%), Postives = 65/133 (48.87%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGK 474
            L  HN  R    V  +T D  LA  AQ YA +        HS   G YGENLA++F        +   A + W DE + Y +N  +      GH++QVVW+++   G  R +S NG F I   Y P GNFIG+
Sbjct:   31 LNPHNAARRQVGVGPMTWDNRLAAYAQNYANQRIGDCGMIHS--HGPYGENLAAAFPQ-----LNAAGAVKMWVDEKRFYDYNSNSCVGGVCGHYTQVVWRNSVRLGCARVRSNNGWFFITCNYDPPGNFIGQ 156          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. UniProt/SwissProt
Match: sp|Q04108|PR04_SOLLC (Pathogenesis-related leaf protein 4 OS=Solanum lycopersicum OX=4081 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.311e-18
Identity = 51/134 (38.06%), Postives = 69/134 (51.49%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKF-NQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGK 474
            L  HN  RA   V  ++ D NLA  AQ YA   A   +  HS +    GENLA     K G  F+G AA Q W  E  DY +   +    +  GH++QVVW+++   G GRA+  NG + I   Y P GN++G+
Sbjct:   32 LAVHNDARAQVGVGPMSWDANLASRAQNYANSRAGDCNLIHSGA----GENLA-----KGGGDFTGRAAVQLWVSERPDYNYATNQCVGGKMCGHYTQVVWRNSVRLGCGRARCNNGWWFISCNYDPVGNWVGE 156          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. TrEMBL
Match: A0A068W9F9 (Venom allergen val protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000745000 PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 2.986e-39
Identity = 83/171 (48.54%), Postives = 104/171 (60.82%), Query Frame = 1
Query:   34 MALNNDHNDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGN-FIIVGQYKPAGNFIGKFKENIPSPIGAPPKLTEEKKSAA 543
            M +N   N+  + A   HNKLRALH   +LT D  LAK AQ++AE L K N   HS +   YGEN+A      PG+ F+G  A+Q WY EIKDY F    Q   K GHF+Q+VW DTK AGFG AKS  G+  IIVGQYKP GN++G+FK  +P P     K+ +  + AA
Sbjct:    1 MGINEKLNEECIQA---HNKLRALHGCASLTYDAKLAKQAQKHAEYLLKQNKMEHSTNR-DYGENIALK-GGTPGFQFTGYDASQMWYSEIKDYDFKGGDQL--KCGHFTQLVWSDTKRAGFGVAKSAKGDKVIIVGQYKPPGNYMGEFKAKVPRPTSGKVKVPDVSELAA 164          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. TrEMBL
Match: B3GUV1 (Golgi-associated plant pathogenesis-related protein OS=Schistosoma japonicum OX=6182 GN=EWB00_004227 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.796e-38
Identity = 76/156 (48.72%), Postives = 101/156 (64.74%), Query Frame = 1
Query:   55 NDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFI-IVGQYKPAGNFIGKFKENIPSP-IGAPPK 516
            N +N  A++ HN+LRALH  P ++ D  LA  +Q++AE LA  N   HSK++G YGENLA    S  G   +G  AT+NWYDEI  + FN + Q     GHF+QV+WK T  AGFG AKS +G  + +VG+YKPAGN IG + +N+P P   APP+
Sbjct:    4 NKLNNEAIQAHNELRALHGCPKISYDSKLASDSQKWAEHLASINCLQHSKADG-YGENLAFQM-STAGASLNGREATRNWYDEISKHDFNGQNQPG--TGHFTQVIWKSTNKAGFGSAKSKDGMKVYVVGRYKPAGNVIGHYTDNVPRPKKNAPPR 155          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. TrEMBL
Match: Q86EZ0 (Clone ZZD128 mRNA sequence OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 6.624e-38
Identity = 76/156 (48.72%), Postives = 101/156 (64.74%), Query Frame = 1
Query:   55 NDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFI-IVGQYKPAGNFIGKFKENIPSP-IGAPPK 516
            N +N  A++ HN+LRALH  P ++ D  LA  +Q++AE LA  N   HSK++G YGENLA    S  G   +G  AT+NWYDEI  + FN + Q     GHF+QV+WK T  AGFG AKS +G  + +VG+YKPAGN IG + +N+P P   APP+
Sbjct:    4 NKLNNEAIQAHNELRALHGCPKISYDSKLASDSQKWAEHLASINCLQHSKADG-YGENLAFQM-STAGASLNGREATRNWYDEISKHDFNGQNQPG--TGHFTQVIWKSTNKAGFGSAKSKDGMKVYVVGRYKPAGNVIGHYTDNVPRPKKNAPPR 155          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. TrEMBL
Match: H2KNL7 (Golgi-associated plant pathogenesis-related protein 1 OS=Clonorchis sinensis OX=79923 GN=Glipr2 PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.104e-37
Identity = 75/159 (47.17%), Postives = 105/159 (66.04%), Query Frame = 1
Query:   61 VNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFI-IVGQYKPAGNFIGKFKENIPSPIGAPPKLTEEKK 534
            +N  A+  HN+LRA H  P LT+D  LA+ AQ++AE+LAKT    HS ++ ++GENLA   +S      SG+ ATQ WYDEI  +++ ++ Q     GHF+QV+WK T+ AGFGRA S++G  I +VG+Y P GN +GKF EN+P PI    KL  +K+
Sbjct:    5 LNDEAIAAHNQLRAAHGCPKLTLDPELARGAQKWAEELAKTKRLQHS-NDKRFGENLAYQQSSVKA-ALSGQQATQMWYDEIHVHQYVEQFQPQS--GHFTQVIWKGTQKAGFGRASSSDGKSIYVVGRYTPPGNMVGKFCENVPRPIRPVEKLPAKKR 159          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. TrEMBL
Match: A0A068Y9F8 (Venom allergen val protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000745000 PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.121e-37
Identity = 78/162 (48.15%), Postives = 99/162 (61.11%), Query Frame = 1
Query:   61 VNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGN-FIIVGQYKPAGNFIGKFKENIPSPIGAPPKLTEEKKSAA 543
            +N   ++ HNKLRALH    LT D  LAK AQ++AE L K N   HS +   YGEN+A      PG+ F+G  A+Q WY EI+ Y F    Q   K GHF+Q+VW DTK AGFG AKS  G+  IIVGQYKP GN++G+FK  +P P     K+ +  + AA
Sbjct:    7 LNEECIRAHNKLRALHGCAPLTYDAKLAKQAQKHAEYLLKQNKMEHSTNR-DYGENIALK-GGTPGFQFTGYDASQMWYSEIRAYDFKGGDQL--KCGHFTQLVWSDTKQAGFGVAKSAKGDKVIIVGQYKPPGNYMGEFKAKVPRPTSGKVKVPDVSELAA 164          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000037136.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:26526:29035:1 gene:ENSAMXG00000037785.1 transcript:ENSAMXT00000037136.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 1.901e-29
Identity = 68/160 (42.50%), Postives = 95/160 (59.38%), Query Frame = 1
Query:   40 LNNDHNDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFI-IVGQYKPAGNFI--GKFKENIPSPIGAP 510
            L  DH++     L+ HN  R  H  P LTI  +L+++A+++AE L    +  HS  E  YGENL  +F+S  G   +G  A  +WY+EIKDY F++    +   GHF+QVVWKDTK  G+G A  T+G  + +VGQY P GNF   G F++N+  P G P
Sbjct:   15 LVTDHSNFEEEFLQTHNTYRKKHGAPPLTISQDLSRSAKKWAEHLLSNKTLQHSNRE--YGENLYYAFSSG-GKSLTGREAVDSWYNEIKDYNFSRP-GFSSGTGHFTQVVWKDTKEVGYGVA--TDGKTVFVVGQYLPPGNFTNPGAFEKNV-LPAGTP 167          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000046499.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:22169:29035:1 gene:ENSAMXG00000037785.1 transcript:ENSAMXT00000046499.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 4.051e-28
Identity = 65/148 (43.92%), Postives = 90/148 (60.81%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFI-IVGQYKPAGNFI--GKFKENIPSPIGAP 510
            L+ HN  R  H  P LTI  +L+++A+++AE L    +  HS  E  YGENL  +F+S  G   +G  A  +WY+EIKDY F++    +   GHF+QVVWKDTK  G+G A  T+G  + +VGQY P GNF   G F++N+  P G P
Sbjct:   21 LQTHNTYRKKHGAPPLTISQDLSRSAKKWAEHLLSNKTLQHSNRE--YGENLYYAFSSG-GKSLTGREAVDSWYNEIKDYNFSRP-GFSSGTGHFTQVVWKDTKEVGYGVA--TDGKTVFVVGQYLPPGNFTNPGAFEKNV-LPAGTP 161          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000045529.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:33202:35631:1 gene:ENSAMXG00000033350.1 transcript:ENSAMXT00000045529.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 2.252e-27
Identity = 64/151 (42.38%), Postives = 89/151 (58.94%), Query Frame = 1
Query:   67 VSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFI-IVGQYKPAGNFI--GKFKENIPSPIGAP 510
            V  L+ HN  R  H  P LTI  +L ++A+ +A+ L    +  HS  E  YGENL  +F+S  G   +G  A  +WY+E+KDY F++    +   GHF+QVVWKDTK  G+G A  T+G  + +VGQY P GNF   G F++N+  P G P
Sbjct:    8 VEFLQTHNTYRNKHGAPPLTISQDLCRSAKSWADYLLSIKTLQHSNKE--YGENLYYAFSSG-GKSLTGHEAVDSWYNEVKDYNFSRP-GFSSATGHFTQVVWKDTKEVGYGVA--TDGKTVFVVGQYLPPGNFTNPGAFEKNV-LPAGTP 151          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000051775.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:28035:32028:1 gene:ENSAMXG00000030558.1 transcript:ENSAMXT00000051775.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.219 bits (256), Expect = 7.574e-27
Identity = 62/147 (42.18%), Postives = 89/147 (60.54%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFI-IVGQYKPAGNFI--GKFKENIPSPIGA 507
            L+ HN  R  H  P LTI  +L+++A+++AE L    +  HS  E  YGENL  +F+S  G   +G  A  +WY+E+KDY F++    +   GHF+QVVWKDTK  G+G A  T+G  + +VGQY P GNF   G F++N+ +  G 
Sbjct:   10 LQTHNTYRKKHGAPPLTISQDLSRSAKKWAEHLLSNKTLQHSNRE--YGENLYYAFSSG-GKSLTGREAVDSWYNEVKDYNFSRPGFSS-GTGHFTQVVWKDTKEVGYGVA--TDGKTVFVVGQYLPPGNFTNPGAFEKNVLTSNGV 150          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000056153.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:17472:20230:1 gene:ENSAMXG00000040666.1 transcript:ENSAMXT00000056153.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 2.925e-25
Identity = 63/148 (42.57%), Postives = 87/148 (58.78%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNG-NFIIVGQYKPAGNFI--GKFKENIPSPIGAP 510
            L+ HN  R  H    LTI   L ++AQ +AE L    +  HS S GK+GENL  +++S  G   +G  A  +WY+E+KDY +++    +   GHF+QVVWKDTK  G+G A  T+G    +VGQY P GNF   G F++N+  P G P
Sbjct:   20 LQSHNTYRNKHGAQPLTISRELCRSAQAWAEHLLSIKTLQHS-SGGKFGENLFYTWSSG-GKSLTGREAVDSWYNEVKDYNYSRP-GFSSGTGHFTQVVWKDTKELGYGVA--TDGKTVFVVGQYLPPGNFTNPGAFEKNV-LPAGTP 161          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002228.1 (pep scaffold:Pmarinus_7.0:GL477414:68597:85540:-1 gene:ENSPMAG00000002025.1 transcript:ENSPMAT00000002228.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 5.688e-14
Identity = 43/153 (28.10%), Postives = 74/153 (48.37%), Query Frame = 1
Query:   49 DHNDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGEN-LASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGN--FIGKFKENIPSP 498
            D  +  +  L  HN+LR +H    L     L + A+ +A +LA++ +   S     +G+N +A ++      + +G   T  WY +   Y +N    Q +  G+FSQ+VW+ +   G G A    G F+ V  Y PAGN  +   +++N+  P
Sbjct:  217 DQEEFCIDVLAEHNRLREIHGARPLRRSVALGRDARAWARELARSRAL-RSHPTVPHGQNTVAFAWVRYRMLITAGRKVTNCWYADRLAYDYNNPGFQ-QGTGNFSQLVWRSSLDLGVGLACDGRGMFVAVAFYSPAGNLPYAMSYRDNVLPP 367          

HSP 2 Score: 66.2402 bits (160), Expect = 9.925e-13
Identity = 40/130 (30.77%), Postives = 65/130 (50.00%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENL----ASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKP 453
            L+ HN  RA H    L     L + A+ +AE L +  +  HS +   +GENL      +    PG     +  T++WY E+K Y F+    +  K+G+  ++VW+ +++ G GRA S  G  ++V  Y P
Sbjct:   34 LRAHNAARARHGAAPLRACAALEREARAWAEHLLERRALKHSDTS--HGENLYYRPLGAREQAPG-----KEVTEHWYSEVKHYDFSSPGYK-PKVGYLDKLVWRASQSLGVGRAVSPQGCVVVVAVYDP 155          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002224.1 (pep scaffold:Pmarinus_7.0:GL477414:68570:72489:-1 gene:ENSPMAG00000002025.1 transcript:ENSPMAT00000002224.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 2.114e-13
Identity = 42/143 (29.37%), Postives = 66/143 (46.15%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGN--FIGKFKENIPSP 498
            L  HN+LR +H    L     L + A+ +A +LA++ +   S     +G+N      S P         T  WY +   Y +N    Q +  G+FSQ+VW+ +   G G A    G F+ V  Y PAGN  +   +++N+  P
Sbjct:    3 LAEHNRLREIHGARPLRRSVALGRDARAWARELARSRAL-RSHPTVPHGQNRCVRVGSIPR-----RKVTNCWYADRLAYDYNNPGFQ-QGTGNFSQLVWRSSLDLGVGLACDGRGMFVAVAFYSPAGNLPYAMSYRDNVLPP 138          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002231.1 (pep scaffold:Pmarinus_7.0:GL477414:68597:85459:-1 gene:ENSPMAG00000002025.1 transcript:ENSPMAT00000002231.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 2.117e-13
Identity = 43/152 (28.29%), Postives = 72/152 (47.37%), Query Frame = 1
Query:   49 DHNDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGN--FIGKFKENIPSP 498
            D  +  +  L  HN+LR +H    L     L + A+ +A +LA++ +   S     +G+N+ +      G +  G   T  WY +   Y +N    Q +  G+FSQ+VW+ +   G G A    G F+ V  Y PAGN  +   +++N+  P
Sbjct:  186 DQEEFCIDVLAEHNRLREIHGARPLRRSVALGRDARAWARELARSRAL-RSHPTVPHGQNVWAKHIGT-GELPKGRKVTNCWYADRLAYDYNNPGFQ-QGTGNFSQLVWRSSLDLGVGLACDGRGMFVAVAFYSPAGNLPYAMSYRDNVLPP 334          

HSP 2 Score: 65.855 bits (159), Expect = 1.258e-12
Identity = 41/136 (30.15%), Postives = 68/136 (50.00%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENL------ASSFNSKPG----YVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKP 453
            L+ HN  RA H    L     L + A+ +AE L +  +  HS +   +GENL      A    ++PG     +   +  T++WY E+K Y F+    +  K+G+  ++VW+ +++ G GRA S  G  ++V  Y P
Sbjct:    7 LRAHNAARARHGAAPLRACAALEREARAWAEHLLERRALKHSDT--SHGENLYYRPLGAREQGAEPGGTGLRLRGRKEVTEHWYSEVKHYDFSSPGYK-PKVGYLDKLVWRASQSLGVGRAVSPQGCVVVVAVYDP 139          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Sea Lamprey
Match: glipr2l (GLI pathogenesis-related 2, like [Source:ZFIN;Acc:ZDB-GENE-041010-53])

HSP 1 Score: 51.6026 bits (122), Expect = 5.513e-9
Identity = 30/85 (35.29%), Postives = 43/85 (50.59%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKS--EGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFN 324
            L  HN  R  H V  L++   + + AQ YAE LA+T    HS     G+ GENLA +   +P      +   + WY EI++Y F+
Sbjct:   14 LNAHNDYRKTHGVATLSLSSKMCREAQSYAESLARTRVLKHSSDTERGQCGENLAWASYDEP-----AKEVAERWYAEIQNYNFS 93          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 88.1965 bits (217), Expect = 7.080e-21
Identity = 54/141 (38.30%), Postives = 75/141 (53.19%), Query Frame = 1
Query:   76 LKHHNKLRALHR-VPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFG--RAKSTNGNFIIVGQYKPAGNFIGKFKENI 489
            L  HNK RALH+  P L+    LA  AQ+YA+    + +  HS   G YGENLA  ++        G AA   WY+EI +Y F+     +   GHF+QVVWK T   G G        G+++I   Y PAGN+ G++ +N+
Sbjct:  167 LAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSG--GPYGENLALGYD--------GPAAVDAWYNEISNYDFSNP-GFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVIC-SYDPAGNYEGEYADNV 295          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 88.1965 bits (217), Expect = 4.085e-20
Identity = 57/141 (40.43%), Postives = 73/141 (51.77%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWN--LAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFG-RAKSTNGNFIIVGQYKPAGNFIGKFKENI 489
            L  HNK RALH V    + W+  LA  AQ YA++   +    HS  +G YGENLA       GY  +G  A   WY EI  Y ++     +E  GHF+QVVWK T   G G +   T  N  IV  Y P GN++G+F E +
Sbjct:   30 LNEHNKFRALH-VDTAPLTWSDTLATYAQNYADQYDCSGVLTHS--DGPYGENLA------LGYTDTG--AVDAWYGEISKYNYSNP-GFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSYNPPGNYLGEFAEEV 158          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Yeast
Match: PRY2 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY1; may be involved in detoxification of hydrophobic compounds; PRY2 has a paralog, PRY1, that arose from the whole genome duplication [Source:SGD;Acc:S000001721])

HSP 1 Score: 85.5001 bits (210), Expect = 9.069e-20
Identity = 58/147 (39.46%), Postives = 77/147 (52.38%), Query Frame = 1
Query:   58 DVNVSALKHHNKLRALHR-VPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNF--IIVGQYKPAGNFIGKFKENI 489
            D + S +  HN  RALH+   +LT    LA  AQ YA+    + +  HS   G YGENLA       GY  +G  +   WY+EI  Y ++     +E  GHF+QVVWK T   G G  KS  G +   I+  YK AGN IG+F +N+
Sbjct:  191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSG--GPYGENLA------LGYGTTG--SVDAWYNEITSYDYSNP-GFSESAGHFTQVVWKGTSEVGCGL-KSCGGEWGDYIICSYKAAGNVIGEFADNV 325          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Nematostella
Match: EDO49309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH91])

HSP 1 Score: 112.079 bits (279), Expect = 2.074e-30
Identity = 66/141 (46.81%), Postives = 86/141 (60.99%), Query Frame = 1
Query:   73 ALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSE-GKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNF-IIVGQYKPAGNFIGKFKENI 489
            AL  HN  RA H V NL    +LA+ AQ +AEKLA+  +  HS  E G+ GENLA  F  K  Y  +GE AT  WY+E   Y FN+   Q+   GHF+QVVWK TK  G GRAK+ +G    +VG+Y+P+GN + +F  N+
Sbjct:   45 ALDAHNYFRAFHGVKNLKWSHDLARGAQAWAEKLARERTLKHSTRERGEDGENLA-MFTGK--YESAGEEATNMWYEESAYYNFNRPGYQS-NTGHFTQVVWKGTKELGLGRAKTPDGRLTFVVGRYRPSGNMLREFDNNV 181          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Nematostella
Match: EDO34555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP06])

HSP 1 Score: 108.997 bits (271), Expect = 8.806e-30
Identity = 59/139 (42.45%), Postives = 78/139 (56.12%), Query Frame = 1
Query:   73 ALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGKFKENI 489
              + HN  R  HR   L    +LA  A E+AE LA TN   HS  + + GENLA +     GY   G+ A + WYDE+KDY F +    N K GHF+Q+VW+ TK  G  +  S +G   +V +Y P GN +G+FKENI
Sbjct:    5 CFRQHNIYRHQHRACRLLWSADLASDAAEWAEHLASTNRLEHSPQK-ECGENLACA----GGYDLRGDKAAEMWYDEVKDYNF-ETLAYNAKCGHFTQLVWRGTKEIGVAKRVSADGTQFVVARYHPPGNVLGEFKENI 137          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Nematostella
Match: EDO49310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH92])

HSP 1 Score: 110.923 bits (276), Expect = 1.953e-28
Identity = 59/139 (42.45%), Postives = 82/139 (58.99%), Query Frame = 1
Query:   73 ALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGKFKENI 489
            +L  HN+ RA+H VP LT   ++A+ AQ++A KLAK     H KS    GEN+  S  S   +  +GEAA ++WY E++ Y F +   Q+   GHF+QVVWK ++  G  RAKS  G   +V +Y P GN +  F ENI
Sbjct:    8 SLDAHNRYRAMHNVPPLTWSNSIAREAQKWANKLAKEGKLIHDKSRSGQGENVFMS--SGANFDDAGEAACESWYQEVERYNFQRGGHQS-GTGHFTQVVWKSSEELGVARAKSKKGAVFVVARYSPGGNDLNAFNENI 143          

HSP 2 Score: 81.2629 bits (199), Expect = 1.120e-17
Identity = 52/147 (35.37%), Postives = 73/147 (49.66%), Query Frame = 1
Query:   58 DVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKY--GENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFI-IVGQYKPAGNFIGKFKENI 489
            D     L  HN  RA+H    L     LAK AQ +A KLA+     H+  E +Y  GEN+      +  + F    A Q WY+E + Y+++         GHF+Q+VW+ T+  G G AKS +G     V +Y P GN +  FKEN+
Sbjct:  212 DTRSRILDIHNNYRAMHNAAPLRWSAALAKDAQAWAGKLAREGRLEHASREDRYYKGENIC-----RMSHHFDIGDALQIWYNESESYQYDNPGFA-LTTGHFTQIVWRGTREVGVGFAKSPDGRLTYAVARYNPPGNNMRHFKENV 352          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Nematostella
Match: EDO48880 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM7])

HSP 1 Score: 104.76 bits (260), Expect = 4.023e-28
Identity = 62/139 (44.60%), Postives = 79/139 (56.83%), Query Frame = 1
Query:   73 ALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGKFKENI 489
             L  HN  RA H  P L     LA    ++A+ LA+ N+  HSK  G+YGENLA  F S  GY  SG   T+ WYDEI+ Y+FN     +   GHF+QVVW  ++  G  +A S NG    V +Y PAGN IG+F EN+
Sbjct:    9 CLDSHNAYRAQHGAPPLKWSAKLASDCDKWAKDLARRNTMQHSK--GEYGENLA--FAS--GYELSGGRTTEMWYDEIQKYRFNNPGF-SSGTGHFTQVVWVGSQEMGVAKAVSKNGAHYAVARYYPAGNVIGQFPENV 140          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Nematostella
Match: EDO35383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLP0])

HSP 1 Score: 102.834 bits (255), Expect = 2.789e-27
Identity = 56/141 (39.72%), Postives = 82/141 (58.16%), Query Frame = 1
Query:   73 ALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGK--YGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGKFKENI 489
             ++ HN+LRA H+ P +T    LAK AQ +A  +AK     HS  + +   GENL   F S PG + +G+   + WY E+  YKF +   Q+   GHF+QVVWK TK      A+  +G+  +VG+YKPAGN + +F +N+
Sbjct:    7 CIEVHNELRAQHQAPKVTWSDQLAKDAQAWANHIAKNGRLEHSSPDSRPDQGENL---FMSSPGEINAGDVVDE-WYSEVSKYKFGKPGWQS-GTGHFTQVVWKGTKEVAMASAEGPDGSVYVVGRYKPAGNVLTQFADNV 142          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Medaka
Match: ENSORLT00000020413.2 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101166141])

HSP 1 Score: 98.2117 bits (243), Expect = 4.556e-25
Identity = 60/141 (42.55%), Postives = 82/141 (58.16%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNF-IIVGQYKPAGNFI--GKFKENI 489
            L  HN  RALH  P LT +  L   AQ++A+   +T++  HS +E   GEN+     S P  V +G+ A   WY EIKDY F +   Q+   GHF+QVVWK++K  G G A  T+G    +VGQY+P GNF   G+F+ N+
Sbjct:   11 LNAHNAYRALHGAPPLTYNKELCDEAQKWADTCLRTHTLGHSDTE--EGENVFYKSGSPPVKV-TGKDAVDAWYSEIKDYNFKKPGSQS-GTGHFTQVVWKESKELGLGMA--TDGRMAFVVGQYRPPGNFTNPGQFEANV 145          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Medaka
Match: ENSORLT00000028427.1 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101166141])

HSP 1 Score: 98.2117 bits (243), Expect = 4.556e-25
Identity = 60/141 (42.55%), Postives = 82/141 (58.16%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNF-IIVGQYKPAGNFI--GKFKENI 489
            L  HN  RALH  P LT +  L   AQ++A+   +T++  HS +E   GEN+     S P  V +G+ A   WY EIKDY F +   Q+   GHF+QVVWK++K  G G A  T+G    +VGQY+P GNF   G+F+ N+
Sbjct:   11 LNAHNAYRALHGAPPLTYNKELCDEAQKWADTCLRTHTLGHSDTE--EGENVFYKSGSPPVKV-TGKDAVDAWYSEIKDYNFKKPGSQS-GTGHFTQVVWKESKELGLGMA--TDGRMAFVVGQYRPPGNFTNPGQFEANV 145          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Medaka
Match: ENSORLT00000043877.1 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101166141])

HSP 1 Score: 98.2117 bits (243), Expect = 5.784e-25
Identity = 60/141 (42.55%), Postives = 82/141 (58.16%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNF-IIVGQYKPAGNFI--GKFKENI 489
            L  HN  RALH  P LT +  L   AQ++A+   +T++  HS +E   GEN+     S P  V +G+ A   WY EIKDY F +   Q+   GHF+QVVWK++K  G G A  T+G    +VGQY+P GNF   G+F+ N+
Sbjct:   16 LNAHNAYRALHGAPPLTYNKELCDEAQKWADTCLRTHTLGHSDTE--EGENVFYKSGSPPVKV-TGKDAVDAWYSEIKDYNFKKPGSQS-GTGHFTQVVWKESKELGLGMA--TDGRMAFVVGQYRPPGNFTNPGQFEANV 150          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Medaka
Match: ENSORLT00000031186.1 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101165896])

HSP 1 Score: 92.0485 bits (227), Expect = 1.021e-22
Identity = 57/141 (40.43%), Postives = 82/141 (58.16%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNF-IIVGQYKPAGNFI--GKFKENI 489
            L+ HN  RALH  P LT +  +   AQ++A++  + ++  H  SE K GEN+     S P    +G+ A   WY EIKDY F +   ++   GHF+QVVWK++K  G G A  T+G    +VGQY+P GNF   G+F+ N+
Sbjct:   11 LETHNAYRALHGAPPLTYNSKMCGEAQKWADECLRIHTLGH--SETKDGENVFFKSGS-PSVSITGKDAVDAWYSEIKDYNFKKPGFKS-GTGHFTQVVWKESKELGLGMA--TDGRMAFVVGQYRPPGNFSNPGQFEANV 145          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Medaka
Match: glipr2l (GLI pathogenesis related 2 [Source:NCBI gene;Acc:101165836])

HSP 1 Score: 88.5817 bits (218), Expect = 2.478e-21
Identity = 52/142 (36.62%), Postives = 78/142 (54.93%), Query Frame = 1
Query:   76 LKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKS--EGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFI--GKFKENI 489
            L+ HN+ R  H+ P L +   L+  A  YAE LA      HS++   G  GENLA +      Y  +G+  T  WY+E+K Y F++        GHF+ +VWK+TK  G G+A +++G+  +V +Y PAGN    G F+ N+
Sbjct:   14 LRCHNEYRKKHQAPELKLSSKLSTEAARYAESLASIRILKHSEASARGSCGENLAWA-----SYDQTGKDVTDRWYEEVKQYNFSRPGFTT-GTGHFTAMVWKNTKKLGVGKAVASDGSSFVVARYFPAGNITNQGHFENNV 149          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Planmine SMEST
Match: SMESG000063559.1 (SMESG000063559.1)

HSP 1 Score: 431.024 bits (1107), Expect = 1.675e-154
Identity = 233/237 (98.31%), Postives = 235/237 (99.16%), Query Frame = 1
Query:   34 MALNNDHNDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGKFKENIPSPIGAPPKLTEEKKSAASDPIXXXXXXXXXXXXXXXXXXXXXXXGQKSKDDQLIKTTTKKSTINGKVSVETIQTFAKPDGKTYE 744
            MALNNDHNDVN SALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNF+GKFKENIPSPIGAPPKLTEEKKSAASDPIPKSTP KTS+PVSSKPVSVSKSAGQKSKDDQLIKTTTKKSTINGKVSVETIQTFAKPDGKTYE
Sbjct:    1 MALNNDHNDVNESALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFLGKFKENIPSPIGAPPKLTEEKKSAASDPIPKSTPVKTSRPVSSKPVSVSKSAGQKSKDDQLIKTTTKKSTINGKVSVETIQTFAKPDGKTYE 237          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Planmine SMEST
Match: SMESG000063568.1 (SMESG000063568.1)

HSP 1 Score: 279.256 bits (713), Expect = 2.183e-94
Identity = 145/253 (57.31%), Postives = 173/253 (68.38%), Query Frame = 1
Query:   34 MALNNDHNDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGKFKENIPSPIGAPPKLTE----------------EKKSAASDPIXXXXXXXXXXXXXXXXXXXXXXXGQKSKDDQLIKTTTKKSTINGKVSVETIQTFAKPDGKTYE 744
            MALN  H DVN S++  HNKLRALH  P LTIDW LAK+AQ YAEKLAKTN+F HS+S G+YGENLASS+NS+ GYVF+G AATQNWYDEIKDYKF +ETQ N KIGHFSQVVWK TK AGFGRA+S++GNF+IVGQYKP GN+IG +KEN+ S  G PPK  E                 KK+    P+            S    ++    G K KDDQ+IK++TK  T NGK  VE  +T+  P+G+TYE
Sbjct:    1 MALNKAHQDVNESSINMHNKLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATGPPPKREEPTFDVNQNKPDKAKSSPKKAFLCCPM-GKKSKSPKSSPSKSASNIKPVIGPKHKDDQMIKSSTKTVTTNGKKKVEVTETYQTPNGETYE 252          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Planmine SMEST
Match: SMESG000063568.1 (SMESG000063568.1)

HSP 1 Score: 265.774 bits (678), Expect = 5.250e-89
Identity = 138/244 (56.56%), Postives = 167/244 (68.44%), Query Frame = 1
Query:   61 VNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGKFKENIPSPIGAPPKLTE----------------EKKSAASDPIXXXXXXXXXXXXXXXXXXXXXXXGQKSKDDQLIKTTTKKSTINGKVSVETIQTFAKPDGKTYE 744
            +N  AL+ HN+LRALH  P LTIDW LAK+AQ YAEKLAKTN+F HS+S G+YGENLASS+NS+ GYVF+G AATQNWYDEIKDYKF +ETQ N KIGHFSQVVWK TK AGFGRA+S++GNF+IVGQYKP GN+IG +KEN+ S  G PPK  E                 KK+    P+            S    ++    G K KDDQ+IK++TK  T NGK  VE  +T+  P+G+TYE
Sbjct:   13 LNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATGPPPKREEPTFDVNQNKPDKAKSSPKKAFLCCPM-GKKSKSPKSSPSKSASNIKPVIGPKHKDDQMIKSSTKTVTTNGKKKVEVTETYQTPNGETYE 255          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Planmine SMEST
Match: SMESG000063568.1 (SMESG000063568.1)

HSP 1 Score: 265.388 bits (677), Expect = 7.354e-89
Identity = 138/251 (54.98%), Postives = 170/251 (67.73%), Query Frame = 1
Query:   40 LNNDHNDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGKFKENIPSPIGAPPKLTE----------------EKKSAASDPIXXXXXXXXXXXXXXXXXXXXXXXGQKSKDDQLIKTTTKKSTINGKVSVETIQTFAKPDGKTYE 744
            +  +  ++N  AL+ HN+LRALH  P LTIDW LAK+AQ YAEKLAKTN+F HS+S G+YGENLASS+NS+ GYVF+G AATQNWYDEIKDYKF +ETQ N KIGHFSQVVWK TK AGFGRA+S++GNF+IVGQYKP GN+IG +KEN+ S  G PPK  E                 KK+    P+            S    ++    G K KDDQ+IK++TK  T NGK  VE  +T+  P+G+TYE
Sbjct:    1 MGKELEELNNEALEKHNELRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATGPPPKREEPTFDVNQNKPDKAKSSPKKAFLCCPM-GKKSKSPKSSPSKSASNIKPVIGPKHKDDQMIKSSTKTVTTNGKKKVEVTETYQTPNGETYE 250          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Planmine SMEST
Match: SMESG000070848.1 (SMESG000070848.1)

HSP 1 Score: 133.65 bits (335), Expect = 6.208e-38
Identity = 86/230 (37.39%), Postives = 119/230 (51.74%), Query Frame = 1
Query:   64 NVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGKFKENI----PSPIGAPPKLTEEKKSAASDPIXXXXXXXXXXXXXXXXXXXXXXXGQKSKDD---QLIKTTTKKSTINGKVSVETIQTFAKPDG 732
            N   L+ HN+LR LH  P++TI+  L   AQ++A  +A+T    HSKS+GKYGEN+ASS  SK     +G+  T  WY EI DY FN E Q   K GHFSQVVWK +   GFG  KSTNG +    +Y P GN +GK+ E++     + I  P  +   K S    P                         QKS+++   +L+  + K + +NG  + E ++TF   DG
Sbjct:    8 NTEGLETHNELRRLHNAPDMTINDLLMSDAQDWARHMAETMKLEHSKSDGKYGENIASS--SKK---LNGQEVTLMWYREIFDYNFNDEKQNLAKTGHFSQVVWKSSLEIGFGLEKSTNGMWYYCSRYLPPGNCVGKYLEHVNNYGKNWIDHPLII---KISQHRHP---------------------SLGSQKSEENSEMKLVGISKKTTIVNGIETTELVETFVNEDG 208          
The following BLAST results are available for this feature:
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLIPR21.442e-2641.18GLI pathogenesis related 2 [Source:HGNC Symbol;Acc... [more]
GLIPR21.979e-1836.13GLI pathogenesis related 2 [Source:HGNC Symbol;Acc... [more]
CRISP21.075e-1031.76cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CRISP21.075e-1031.76cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CRISP35.376e-1032.35cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F57B7.24.001e-1434.48pep chromosome:WBcel235:V:11441925:11443484:-1 gen... [more]
F57B7.21.097e-1334.48pep chromosome:WBcel235:V:11441925:11443603:-1 gen... [more]
C07A4.33.420e-1332.43pep chromosome:WBcel235:X:10174985:10175896:1 gene... [more]
F09B9.51.561e-1228.42pep chromosome:WBcel235:X:10154821:10156856:1 gene... [more]
scl-19.609e-931.36SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG314823.014e-2639.60gene:FBgn0051482 transcript:FBtr0081679[more]
CG42701.114e-2237.78gene:FBgn0031407 transcript:FBtr0077754[more]
CG42702.232e-1538.89gene:FBgn0031407 transcript:FBtr0077755[more]
CG169953.463e-1535.17gene:FBgn0031412 transcript:FBtr0077758[more]
CG340492.085e-1432.86gene:FBgn0054049 transcript:FBtr0302372[more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR855258.31.218e-2644.10pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33042518:33... [more]
AL929549.21.968e-2644.10pep chromosome:GRCz11:CHR_ALT_CTG5_1_26:33034715:3... [more]
CR855258.32.173e-2644.30pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33042518:33... [more]
CR855258.28.457e-2641.43pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33040981:33... [more]
im:71509885.440e-2542.55im:7150988 [Source:ZFIN;Acc:ZDB-GENE-050309-169][more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
echdc16.101e-3042.55ethylmalonyl-CoA decarboxylase 1 [Source:Xenbase;A... [more]
trappc31.160e-2236.05trafficking protein particle complex 3 [Source:Xen... [more]
trappc37.347e-2239.86trafficking protein particle complex 3 [Source:Xen... [more]
pi156.742e-726.70peptidase inhibitor 15 [Source:NCBI gene;Acc:10048... [more]
ENSXETT00000021732.18.963e-730.89pep primary_assembly:Xenopus_tropicalis_v9.1:5:144... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glipr21.745e-2741.61GLI pathogenesis-related 2 [Source:MGI Symbol;Acc:... [more]
Glipr27.942e-1543.04GLI pathogenesis-related 2 [Source:MGI Symbol;Acc:... [more]
Crisp11.064e-1032.17cysteine-rich secretory protein 1 [Source:MGI Symb... [more]
Pi161.760e-929.61peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi162.153e-927.60peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CYL5|GAPR1_MOUSE1.221e-2641.61Golgi-associated plant pathogenesis-related protei... [more]
sp|Q9H4G4|GAPR1_HUMAN6.923e-2641.18Golgi-associated plant pathogenesis-related protei... [more]
sp|P47032|PRY1_YEAST4.916e-1938.30Protein PRY1 OS=Saccharomyces cerevisiae (strain A... [more]
sp|P11670|PRB1_TOBAC1.934e-1836.84Basic form of pathogenesis-related protein 1 OS=Ni... [more]
sp|Q04108|PR04_SOLLC2.311e-1838.06Pathogenesis-related leaf protein 4 OS=Solanum lyc... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068W9F92.986e-3948.54Venom allergen val protein OS=Echinococcus granulo... [more]
B3GUV13.796e-3848.72Golgi-associated plant pathogenesis-related protei... [more]
Q86EZ06.624e-3848.72Clone ZZD128 mRNA sequence OS=Schistosoma japonicu... [more]
H2KNL71.104e-3747.17Golgi-associated plant pathogenesis-related protei... [more]
A0A068Y9F82.121e-3748.15Venom allergen val protein OS=Echinococcus multilo... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000037136.11.901e-2942.50pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000046499.14.051e-2843.92pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000045529.12.252e-2742.38pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000051775.17.574e-2742.18pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000056153.12.925e-2542.57pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000002228.15.688e-1428.10pep scaffold:Pmarinus_7.0:GL477414:68597:85540:-1 ... [more]
ENSPMAT00000002224.12.114e-1329.37pep scaffold:Pmarinus_7.0:GL477414:68570:72489:-1 ... [more]
ENSPMAT00000002231.12.117e-1328.29pep scaffold:Pmarinus_7.0:GL477414:68597:85459:-1 ... [more]
glipr2l5.513e-935.29GLI pathogenesis-related 2, like [Source:ZFIN;Acc:... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRY17.080e-2138.30Sterol binding protein involved in the export of a... [more]
PRY34.085e-2040.43Cell wall-associated protein involved in export of... [more]
PRY29.069e-2039.46Sterol binding protein involved in the export of a... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493092.074e-3046.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345558.806e-3042.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493101.953e-2842.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488804.023e-2844.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353832.789e-2739.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020413.24.556e-2542.55Golgi-associated plant pathogenesis-related protei... [more]
ENSORLT00000028427.14.556e-2542.55Golgi-associated plant pathogenesis-related protei... [more]
ENSORLT00000043877.15.784e-2542.55Golgi-associated plant pathogenesis-related protei... [more]
ENSORLT00000031186.11.021e-2240.43Golgi-associated plant pathogenesis-related protei... [more]
glipr2l2.478e-2136.62GLI pathogenesis related 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063559.11.675e-15498.31SMESG000063559.1[more]
SMESG000063568.12.183e-9457.31SMESG000063568.1[more]
SMESG000063568.15.250e-8956.56SMESG000063568.1[more]
SMESG000063568.17.354e-8954.98SMESG000063568.1[more]
SMESG000070848.16.208e-3837.39SMESG000070848.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025368 ID=SMED30025368|Name=Golgi-associated plant pathogenesis-related protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=845bp
ATAAATAATAATTCACGCTAATTGTGCATTTAAATGGCTTTAAACAATGA
TCATAATGATGTAAATGTATCTGCTTTGAAGCATCATAATAAATTAAGAG
CTTTGCACCGCGTACCAAACCTGACCATAGATTGGAATCTGGCCAAAACT
GCCCAGGAATACGCAGAGAAACTGGCGAAGACTAACTCGTTTTGTCACTC
GAAAAGCGAAGGAAAATACGGGGAAAATCTTGCATCTTCATTCAATTCAA
AACCAGGCTACGTTTTCAGCGGAGAGGCCGCCACCCAGAATTGGTACGAT
GAAATCAAGGACTACAAATTCAACCAAGAGACCCAACAAAATGAAAAAAT
TGGTCATTTTAGCCAGGTAGTGTGGAAAGACACTAAAGCCGCAGGATTCG
GAAGGGCAAAATCAACTAATGGAAATTTCATTATCGTTGGACAGTACAAA
CCGGCTGGAAATTTTATAGGCAAATTTAAAGAAAACATTCCAAGTCCAAT
TGGAGCTCCACCAAAATTAACTGAGGAAAAGAAATCAGCAGCTTCTGATC
CCATTCCTAAGTCAACTCCAGCGAAGACTAGCAAACCAGTTTCTAGTAAG
CCCGTTTCAGTTTCAAAGTCTGCGGGTCAGAAATCGAAAGATGACCAGTT
GATTAAAACCACCACGAAGAAGTCGACAATCAACGGGAAAGTTTCTGTTG
AAACCATTCAAACCTTCGCGAAACCCGATGGAAAGACATATGAGGTGACC
ACAAAGACAAGTTGAGTTTCGAATTCAGTTTGACAGCCATATGAATATCC
TATGTAATAAAAATACAAATTTTACAAATTTTAAAAAAAAAGATC
back to top

protein sequence of SMED30025368-orf-1

>SMED30025368-orf-1 ID=SMED30025368-orf-1|Name=SMED30025368-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=244bp
MALNNDHNDVNVSALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKT
NSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQET
QQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFIGKFKE
NIPSPIGAPPKLTEEKKSAASDPIPKSTPAKTSKPVSSKPVSVSKSAGQK
SKDDQLIKTTTKKSTINGKVSVETIQTFAKPDGKTYEVTTKTS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000106ciliated epithelial cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR034113SCP_GAPR1-like
IPR002413V5_allergen-like
IPR001283CRISP-related
IPR014044CAP_domain
IPR018244Allrgn_V5/Tpx1_CS
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001283Cysteine-rich secretory protein-relatedPRINTSPR00837V5TPXLIKEcoord: 106..122
score: 42.72
coord: 133..146
score: 43.91
coord: 30..48
score: 32.58
coord: 83..96
score: 35.64
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 4..151
IPR014044CAP domainSMARTSM00198SCP_3coord: 9..146
e-value: 1.4E-33
score: 127.5
IPR014044CAP domainPFAMPF00188CAPcoord: 15..138
e-value: 6.8E-21
score: 75.4
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 4..156
e-value: 8.1E-42
score: 145.0
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 8..152
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 175..200
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 157..213
NoneNo IPR availablePANTHERPTHR10334:SF386GOLGI-ASSOCIATED PLANT PATHOGENESIS-RELATED PROTEIN 1coord: 4..151
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01009CRISP_1coord: 107..117
IPR034113Golgi-associated plant pathogenesis-related protein 1, SCP domainCDDcd05382CAP_GAPR1-likecoord: 9..144
e-value: 5.83525E-55
score: 170.859