V-type proton ATPase catalytic subunit A

Overview
NameV-type proton ATPase catalytic subunit A
Smed IDSMED30025367
Length (bp)2059
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of V-type proton ATPase catalytic subunit A (SMED30025367) t-SNE clustered cells

Violin plots show distribution of expression levels for V-type proton ATPase catalytic subunit A (SMED30025367) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of V-type proton ATPase catalytic subunit A (SMED30025367) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for V-type proton ATPase catalytic subunit A (SMED30025367) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025367

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025367SMESG000063434.1 Contig3189GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025367SMESG000028157.1 PL06011B1G03ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025367SMESG000028157.1 Contig3189GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30025367SMESG000028157.1 dd_Smed_v4_959_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025367SMESG000028157.1 dd_Smed_v4_959_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025367SMESG000028157.1 dd_Smed_v4_959_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30025367SMESG000028157.1 dd_Smed_v4_959_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30025367SMESG000028157.1 dd_Smed_v4_959_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025367SMESG000028157.1 Contig52662uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025367SMESG000028157.1 Contig52662newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Human
Match: ATP6V1A (ATPase H+ transporting V1 subunit A [Source:HGNC Symbol;Acc:HGNC:851])

HSP 1 Score: 994.186 bits (2569), Expect = 0.000e+0
Identity = 486/604 (80.46%), Postives = 547/604 (90.56%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            E  FGYVH VSGPVVTA +M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV+VGDPV++TGKPLSVELGPGIMG+IFDGIQRPL DI+S T+SIYIP+GVN+ AL R IKWDF P  N+ VG H++GGDI+GIV EN+L+KHKIM+ P+ +G V +IAP G Y   +VVL  EF  V+ K TMVQVWPVRQ RPV++KLPAN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EVDG  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGY+VSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPS+NWLIS+SKY RALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVGML NMI  YD +R AVETT+QSDNKITW++IRE MGD +YK+SSMKFKDP+KDG+ KI  DY +L E++ N FR+LED
Sbjct:   15 ESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWDFTPCKNLRVGSHITGGDIYGIVSENSLIKHKIMLPPRNRGTVTYIAPPGNYDTSDVVLELEFEGVKEKFTMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAFRSLED 617          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Human
Match: ATP6V1A (ATPase H+ transporting V1 subunit A [Source:HGNC Symbol;Acc:HGNC:851])

HSP 1 Score: 273.092 bits (697), Expect = 6.773e-87
Identity = 132/191 (69.11%), Postives = 159/191 (83.25%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTM 631
            E  FGYVH VSGPVVTA +M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV+VGDPV++TGKPLSVELGPGIMG+IFDGIQRPL DI+S T+SIYIP+GVN+ AL R IKWDF P  N+ VG H++GGDI+GIV EN+L+KHKIM+ P+ +G V +IAP G Y   +VVL  EF  V+ K TM
Sbjct:   15 ESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWDFTPCKNLRVGSHITGGDIYGIVSENSLIKHKIMLPPRNRGTVTYIAPPGNYDTSDVVLELEFEGVKEKFTM 205          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Human
Match: ATP6V1A (ATPase H+ transporting V1 subunit A [Source:HGNC Symbol;Acc:HGNC:851])

HSP 1 Score: 244.973 bits (624), Expect = 1.309e-76
Identity = 118/172 (68.60%), Postives = 144/172 (83.72%), Query Frame = 2
Query:  119 MSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTM 631
            M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV+VGDPV++TGKPLSVELGPGIMG+IFDGIQRPL DI+S T+SIYIP+GVN+ AL R IKWDF P  N+ VG H++GGDI+GIV EN+L+KHKIM+ P+ +G V +IAP G Y   +VVL  EF  V+ K TM
Sbjct:    1 MAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWDFTPCKNLRVGSHITGGDIYGIVSENSLIKHKIMLPPRNRGTVTYIAPPGNYDTSDVVLELEFEGVKEKFTM 172          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Human
Match: ATP5F1B (ATP synthase F1 subunit beta [Source:HGNC Symbol;Acc:HGNC:830])

HSP 1 Score: 115.931 bits (289), Expect = 1.608e-26
Identity = 99/364 (27.20%), Postives = 171/364 (46.98%), Query Frame = 2
Query:  695 LLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSL---SKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVN-ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDM-GYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDD--FYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYD----------KFCPFYKTVGMLKNMI-----HLYDQSRHAV----ETTSQSDN 1708
            L+TG +V+D L P  +GG   + G  G GKTV+   L      ++    ++ G GER  E +++  +     IE   +N +    + ALV    N P  AR     TG+T++EYFRD  G +V +  D+  R+ +A  E+S  L  +P+  GY   L   + +  ER            ++GS+T V A+  P  D +DP  + T   +     L + +A+   +P+++ L S S   R +D      +HY+    +     +ILQ+ + L +I+ ++G   L+E DK+T+  AR ++  FL Q    P+           K  P  +T+   + ++     HL +Q+ + V    E  +++D 
Sbjct:  183 LVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEM----IESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--------KKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTS---RIMDPNIVGSEHYD----VARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQ-RFLSQ----PFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADK 522          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Human
Match: ATP5F1B (ATP synthase F1 subunit beta [Source:HGNC Symbol;Acc:HGNC:830])

HSP 1 Score: 96.2857 bits (238), Expect = 8.162e-21
Identity = 69/236 (29.24%), Postives = 114/236 (48.31%), Query Frame = 2
Query:  695 LLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSL---SKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVN-ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDM-GYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSK 1387
            L+TG +V+D L P  +GG   + G  G GKTV+   L      ++    ++ G GER  E +++  +     IE   +N +    + ALV    N P  AR     TG+T++EYFRD  G +V +  D+  R+ +A  E+S  L  +P+  GY   L   + +  ER            ++GS+T V A+  P  D +DP  + T   +     L + +A+   +P+++ L S S+
Sbjct:  120 LVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEM----IESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--------KKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSR 343          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Celegans
Match: vha-13 (V-type proton ATPase catalytic subunit A [Source:UniProtKB/Swiss-Prot;Acc:Q9XW92])

HSP 1 Score: 955.281 bits (2468), Expect = 0.000e+0
Identity = 465/607 (76.61%), Postives = 538/607 (88.63%), Query Frame = 2
Query:   53 LKIEEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQ-PVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            +  E  +G+V+ VSGPVVTA  M+GSAMYELVRVG+ +LVGEIIRLEGD+AT+QVYE+TSGVT+GDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDIA +T+SIYIPKGV+  AL R  +WDF    ++ VG HV+GGDI G V EN L+KHKI++ P   G + ++AP G YTV++ +L  EF   + K +M+Q+WPVR PRPV++KL AN PLL GQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSD IIYVGCGERGNEMSEVL+DFPELT+EV+GV  SIMKRTALVANTSNMPVAAREASIYTGITL+EYFRDMG NV+MMADSTSRWAEALREISGRL EMPA+SGYPAYL ARLASFYERAGRV+C+G P ER+GSVTIVGAVSPPGGDF+DPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+S+Y RAL++FY+K+Y EFV+LRTK  EILQEEEDLSEIVQLVGK SLAESDK+TLEVA+++KDDFLQQNGY+ YD+FCPFYKTVGMLKNMI  YD +RHAVE T+QSDNKITWN+I+++MGD IY++S+MKFKDPV DG+ KI +DY++L E ++N FRNLED
Sbjct:    1 MAAESSYGFVYGVSGPVVTAEKMAGSAMYELVRVGHQELVGEIIRLEGDYATIQVYEETSGVTIGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDIADITQSIYIPKGVSTNALSREARWDFVVSKDLRVGGHVTGGDIIGTVDENLLIKHKILLPPSACGTITFVAPSGQYTVEDTLLELEFAGRKQKFSMLQIWPVRSPRPVTEKLAANNPLLCGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDAIIYVGCGERGNEMSEVLRDFPELTMEVEGVTTSIMKRTALVANTSNMPVAAREASIYTGITLAEYFRDMGLNVAMMADSTSRWAEALREISGRLGEMPADSGYPAYLAARLASFYERAGRVKCLGSP-EREGSVTIVGAVSPPGGDFADPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSEYMRALEEFYEKNYPEFVSLRTKCKEILQEEEDLSEIVQLVGKASLAESDKVTLEVAKIIKDDFLQQNGYTKYDRFCPFYKTVGMLKNMIGFYDLARHAVEATAQSDNKITWNVIKDSMGDLIYQLSAMKFKDPVADGEAKIRKDYEDLAEAMANAFRNLED 606          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Celegans
Match: vha-13 (V-type proton ATPase catalytic subunit A [Source:UniProtKB/Swiss-Prot;Acc:Q9XW92])

HSP 1 Score: 955.281 bits (2468), Expect = 0.000e+0
Identity = 465/607 (76.61%), Postives = 538/607 (88.63%), Query Frame = 2
Query:   53 LKIEEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQ-PVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            +  E  +G+V+ VSGPVVTA  M+GSAMYELVRVG+ +LVGEIIRLEGD+AT+QVYE+TSGVT+GDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDIA +T+SIYIPKGV+  AL R  +WDF    ++ VG HV+GGDI G V EN L+KHKI++ P   G + ++AP G YTV++ +L  EF   + K +M+Q+WPVR PRPV++KL AN PLL GQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSD IIYVGCGERGNEMSEVL+DFPELT+EV+GV  SIMKRTALVANTSNMPVAAREASIYTGITL+EYFRDMG NV+MMADSTSRWAEALREISGRL EMPA+SGYPAYL ARLASFYERAGRV+C+G P ER+GSVTIVGAVSPPGGDF+DPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+S+Y RAL++FY+K+Y EFV+LRTK  EILQEEEDLSEIVQLVGK SLAESDK+TLEVA+++KDDFLQQNGY+ YD+FCPFYKTVGMLKNMI  YD +RHAVE T+QSDNKITWN+I+++MGD IY++S+MKFKDPV DG+ KI +DY++L E ++N FRNLED
Sbjct:    1 MAAESSYGFVYGVSGPVVTAEKMAGSAMYELVRVGHQELVGEIIRLEGDYATIQVYEETSGVTIGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDIADITQSIYIPKGVSTNALSREARWDFVVSKDLRVGGHVTGGDIIGTVDENLLIKHKILLPPSACGTITFVAPSGQYTVEDTLLELEFAGRKQKFSMLQIWPVRSPRPVTEKLAANNPLLCGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDAIIYVGCGERGNEMSEVLRDFPELTMEVEGVTTSIMKRTALVANTSNMPVAAREASIYTGITLAEYFRDMGLNVAMMADSTSRWAEALREISGRLGEMPADSGYPAYLAARLASFYERAGRVKCLGSP-EREGSVTIVGAVSPPGGDFADPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSEYMRALEEFYEKNYPEFVSLRTKCKEILQEEEDLSEIVQLVGKASLAESDKVTLEVAKIIKDDFLQQNGYTKYDRFCPFYKTVGMLKNMIGFYDLARHAVEATAQSDNKITWNVIKDSMGDLIYQLSAMKFKDPVADGEAKIRKDYEDLAEAMANAFRNLED 606          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Celegans
Match: vha-13 (V-type proton ATPase catalytic subunit A [Source:UniProtKB/Swiss-Prot;Acc:Q9XW92])

HSP 1 Score: 955.281 bits (2468), Expect = 0.000e+0
Identity = 465/607 (76.61%), Postives = 538/607 (88.63%), Query Frame = 2
Query:   53 LKIEEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQ-PVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            +  E  +G+V+ VSGPVVTA  M+GSAMYELVRVG+ +LVGEIIRLEGD+AT+QVYE+TSGVT+GDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDIA +T+SIYIPKGV+  AL R  +WDF    ++ VG HV+GGDI G V EN L+KHKI++ P   G + ++AP G YTV++ +L  EF   + K +M+Q+WPVR PRPV++KL AN PLL GQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSD IIYVGCGERGNEMSEVL+DFPELT+EV+GV  SIMKRTALVANTSNMPVAAREASIYTGITL+EYFRDMG NV+MMADSTSRWAEALREISGRL EMPA+SGYPAYL ARLASFYERAGRV+C+G P ER+GSVTIVGAVSPPGGDF+DPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+S+Y RAL++FY+K+Y EFV+LRTK  EILQEEEDLSEIVQLVGK SLAESDK+TLEVA+++KDDFLQQNGY+ YD+FCPFYKTVGMLKNMI  YD +RHAVE T+QSDNKITWN+I+++MGD IY++S+MKFKDPV DG+ KI +DY++L E ++N FRNLED
Sbjct:    1 MAAESSYGFVYGVSGPVVTAEKMAGSAMYELVRVGHQELVGEIIRLEGDYATIQVYEETSGVTIGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDIADITQSIYIPKGVSTNALSREARWDFVVSKDLRVGGHVTGGDIIGTVDENLLIKHKILLPPSACGTITFVAPSGQYTVEDTLLELEFAGRKQKFSMLQIWPVRSPRPVTEKLAANNPLLCGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDAIIYVGCGERGNEMSEVLRDFPELTMEVEGVTTSIMKRTALVANTSNMPVAAREASIYTGITLAEYFRDMGLNVAMMADSTSRWAEALREISGRLGEMPADSGYPAYLAARLASFYERAGRVKCLGSP-EREGSVTIVGAVSPPGGDFADPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSEYMRALEEFYEKNYPEFVSLRTKCKEILQEEEDLSEIVQLVGKASLAESDKVTLEVAKIIKDDFLQQNGYTKYDRFCPFYKTVGMLKNMIGFYDLARHAVEATAQSDNKITWNVIKDSMGDLIYQLSAMKFKDPVADGEAKIRKDYEDLAEAMANAFRNLED 606          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Celegans
Match: vha-13 (V-type proton ATPase catalytic subunit A [Source:UniProtKB/Swiss-Prot;Acc:Q9XW92])

HSP 1 Score: 955.281 bits (2468), Expect = 0.000e+0
Identity = 465/607 (76.61%), Postives = 538/607 (88.63%), Query Frame = 2
Query:   53 LKIEEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQ-PVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            +  E  +G+V+ VSGPVVTA  M+GSAMYELVRVG+ +LVGEIIRLEGD+AT+QVYE+TSGVT+GDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDIA +T+SIYIPKGV+  AL R  +WDF    ++ VG HV+GGDI G V EN L+KHKI++ P   G + ++AP G YTV++ +L  EF   + K +M+Q+WPVR PRPV++KL AN PLL GQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSD IIYVGCGERGNEMSEVL+DFPELT+EV+GV  SIMKRTALVANTSNMPVAAREASIYTGITL+EYFRDMG NV+MMADSTSRWAEALREISGRL EMPA+SGYPAYL ARLASFYERAGRV+C+G P ER+GSVTIVGAVSPPGGDF+DPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+S+Y RAL++FY+K+Y EFV+LRTK  EILQEEEDLSEIVQLVGK SLAESDK+TLEVA+++KDDFLQQNGY+ YD+FCPFYKTVGMLKNMI  YD +RHAVE T+QSDNKITWN+I+++MGD IY++S+MKFKDPV DG+ KI +DY++L E ++N FRNLED
Sbjct:    1 MAAESSYGFVYGVSGPVVTAEKMAGSAMYELVRVGHQELVGEIIRLEGDYATIQVYEETSGVTIGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDIADITQSIYIPKGVSTNALSREARWDFVVSKDLRVGGHVTGGDIIGTVDENLLIKHKILLPPSACGTITFVAPSGQYTVEDTLLELEFAGRKQKFSMLQIWPVRSPRPVTEKLAANNPLLCGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDAIIYVGCGERGNEMSEVLRDFPELTMEVEGVTTSIMKRTALVANTSNMPVAAREASIYTGITLAEYFRDMGLNVAMMADSTSRWAEALREISGRLGEMPADSGYPAYLAARLASFYERAGRVKCLGSP-EREGSVTIVGAVSPPGGDFADPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSEYMRALEEFYEKNYPEFVSLRTKCKEILQEEEDLSEIVQLVGKASLAESDKVTLEVAKIIKDDFLQQNGYTKYDRFCPFYKTVGMLKNMIGFYDLARHAVEATAQSDNKITWNVIKDSMGDLIYQLSAMKFKDPVADGEAKIRKDYEDLAEAMANAFRNLED 606          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Celegans
Match: vha-13 (V-type proton ATPase catalytic subunit A [Source:UniProtKB/Swiss-Prot;Acc:Q9XW92])

HSP 1 Score: 955.281 bits (2468), Expect = 0.000e+0
Identity = 465/607 (76.61%), Postives = 538/607 (88.63%), Query Frame = 2
Query:   53 LKIEEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQ-PVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            +  E  +G+V+ VSGPVVTA  M+GSAMYELVRVG+ +LVGEIIRLEGD+AT+QVYE+TSGVT+GDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDIA +T+SIYIPKGV+  AL R  +WDF    ++ VG HV+GGDI G V EN L+KHKI++ P   G + ++AP G YTV++ +L  EF   + K +M+Q+WPVR PRPV++KL AN PLL GQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSD IIYVGCGERGNEMSEVL+DFPELT+EV+GV  SIMKRTALVANTSNMPVAAREASIYTGITL+EYFRDMG NV+MMADSTSRWAEALREISGRL EMPA+SGYPAYL ARLASFYERAGRV+C+G P ER+GSVTIVGAVSPPGGDF+DPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+S+Y RAL++FY+K+Y EFV+LRTK  EILQEEEDLSEIVQLVGK SLAESDK+TLEVA+++KDDFLQQNGY+ YD+FCPFYKTVGMLKNMI  YD +RHAVE T+QSDNKITWN+I+++MGD IY++S+MKFKDPV DG+ KI +DY++L E ++N FRNLED
Sbjct:    1 MAAESSYGFVYGVSGPVVTAEKMAGSAMYELVRVGHQELVGEIIRLEGDYATIQVYEETSGVTIGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDIADITQSIYIPKGVSTNALSREARWDFVVSKDLRVGGHVTGGDIIGTVDENLLIKHKILLPPSACGTITFVAPSGQYTVEDTLLELEFAGRKQKFSMLQIWPVRSPRPVTEKLAANNPLLCGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDAIIYVGCGERGNEMSEVLRDFPELTMEVEGVTTSIMKRTALVANTSNMPVAAREASIYTGITLAEYFRDMGLNVAMMADSTSRWAEALREISGRLGEMPADSGYPAYLAARLASFYERAGRVKCLGSP-EREGSVTIVGAVSPPGGDFADPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSEYMRALEEFYEKNYPEFVSLRTKCKEILQEEEDLSEIVQLVGKASLAESDKVTLEVAKIIKDDFLQQNGYTKYDRFCPFYKTVGMLKNMIGFYDLARHAVEATAQSDNKITWNVIKDSMGDLIYQLSAMKFKDPVADGEAKIRKDYEDLAEAMANAFRNLED 606          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Fly
Match: Vha68-2 (gene:FBgn0263598 transcript:FBtr0080420)

HSP 1 Score: 1009.59 bits (2609), Expect = 0.000e+0
Identity = 495/615 (80.49%), Postives = 560/615 (91.06%), Query Frame = 2
Query:   44 MKNLKIEED------FGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            M NLK  +D      +G V AVSGPVVTA  MSGSAMYELVRVGY +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LT+SIYIPKGVN+P+L R   W+F P+NV VG H++GGD++G+V ENTLVKHK++V+P+ KG V++IAP G Y VD+VVL TEF+   TKHTM+QVWPVRQPRPV++KLPAN+PLLTGQRVLD+LFPCVQGGTTAIPGAFGCGKTVISQ+LSKYSNSDVIIYVGCGERGNEMSEVL+DFPEL++E+DGV ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+SKY RALDDFYDK++ EFV LRTK  EILQEEEDLSEIVQLVGK SLAE+DKITLEVA+LLKDDFLQQN YS YD+FCPFYKTVGML+N+I  YD +RH+VE+T+QS+NKITWN+IREAMG+ +Y++SSMKFKDPVKDG+ KI  D+++L+E++   FRNLED
Sbjct:    1 MSNLKRFDDEERESKYGRVFAVSGPVVTAEAMSGSAMYELVRVGYYELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINELTESIYIPKGVNVPSLSRVASWEFNPLNVKVGSHITGGDLYGLVHENTLVKHKMIVNPRAKGTVRYIAPSGNYKVDDVVLETEFDGEITKHTMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQALSKYSNSDVIIYVGCGERGNEMSEVLRDFPELSVEIDGVTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNFPEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSSYDRFCPFYKTVGMLRNIIDFYDMARHSVESTAQSENKITWNVIREAMGNIMYQLSSMKFKDPVKDGEAKIKADFEQLHEDLQQAFRNLED 614          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Fly
Match: Vha68-2 (gene:FBgn0263598 transcript:FBtr0080418)

HSP 1 Score: 1009.59 bits (2609), Expect = 0.000e+0
Identity = 495/615 (80.49%), Postives = 560/615 (91.06%), Query Frame = 2
Query:   44 MKNLKIEED------FGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            M NLK  +D      +G V AVSGPVVTA  MSGSAMYELVRVGY +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LT+SIYIPKGVN+P+L R   W+F P+NV VG H++GGD++G+V ENTLVKHK++V+P+ KG V++IAP G Y VD+VVL TEF+   TKHTM+QVWPVRQPRPV++KLPAN+PLLTGQRVLD+LFPCVQGGTTAIPGAFGCGKTVISQ+LSKYSNSDVIIYVGCGERGNEMSEVL+DFPEL++E+DGV ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+SKY RALDDFYDK++ EFV LRTK  EILQEEEDLSEIVQLVGK SLAE+DKITLEVA+LLKDDFLQQN YS YD+FCPFYKTVGML+N+I  YD +RH+VE+T+QS+NKITWN+IREAMG+ +Y++SSMKFKDPVKDG+ KI  D+++L+E++   FRNLED
Sbjct:    1 MSNLKRFDDEERESKYGRVFAVSGPVVTAEAMSGSAMYELVRVGYYELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINELTESIYIPKGVNVPSLSRVASWEFNPLNVKVGSHITGGDLYGLVHENTLVKHKMIVNPRAKGTVRYIAPSGNYKVDDVVLETEFDGEITKHTMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQALSKYSNSDVIIYVGCGERGNEMSEVLRDFPELSVEIDGVTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNFPEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSSYDRFCPFYKTVGMLRNIIDFYDMARHSVESTAQSENKITWNVIREAMGNIMYQLSSMKFKDPVKDGEAKIKADFEQLHEDLQQAFRNLED 614          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Fly
Match: Vha68-2 (gene:FBgn0263598 transcript:FBtr0305551)

HSP 1 Score: 1009.59 bits (2609), Expect = 0.000e+0
Identity = 495/615 (80.49%), Postives = 560/615 (91.06%), Query Frame = 2
Query:   44 MKNLKIEED------FGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            M NLK  +D      +G V AVSGPVVTA  MSGSAMYELVRVGY +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LT+SIYIPKGVN+P+L R   W+F P+NV VG H++GGD++G+V ENTLVKHK++V+P+ KG V++IAP G Y VD+VVL TEF+   TKHTM+QVWPVRQPRPV++KLPAN+PLLTGQRVLD+LFPCVQGGTTAIPGAFGCGKTVISQ+LSKYSNSDVIIYVGCGERGNEMSEVL+DFPEL++E+DGV ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+SKY RALDDFYDK++ EFV LRTK  EILQEEEDLSEIVQLVGK SLAE+DKITLEVA+LLKDDFLQQN YS YD+FCPFYKTVGML+N+I  YD +RH+VE+T+QS+NKITWN+IREAMG+ +Y++SSMKFKDPVKDG+ KI  D+++L+E++   FRNLED
Sbjct:    1 MSNLKRFDDEERESKYGRVFAVSGPVVTAEAMSGSAMYELVRVGYYELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINELTESIYIPKGVNVPSLSRVASWEFNPLNVKVGSHITGGDLYGLVHENTLVKHKMIVNPRAKGTVRYIAPSGNYKVDDVVLETEFDGEITKHTMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQALSKYSNSDVIIYVGCGERGNEMSEVLRDFPELSVEIDGVTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNFPEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSSYDRFCPFYKTVGMLRNIIDFYDMARHSVESTAQSENKITWNVIREAMGNIMYQLSSMKFKDPVKDGEAKIKADFEQLHEDLQQAFRNLED 614          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Fly
Match: Vha68-2 (gene:FBgn0263598 transcript:FBtr0336614)

HSP 1 Score: 1009.59 bits (2609), Expect = 0.000e+0
Identity = 495/615 (80.49%), Postives = 560/615 (91.06%), Query Frame = 2
Query:   44 MKNLKIEED------FGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            M NLK  +D      +G V AVSGPVVTA  MSGSAMYELVRVGY +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LT+SIYIPKGVN+P+L R   W+F P+NV VG H++GGD++G+V ENTLVKHK++V+P+ KG V++IAP G Y VD+VVL TEF+   TKHTM+QVWPVRQPRPV++KLPAN+PLLTGQRVLD+LFPCVQGGTTAIPGAFGCGKTVISQ+LSKYSNSDVIIYVGCGERGNEMSEVL+DFPEL++E+DGV ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+SKY RALDDFYDK++ EFV LRTK  EILQEEEDLSEIVQLVGK SLAE+DKITLEVA+LLKDDFLQQN YS YD+FCPFYKTVGML+N+I  YD +RH+VE+T+QS+NKITWN+IREAMG+ +Y++SSMKFKDPVKDG+ KI  D+++L+E++   FRNLED
Sbjct:    1 MSNLKRFDDEERESKYGRVFAVSGPVVTAEAMSGSAMYELVRVGYYELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINELTESIYIPKGVNVPSLSRVASWEFNPLNVKVGSHITGGDLYGLVHENTLVKHKMIVNPRAKGTVRYIAPSGNYKVDDVVLETEFDGEITKHTMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQALSKYSNSDVIIYVGCGERGNEMSEVLRDFPELSVEIDGVTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNFPEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSSYDRFCPFYKTVGMLRNIIDFYDMARHSVESTAQSENKITWNVIREAMGNIMYQLSSMKFKDPVKDGEAKIKADFEQLHEDLQQAFRNLED 614          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Fly
Match: Vha68-2 (gene:FBgn0263598 transcript:FBtr0080419)

HSP 1 Score: 1009.59 bits (2609), Expect = 0.000e+0
Identity = 495/615 (80.49%), Postives = 560/615 (91.06%), Query Frame = 2
Query:   44 MKNLKIEED------FGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            M NLK  +D      +G V AVSGPVVTA  MSGSAMYELVRVGY +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LT+SIYIPKGVN+P+L R   W+F P+NV VG H++GGD++G+V ENTLVKHK++V+P+ KG V++IAP G Y VD+VVL TEF+   TKHTM+QVWPVRQPRPV++KLPAN+PLLTGQRVLD+LFPCVQGGTTAIPGAFGCGKTVISQ+LSKYSNSDVIIYVGCGERGNEMSEVL+DFPEL++E+DGV ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+SKY RALDDFYDK++ EFV LRTK  EILQEEEDLSEIVQLVGK SLAE+DKITLEVA+LLKDDFLQQN YS YD+FCPFYKTVGML+N+I  YD +RH+VE+T+QS+NKITWN+IREAMG+ +Y++SSMKFKDPVKDG+ KI  D+++L+E++   FRNLED
Sbjct:    1 MSNLKRFDDEERESKYGRVFAVSGPVVTAEAMSGSAMYELVRVGYYELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINELTESIYIPKGVNVPSLSRVASWEFNPLNVKVGSHITGGDLYGLVHENTLVKHKMIVNPRAKGTVRYIAPSGNYKVDDVVLETEFDGEITKHTMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQALSKYSNSDVIIYVGCGERGNEMSEVLRDFPELSVEIDGVTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNFPEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSSYDRFCPFYKTVGMLRNIIDFYDMARHSVESTAQSENKITWNVIREAMGNIMYQLSSMKFKDPVKDGEAKIKADFEQLHEDLQQAFRNLED 614          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Zebrafish
Match: atp6v1aa (ATPase H+ transporting V1 subunit Aa [Source:ZFIN;Acc:ZDB-GENE-040426-1143])

HSP 1 Score: 995.727 bits (2573), Expect = 0.000e+0
Identity = 487/604 (80.63%), Postives = 548/604 (90.73%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVN-VSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            E  FGYVH VSGPVVTAS+M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV VGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LT+SIYIP+GVN+ AL+R +KWDF P+N + VG HV+GGDI+G+V EN+L+KHK+M+ P+ +G V ++AP G Y V +VVL  EF  V+ K TMVQVWPVRQ RPV++KLPAN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EV G  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPS+NWLIS+SKYTRALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVG+L NMI  YD +RHAVETT+QSDNKITW  IRE MG+ +Y+ISSMKFKDPVK+G+ KI  DY +L E++ N FR LED
Sbjct:   15 ESQFGYVHGVSGPVVTASSMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVCVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINDLTQSIYIPRGVNIGALNRDLKWDFTPINNLRVGSHVTGGDIYGLVNENSLIKHKLMLPPRSRGTVTYVAPPGNYDVSDVVLELEFEGVKEKFTMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVGGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYTRALDEYYDKHFQEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGILSNMIAFYDLARHAVETTAQSDNKITWAQIREHMGEILYRISSMKFKDPVKEGEAKIKADYAQLLEDMQNSFRTLED 617          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Zebrafish
Match: atp6v1aa (ATPase H+ transporting V1 subunit Aa [Source:ZFIN;Acc:ZDB-GENE-040426-1143])

HSP 1 Score: 995.727 bits (2573), Expect = 0.000e+0
Identity = 487/604 (80.63%), Postives = 548/604 (90.73%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVN-VSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            E  FGYVH VSGPVVTAS+M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV VGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LT+SIYIP+GVN+ AL+R +KWDF P+N + VG HV+GGDI+G+V EN+L+KHK+M+ P+ +G V ++AP G Y V +VVL  EF  V+ K TMVQVWPVRQ RPV++KLPAN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EV G  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPS+NWLIS+SKYTRALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVG+L NMI  YD +RHAVETT+QSDNKITW  IRE MG+ +Y+ISSMKFKDPVK+G+ KI  DY +L E++ N FR LED
Sbjct:   15 ESQFGYVHGVSGPVVTASSMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVCVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINDLTQSIYIPRGVNIGALNRDLKWDFTPINNLRVGSHVTGGDIYGLVNENSLIKHKLMLPPRSRGTVTYVAPPGNYDVSDVVLELEFEGVKEKFTMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVGGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYTRALDEYYDKHFQEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGILSNMIAFYDLARHAVETTAQSDNKITWAQIREHMGEILYRISSMKFKDPVKEGEAKIKADYAQLLEDMQNSFRTLED 617          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Zebrafish
Match: atp6v1ab (ATPase H+ transporting V1 subunit Ab [Source:ZFIN;Acc:ZDB-GENE-030131-9529])

HSP 1 Score: 994.956 bits (2571), Expect = 0.000e+0
Identity = 488/604 (80.79%), Postives = 549/604 (90.89%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            E  FGYVH VSGPVVTAS+M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV+VGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LT+SIYIP+GVN+ AL+R +KW+F P  N+ VG H++GGDI+G V EN+L+KHKIM+ PK +G V ++AP G Y V +VVL  EF  V+ K TM+QVWPVRQ RPV++KLPAN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EV G  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPS+NWLIS+SKYTRALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVG+L NMI  YD +RHAVETT+QSDNKITW MIRE MG+ +Y+ISSMKFKDPVK+G+EKI  DY +L E++ N FR LED
Sbjct:   15 EGQFGYVHGVSGPVVTASSMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINDLTQSIYIPRGVNIGALNRDLKWEFTPSKNLRVGSHITGGDIYGNVFENSLIKHKIMLPPKSRGTVTYVAPPGNYDVSDVVLELEFEGVKEKFTMMQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVGGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYTRALDEYYDKHFPEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGVLSNMIAFYDMARHAVETTAQSDNKITWAMIREHMGEILYRISSMKFKDPVKEGEEKIKADYAQLLEDMQNAFRTLED 617          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Zebrafish
Match: atp6v1ab (ATPase H+ transporting V1 subunit Ab [Source:ZFIN;Acc:ZDB-GENE-030131-9529])

HSP 1 Score: 994.956 bits (2571), Expect = 0.000e+0
Identity = 488/604 (80.79%), Postives = 549/604 (90.89%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            E  FGYVH VSGPVVTAS+M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV+VGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LT+SIYIP+GVN+ AL+R +KW+F P  N+ VG H++GGDI+G V EN+L+KHKIM+ PK +G V ++AP G Y V +VVL  EF  V+ K TM+QVWPVRQ RPV++KLPAN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EV G  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPS+NWLIS+SKYTRALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVG+L NMI  YD +RHAVETT+QSDNKITW MIRE MG+ +Y+ISSMKFKDPVK+G+EKI  DY +L E++ N FR LED
Sbjct:   15 EGQFGYVHGVSGPVVTASSMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINDLTQSIYIPRGVNIGALNRDLKWEFTPSKNLRVGSHITGGDIYGNVFENSLIKHKIMLPPKSRGTVTYVAPPGNYDVSDVVLELEFEGVKEKFTMMQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVGGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYTRALDEYYDKHFPEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGVLSNMIAFYDMARHAVETTAQSDNKITWAMIREHMGEILYRISSMKFKDPVKEGEEKIKADYAQLLEDMQNAFRTLED 617          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Zebrafish
Match: atp5f1b (ATP synthase F1 subunit beta [Source:ZFIN;Acc:ZDB-GENE-030131-124])

HSP 1 Score: 115.546 bits (288), Expect = 1.313e-26
Identity = 94/337 (27.89%), Postives = 160/337 (47.48%), Query Frame = 2
Query:  695 LLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSL---SKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVN-ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDM-GYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDD--FYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYD----------KFCPFYKTVGMLKNMI 1654
            L+TG +V+D L P  +GG   + G  G GKTV+   L      ++    ++ G GER  E +++  +     IE   +N +    + ALV    N P  AR     TG+T++EYFRD  G +V +  D+  R+ +A  E+S  L  +P+  GY   L   + +  ER            ++GS+T V A+  P  D +DP  + T   +     L + +A+   +P+++ L S S   R +D      +HY+    +     +ILQ+ + L +I+ ++G   L+E DK+T+  AR ++  FL Q    P+           K  P  +T+   K+++
Sbjct:  172 LVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEM----IESGVINLKDTTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--------KKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTS---RIMDPNIVGTEHYD----VARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQ-RFLSQ----PFQVAEVFTGHLGKLVPLKETIKGFKSIL 484          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Xenopus
Match: gpc5 (glypican 5 [Source:Xenbase;Acc:XB-GENE-6031723])

HSP 1 Score: 949.503 bits (2453), Expect = 0.000e+0
Identity = 462/580 (79.66%), Postives = 527/580 (90.86%), Query Frame = 2
Query:   44 MKNLKIEEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFK 1780
            +++ + E  FGYVH VSGPVVTASNM+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV VGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI+  T+SIYIP+G+N+ AL + IKW+F P  ++ VG H++GGDI+G V EN+L++HKIM+ P+ +G V +IAP G Y   +VVL  EF  V+ K TMVQVWPVR  RPV++KLPAN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EVDG  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGY+VSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPS+NWLIS+SKYTRALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVGML NMI  YD +R AV+TT+QSDNKITW++IRE MG+ +Y+++SMKFK
Sbjct:    9 IRDEERESQFGYVHGVSGPVVTASNMAGAAMYELVRVGHCELVGEIIRLEGDMATIQVYEETSGVCVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDISDSTQSIYIPRGINVSALSKDIKWEFNPSKSIRVGSHITGGDIYGAVMENSLIRHKIMLPPRNRGTVTYIAPPGHYDTSDVVLELEFEGVKDKFTMVQVWPVRSIRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYTRALDEYYDKHFQEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLYNMIAFYDMARRAVDTTAQSDNKITWSIIREHMGEILYRLTSMKFK 587          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Xenopus
Match: gpc5 (glypican 5 [Source:Xenbase;Acc:XB-GENE-6031723])

HSP 1 Score: 872.463 bits (2253), Expect = 0.000e+0
Identity = 432/575 (75.13%), Postives = 493/575 (85.74%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQ-VFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFK 1780
            E  FGYVH VSGPVVTASNM+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV VGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI+  T+SIYIP+G+N+ AL + IKW+F P  ++ VG H++GGDI+G V EN+L++HKIM+ P+ +G V +IAP G Y   +VVL  EF  V+ K TMVQVWPVR  RPV++KLPAN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EVDG  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGY+VSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+                            ++ A   +VQ VFWGLDKKLAQRKHFPS+NWLIS+SKYTRALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVGML NMI  YD +R AV+TT+QSDNKITW++IRE MG+ +Y+++SMKFK
Sbjct:   15 ESQFGYVHGVSGPVVTASNMAGAAMYELVRVGHCELVGEIIRLEGDMATIQVYEETSGVCVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDISDSTQSIYIPRGINVSALSKDIKWEFNPSKSIRVGSHITGGDIYGAVMENSLIRHKIMLPPRNRGTVTYIAPPGHYDTSDVVLELEFEGVKDKFTMVQVWPVRSIRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVK----------------------------LSWAACSLVQDVFWGLDKKLAQRKHFPSVNWLISYSKYTRALDEYYDKHFQEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLYNMIAFYDMARRAVDTTAQSDNKITWSIIREHMGEILYRLTSMKFK 561          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Xenopus
Match: gpc5 (glypican 5 [Source:Xenbase;Acc:XB-GENE-6031723])

HSP 1 Score: 871.692 bits (2251), Expect = 0.000e+0
Identity = 432/575 (75.13%), Postives = 493/575 (85.74%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQ-VFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFK 1780
            E  FGYVH VSGPVVTASNM+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV VGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI+  T+SIYIP+G+N+ AL + IKW+F P  ++ VG H++GGDI+G V EN+L++HKIM+ P+ +G V +IAP G Y   +VVL  EF  V+ K TMVQVWPVR  RPV++KLPAN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EVDG  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGY+VSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+                            ++ A   +VQ VFWGLDKKLAQRKHFPS+NWLIS+SKYTRALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVGML NMI  YD +R AV+TT+QSDNKITW++IRE MG+ +Y+++SMKFK
Sbjct:   15 ESQFGYVHGVSGPVVTASNMAGAAMYELVRVGHCELVGEIIRLEGDMATIQVYEETSGVCVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDISDSTQSIYIPRGINVSALSKDIKWEFNPSKSIRVGSHITGGDIYGAVMENSLIRHKIMLPPRNRGTVTYIAPPGHYDTSDVVLELEFEGVKDKFTMVQVWPVRSIRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVK----------------------------LSWAACSLVQDVFWGLDKKLAQRKHFPSVNWLISYSKYTRALDEYYDKHFQEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLYNMIAFYDMARRAVDTTAQSDNKITWSIIREHMGEILYRLTSMKFK 561          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Xenopus
Match: gpc5 (glypican 5 [Source:Xenbase;Acc:XB-GENE-6031723])

HSP 1 Score: 871.692 bits (2251), Expect = 0.000e+0
Identity = 435/580 (75.00%), Postives = 496/580 (85.52%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQ-VFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKD 1795
            E  FGYVH VSGPVVTASNM+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV VGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI+  T+SIYIP+G+N+ AL + IKW+F P  ++ VG H++GGDI+G V EN+L++HKIM+ P+ +G V +IAP G Y   +VVL  EF  V+ K TMVQVWPVR  RPV++KLPAN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EVDG  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGY+VSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+                            ++ A   +VQ VFWGLDKKLAQRKHFPS+NWLIS+SKYTRALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVGML NMI  YD +R AV+TT+QSDNKITW++IRE MG+ +Y+++SMKFK  VKD
Sbjct:   15 ESQFGYVHGVSGPVVTASNMAGAAMYELVRVGHCELVGEIIRLEGDMATIQVYEETSGVCVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDISDSTQSIYIPRGINVSALSKDIKWEFNPSKSIRVGSHITGGDIYGAVMENSLIRHKIMLPPRNRGTVTYIAPPGHYDTSDVVLELEFEGVKDKFTMVQVWPVRSIRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVK----------------------------LSWAACSLVQDVFWGLDKKLAQRKHFPSVNWLISYSKYTRALDEYYDKHFQEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLYNMIAFYDMARRAVDTTAQSDNKITWSIIREHMGEILYRLTSMKFK--VKD 564          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Xenopus
Match: gpc5 (glypican 5 [Source:Xenbase;Acc:XB-GENE-6031723])

HSP 1 Score: 871.307 bits (2250), Expect = 0.000e+0
Identity = 432/575 (75.13%), Postives = 493/575 (85.74%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQ-VFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFK 1780
            E  FGYVH VSGPVVTASNM+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV VGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI+  T+SIYIP+G+N+ AL + IKW+F P  ++ VG H++GGDI+G V EN+L++HKIM+ P+ +G V +IAP G Y   +VVL  EF  V+ K TMVQVWPVR  RPV++KLPAN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EVDG  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGY+VSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+                            ++ A   +VQ VFWGLDKKLAQRKHFPS+NWLIS+SKYTRALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVGML NMI  YD +R AV+TT+QSDNKITW++IRE MG+ +Y+++SMKFK
Sbjct:   22 ESQFGYVHGVSGPVVTASNMAGAAMYELVRVGHCELVGEIIRLEGDMATIQVYEETSGVCVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDISDSTQSIYIPRGINVSALSKDIKWEFNPSKSIRVGSHITGGDIYGAVMENSLIRHKIMLPPRNRGTVTYIAPPGHYDTSDVVLELEFEGVKDKFTMVQVWPVRSIRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVK----------------------------LSWAACSLVQDVFWGLDKKLAQRKHFPSVNWLISYSKYTRALDEYYDKHFQEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLYNMIAFYDMARRAVDTTAQSDNKITWSIIREHMGEILYRLTSMKFK 568          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Mouse
Match: Atp6v1a (ATPase, H+ transporting, lysosomal V1 subunit A [Source:MGI Symbol;Acc:MGI:1201780])

HSP 1 Score: 989.178 bits (2556), Expect = 0.000e+0
Identity = 484/604 (80.13%), Postives = 547/604 (90.56%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            E  FGYVH VSGPVVTA +M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV+VGDPV++TGKPLSVELGPGIMG+IFDGIQRPL DI+S T+SIYIP+GVN+ AL R IKW+F P  N+ VG H++GGDI+GIV EN+L+KHKIM+ P+ +G V +IAP G Y   +VVL  EF  V+ K +MVQVWPVRQ RPV++KLPAN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EVDG  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGY+VSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPS+NWLIS+SKY RALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVGML NMI  YD +R AVETT+QSDNKITW++IRE MG+ +YK+SSMKFKDPVKDG+ KI  DY +L E++ N FR+LED
Sbjct:   15 ESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWEFIPSKNLRVGSHITGGDIYGIVNENSLIKHKIMLPPRNRGSVTYIAPPGNYDASDVVLELEFEGVKEKFSMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMISFYDMARRAVETTAQSDNKITWSIIREHMGEILYKLSSMKFKDPVKDGEAKIKADYAQLLEDMQNAFRSLED 617          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Mouse
Match: Atp6v1a (ATPase, H+ transporting, lysosomal V1 subunit A [Source:MGI Symbol;Acc:MGI:1201780])

HSP 1 Score: 989.178 bits (2556), Expect = 0.000e+0
Identity = 484/604 (80.13%), Postives = 547/604 (90.56%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            E  FGYVH VSGPVVTA +M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV+VGDPV++TGKPLSVELGPGIMG+IFDGIQRPL DI+S T+SIYIP+GVN+ AL R IKW+F P  N+ VG H++GGDI+GIV EN+L+KHKIM+ P+ +G V +IAP G Y   +VVL  EF  V+ K +MVQVWPVRQ RPV++KLPAN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EVDG  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGY+VSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPS+NWLIS+SKY RALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVGML NMI  YD +R AVETT+QSDNKITW++IRE MG+ +YK+SSMKFKDPVKDG+ KI  DY +L E++ N FR+LED
Sbjct:   15 ESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWEFIPSKNLRVGSHITGGDIYGIVNENSLIKHKIMLPPRNRGSVTYIAPPGNYDASDVVLELEFEGVKEKFSMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMISFYDMARRAVETTAQSDNKITWSIIREHMGEILYKLSSMKFKDPVKDGEAKIKADYAQLLEDMQNAFRSLED 617          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Mouse
Match: Atp6v1a (ATPase, H+ transporting, lysosomal V1 subunit A [Source:MGI Symbol;Acc:MGI:1201780])

HSP 1 Score: 298.516 bits (763), Expect = 1.427e-96
Identity = 158/223 (70.85%), Postives = 190/223 (85.20%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDAL 727
            E  FGYVH VSGPVVTA +M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV+VGDPV++TGKPLSVELGPGIMG+IFDGIQRPL DI+S T+SIYIP+GVN+ AL R IKW+F P  N+ VG H++GGDI+GIV EN+L+KHKIM+ P+ +G V +IAP G Y   +VVL  EF  V+ K +MVQVWPVRQ RPV++KLPAN+PLLTGQRVLDAL
Sbjct:   15 ESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWEFIPSKNLRVGSHITGGDIYGIVNENSLIKHKIMLPPRNRGSVTYIAPPGNYDASDVVLELEFEGVKEKFSMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDAL 237          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Mouse
Match: Atp6v1a (ATPase, H+ transporting, lysosomal V1 subunit A [Source:MGI Symbol;Acc:MGI:1201780])

HSP 1 Score: 263.848 bits (673), Expect = 7.600e-84
Identity = 127/182 (69.78%), Postives = 154/182 (84.62%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEF 604
            E  FGYVH VSGPVVTA +M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV+VGDPV++TGKPLSVELGPGIMG+IFDGIQRPL DI+S T+SIYIP+GVN+ AL R IKW+F P  N+ VG H++GGDI+GIV EN+L+KHKIM+ P+ +G V +IAP G Y   +VVL  EF
Sbjct:   15 ESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWEFIPSKNLRVGSHITGGDIYGIVNENSLIKHKIMLPPRNRGSVTYIAPPGNYDASDVVLELEF 196          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Mouse
Match: Atp5b (ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit [Source:MGI Symbol;Acc:MGI:107801])

HSP 1 Score: 116.701 bits (291), Expect = 5.348e-27
Identity = 99/364 (27.20%), Postives = 172/364 (47.25%), Query Frame = 2
Query:  695 LLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSL---SKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVN-ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDM-GYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDD--FYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYD----------KFCPFYKTVGMLKNMI-----HLYDQSRHAV----ETTSQSDN 1708
            L+TG +V+D L P  +GG   + G  G GKTV+   L      ++    ++ G GER  E +++  +     IE   +N +    + ALV    N P  AR     TG+T++EYFRD  G +V +  D+  R+ +A  E+S  L  +P+  GY   L   + +  ER            ++GS+T V A+  P  D +DP  + T   +     L + +A+   +P+++ L S S   R +D     ++HY+    +     +ILQ+ + L +I+ ++G   L+E DK+T+  AR ++  FL Q    P+           K  P  +T+   + ++     HL +Q+ + V    E  +++D 
Sbjct:  183 LVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEM----IESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--------KKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTS---RIMDPNIVGNEHYD----VARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQ-RFLSQ----PFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADK 522          
BLAST of V-type proton ATPase catalytic subunit A vs. UniProt/SwissProt
Match: sp|P31400|VATA_MANSE (V-type proton ATPase catalytic subunit A OS=Manduca sexta OX=7130 GN=VHAA PE=2 SV=1)

HSP 1 Score: 1013.06 bits (2618), Expect = 0.000e+0
Identity = 493/611 (80.69%), Postives = 559/611 (91.49%), Query Frame = 2
Query:   38 KDMKNLKIEEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            K + N + EE FGYV AVSGPVVTA  MSGSAMYELVRVGY +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++TGKPLSVELGPGI+GSIFDGIQRPLKDI  LT+SIYIPKGVN+P+L R + W+F P+NV VG H++GGD++GIV ENTLVKHK+++ P+ KG V +IAP G Y V +VVL TEF+  + ++TM+QVWPVRQPRPV++KLPAN+PLLTGQRVLD+LFPCVQGGTTAIPGAFGCGKTVISQ+LSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+E++GV ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P +R+GSV+IVGAVSPPGGDFSDPVT+ATLGIVQVFWGLDKKLAQRKHFPSINWLIS+SKY RALDDFY+K+Y EFV LRTK  EILQEEEDLSEIVQLVGK SLAE+DKITLEVA+LLKDDFLQQN YS YD+FCPFYKTVGMLKN+I  YD SRHAVE+T+QSDNK+TWN+IR+AMG+ +Y++SSMKFKDPVKDG+ KI  D+D+L E++S  FRNLED
Sbjct:    8 KTIANEENEERFGYVFAVSGPVVTAEKMSGSAMYELVRVGYNELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYIPKGVNVPSLAREVDWEFNPLNVKVGSHITGGDLYGIVHENTLVKHKMLMPPRAKGTVTYIAPAGNYKVTDVVLETEFDGEKAQYTMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQALSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTVEIEGVTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-DREGSVSIVGAVSPPGGDFSDPVTAATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYEKNYPEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSSYDRFCPFYKTVGMLKNIISFYDMSRHAVESTAQSDNKVTWNVIRDAMGNVLYQLSSMKFKDPVKDGEAKIKADFDQLLEDMSAAFRNLED 617          
BLAST of V-type proton ATPase catalytic subunit A vs. UniProt/SwissProt
Match: sp|Q5TTG1|VATA_ANOGA (V-type proton ATPase catalytic subunit A OS=Anopheles gambiae OX=7165 GN=Vha68-2 PE=3 SV=1)

HSP 1 Score: 1013.06 bits (2618), Expect = 0.000e+0
Identity = 497/615 (80.81%), Postives = 555/615 (90.24%), Query Frame = 2
Query:   44 MKNLKI------EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            M NLK       E  FGYV AVSGPVVTA  MSGSAMYELVRVGY +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  +T SIYIPKG+N+P L R+  W F P+NV  G H++GGD++GIV ENTLVKHK+MV P+ KG VK+IAP G YTVD+V+L TEF+   +K TM+QVWPVRQPRPV++KLPAN+PLLTGQRVLD+LFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVI+YVGCGERGNEMSEVL+DFPEL++E+DGV ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+SKY RAL+DFYDK++ EFV +RTK  EILQEEEDLSEIVQLVGK SLAE+DKITLEVA+LLKDDFLQQN YS YD+FCPFYKTVGMLKNMI  YD +RHAVETT+QS+NKITWN+IR++MG  +Y++SSMKFKDPVKDG+ KI  D+D+LYE++   FRNLED
Sbjct:    1 MSNLKKISDEDRESKFGYVFAVSGPVVTAERMSGSAMYELVRVGYYELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINEMTSSIYIPKGINVPCLSRTQSWSFNPLNVKAGSHITGGDLYGIVHENTLVKHKLMVPPRAKGTVKYIAPSGNYTVDDVILETEFDGEISKFTMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIVYVGCGERGNEMSEVLRDFPELSVEIDGVTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALEDFYDKNFPEFVPMRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSAYDRFCPFYKTVGMLKNMIGFYDMARHAVETTAQSENKITWNVIRDSMGQILYQLSSMKFKDPVKDGEPKIKADFDQLYEDMQQAFRNLED 614          
BLAST of V-type proton ATPase catalytic subunit A vs. UniProt/SwissProt
Match: sp|Q2TJ56|VATA_AEDAL (V-type proton ATPase catalytic subunit A OS=Aedes albopictus OX=7160 GN=VhaA PE=2 SV=1)

HSP 1 Score: 1009.59 bits (2609), Expect = 0.000e+0
Identity = 492/603 (81.59%), Postives = 552/603 (91.54%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            E  FGYV AVSGPVVTA  MSGSAMYELVRVGY +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LT SIYIPKGVN+P L R+  W F P+NV VG H++GGD++G+V ENTLVKHK++V P+ KG V++IAP G YTVD+++L TEF+    K +M+QVWPVRQPRPV++KLPAN+PLLTGQRVLD+LFPCVQGGTTAIPGAFGCGKTVISQ+LSKYSNSDVIIYVGCGERGNEMSEVL+DFPEL++E+DGV ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+SKY RALDDFYDK++ EFV LRTK  EILQEEEDLSEIVQLVGK SLAE+DKITLEVA+LLKDDFLQQN YS YD+FCPFYKTVGML+NMI  YD +RHAVETT+QS+NKITWN+IR++MG+ +Y++SSMKFKDPVKDG+ KI  D+D+LYE++   FRNLED
Sbjct:   13 ESKFGYVFAVSGPVVTAERMSGSAMYELVRVGYYELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINELTSSIYIPKGVNIPCLSRTQSWGFNPLNVKVGSHITGGDLYGLVHENTLVKHKLLVPPRAKGTVRYIAPPGNYTVDDIILETEFDGEINKWSMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQALSKYSNSDVIIYVGCGERGNEMSEVLRDFPELSVEIDGVTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNFQEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSAYDRFCPFYKTVGMLRNMIGFYDMARHAVETTAQSENKITWNVIRDSMGNILYQLSSMKFKDPVKDGEAKIKADFDQLYEDLQQAFRNLED 614          
BLAST of V-type proton ATPase catalytic subunit A vs. UniProt/SwissProt
Match: sp|O16109|VATA_AEDAE (V-type proton ATPase catalytic subunit A OS=Aedes aegypti OX=7159 GN=VhaA PE=2 SV=2)

HSP 1 Score: 1009.59 bits (2609), Expect = 0.000e+0
Identity = 492/603 (81.59%), Postives = 552/603 (91.54%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            E  FGYV AVSGPVVTA  MSGSAMYELVRVGY +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LT SIYIPKGVN+P L R+  W F P+NV VG H++GGD++G+V ENTLVKHK++V P+ KG V++IAP G YTVD+++L TEF+    K +M+QVWPVRQPRPV++KLPAN+PLLTGQRVLD+LFPCVQGGTTAIPGAFGCGKTVISQ+LSKYSNSDVIIYVGCGERGNEMSEVL+DFPEL++E+DGV ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+SKY RALDDFYDK++ EFV LRTK  EILQEEEDLSEIVQLVGK SLAE+DKITLEVA+LLKDDFLQQN YS YD+FCPFYKTVGML+NMI  YD +RHAVETT+QS+NKITWN+IR++MG+ +Y++SSMKFKDPVKDG+ KI  D+D+LYE++   FRNLED
Sbjct:   13 ESKFGYVFAVSGPVVTAERMSGSAMYELVRVGYYELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINELTSSIYIPKGVNIPCLSRTQSWGFNPLNVKVGSHITGGDLYGLVHENTLVKHKLLVPPRAKGTVRYIAPPGNYTVDDIILETEFDGEINKWSMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQALSKYSNSDVIIYVGCGERGNEMSEVLRDFPELSVEIDGVTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNFQEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSAYDRFCPFYKTVGMLRNMIGFYDMARHAVETTAQSENKITWNVIRDSMGNILYQLSSMKFKDPVKDGEAKIKADFDQLYEDLQQAFRNLED 614          
BLAST of V-type proton ATPase catalytic subunit A vs. UniProt/SwissProt
Match: sp|Q27331|VATA2_DROME (V-type proton ATPase catalytic subunit A isoform 2 OS=Drosophila melanogaster OX=7227 GN=Vha68-2 PE=1 SV=2)

HSP 1 Score: 1009.59 bits (2609), Expect = 0.000e+0
Identity = 495/615 (80.49%), Postives = 560/615 (91.06%), Query Frame = 2
Query:   44 MKNLKIEED------FGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            M NLK  +D      +G V AVSGPVVTA  MSGSAMYELVRVGY +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LT+SIYIPKGVN+P+L R   W+F P+NV VG H++GGD++G+V ENTLVKHK++V+P+ KG V++IAP G Y VD+VVL TEF+   TKHTM+QVWPVRQPRPV++KLPAN+PLLTGQRVLD+LFPCVQGGTTAIPGAFGCGKTVISQ+LSKYSNSDVIIYVGCGERGNEMSEVL+DFPEL++E+DGV ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+SKY RALDDFYDK++ EFV LRTK  EILQEEEDLSEIVQLVGK SLAE+DKITLEVA+LLKDDFLQQN YS YD+FCPFYKTVGML+N+I  YD +RH+VE+T+QS+NKITWN+IREAMG+ +Y++SSMKFKDPVKDG+ KI  D+++L+E++   FRNLED
Sbjct:    1 MSNLKRFDDEERESKYGRVFAVSGPVVTAEAMSGSAMYELVRVGYYELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINELTESIYIPKGVNVPSLSRVASWEFNPLNVKVGSHITGGDLYGLVHENTLVKHKMIVNPRAKGTVRYIAPSGNYKVDDVVLETEFDGEITKHTMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQALSKYSNSDVIIYVGCGERGNEMSEVLRDFPELSVEIDGVTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNFPEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSSYDRFCPFYKTVGMLRNIIDFYDMARHSVESTAQSENKITWNVIREAMGNIMYQLSSMKFKDPVKDGEAKIKADFEQLHEDLQQAFRNLED 614          
BLAST of V-type proton ATPase catalytic subunit A vs. TrEMBL
Match: A0A4P9I7S3 (V-ATPase A OS=Harmonia axyridis OX=115357 PE=2 SV=1)

HSP 1 Score: 1020.38 bits (2637), Expect = 0.000e+0
Identity = 499/615 (81.14%), Postives = 561/615 (91.22%), Query Frame = 2
Query:   44 MKNLKI------EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            M NL++      E ++GYVHAVSGPVVTA  M GSAMYELVRVGY +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LT+SIYIPKG+N+P L R+ KWDF P+N+ +G H++GGDI+GIV ENTLVK K+M+ PK KG V ++A  G YTVD++VL TEF+  ++K+TM+QVWPVRQPRPVS+KLPAN+PLLTGQRVLD+LFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+E++G  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P +R+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+SKYTRALDDFYDK++ EFV LRTK  EILQEEEDLSEIVQLVGK SLAE+DKITLEVA+LLK+DFLQQN YS YD+FCPFYKTVGMLKNMI LYD +RHAVETT+QS+NKITWN+IREAM + +Y++SSMKFKDPVKDG+ KI  D+D+LYE+I   FRNLED
Sbjct:    1 MSNLRLIRDEEKESEYGYVHAVSGPVVTAEKMCGSAMYELVRVGYFELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINVLTESIYIPKGINVPCLSRTAKWDFNPINIKLGSHLTGGDIYGIVHENTLVKQKLMLPPKSKGTVTYVAEPGSYTVDDIVLETEFDGERSKYTMLQVWPVRQPRPVSEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTVEIEGQTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-DREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYTRALDDFYDKNFAEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKEDFLQQNSYSSYDRFCPFYKTVGMLKNMIGLYDMARHAVETTAQSENKITWNVIREAMNNILYQLSSMKFKDPVKDGEAKIKADFDQLYEDIQQAFRNLED 614          
BLAST of V-type proton ATPase catalytic subunit A vs. TrEMBL
Match: A0A4P9I7S0 (V-ATPase A OS=Hippodamia convergens OX=64696 PE=2 SV=1)

HSP 1 Score: 1019.22 bits (2634), Expect = 0.000e+0
Identity = 499/611 (81.67%), Postives = 560/611 (91.65%), Query Frame = 2
Query:   38 KDMKNLKIEEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            + +++ + E ++GYVHAVSGPVVTA  M GSAMYELVRVGY +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LT+SIYIPKG+N+P L R+ KWDF P N+ +G H++GGDI+GIV ENTLVK K+M+ PK KG V +IA  G YTVD+VVL TEF+  +TK+TM+QVWPVRQPRPVS+KLPAN+PLLTGQRVLD+LFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+E++G  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P +R+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+SKYTRALDDFYDK++ EFV LRTK  EILQEEEDLSEIVQLVGK SLAE+DKITLEVA+LLK+DFLQQN YS YD+FCPFYKTVGMLKNMI LYD +RHAVETT+QS+NKITWN+IREAM + +Y++SSMKFKDPVKDG+ KI  D+D+LYE+I   FRNLED
Sbjct:    5 RRIRDEEQESEYGYVHAVSGPVVTAEKMCGSAMYELVRVGYFELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINVLTESIYIPKGINVPCLSRTAKWDFNPTNIKMGSHLTGGDIYGIVHENTLVKQKLMLPPKSKGTVTYIAEPGSYTVDDVVLETEFDGERTKYTMLQVWPVRQPRPVSEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTVEIEGQTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-DREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYTRALDDFYDKNFPEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKEDFLQQNSYSSYDRFCPFYKTVGMLKNMIGLYDMARHAVETTAQSENKITWNVIREAMNNILYQLSSMKFKDPVKDGEAKIKADFDQLYEDIQQAFRNLED 614          
BLAST of V-type proton ATPase catalytic subunit A vs. TrEMBL
Match: A0A182FQV4 (Uncharacterized protein OS=Anopheles albimanus OX=7167 PE=3 SV=1)

HSP 1 Score: 1018.84 bits (2633), Expect = 0.000e+0
Identity = 500/615 (81.30%), Postives = 557/615 (90.57%), Query Frame = 2
Query:   44 MKNLKI------EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            M NLK       E  FGYV AVSGPVVTA  MSGSAMYELVRVGY +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  +T SIYIPKG+N+P L R+  W F P+NV VG H++GGD++G+V ENTLVKHK+MV P+ KG VK+IAP G YTVD+V+L TEF+   +K TM+QVWPVRQPRPV++KLPAN+PLLTGQRVLD+LFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVI+YVGCGERGNEMSEVL+DFPEL++E+DGV ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+SKY RALDDFYDK++ EFV LRTK  EILQEEEDLSEIVQLVGK SLAE+DKITLEVA+LLKDDFLQQN YS YD+FCPFYKTVGMLKNMI  YD +RHAVETT+QS+NKITWN+IR+AMG+ +Y++SSMKFKDPVKDG+ KI  D+D+LYE++   FRNLED
Sbjct:    1 MSNLKKISDEDRESKFGYVFAVSGPVVTAERMSGSAMYELVRVGYYELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINEMTSSIYIPKGINVPCLSRTQSWSFNPLNVKVGSHITGGDLYGLVHENTLVKHKLMVPPRAKGTVKYIAPPGNYTVDDVILETEFDGESSKFTMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIVYVGCGERGNEMSEVLRDFPELSVEIDGVTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNFQEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSAYDRFCPFYKTVGMLKNMIGFYDMARHAVETTAQSENKITWNVIRDAMGNILYQLSSMKFKDPVKDGEPKIKADFDQLYEDMQQAFRNLED 614          
BLAST of V-type proton ATPase catalytic subunit A vs. TrEMBL
Match: A0A2M3ZZX2 (Putative vacuolar h+-atpase v1 sector subunit a OS=Anopheles triannulatus OX=58253 PE=3 SV=1)

HSP 1 Score: 1018.84 bits (2633), Expect = 0.000e+0
Identity = 500/615 (81.30%), Postives = 557/615 (90.57%), Query Frame = 2
Query:   44 MKNLKI------EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            M NLK       E  FGYV AVSGPVVTA  MSGSAMYELVRVGY +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  +T SIYIPKG+N+P L R+  W F P+NV VG H++GGD++G+V ENTLVKHK+MV P+ KG VK+IAP G YTVD+V+L TEF+   +K TM+QVWPVRQPRPV++KLPAN+PLLTGQRVLD+LFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVI+YVGCGERGNEMSEVL+DFPEL++E+DGV ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+SKY RALDDFYDK++ EFV LRTK  EILQEEEDLSEIVQLVGK SLAE+DKITLEVA+LLKDDFLQQN YS YD+FCPFYKTVGMLKNMI  YD +RHAVETT+QS+NKITWN+IR+AMG+ +Y++SSMKFKDPVKDG+ KI  D+D+LYE++   FRNLED
Sbjct:    1 MSNLKKISDEDRESKFGYVFAVSGPVVTAERMSGSAMYELVRVGYYELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINEMTSSIYIPKGINVPCLSRTQSWSFNPLNVKVGSHITGGDLYGLVHENTLVKHKLMVPPRAKGTVKYIAPPGNYTVDDVILETEFDGESSKFTMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIVYVGCGERGNEMSEVLRDFPELSVEIDGVTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNFQEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSAYDRFCPFYKTVGMLKNMIGFYDMARHAVETTAQSENKITWNVIRDAMGNILYQLSSMKFKDPVKDGEPKIKADFDQLYEDMQQAFRNLED 614          
BLAST of V-type proton ATPase catalytic subunit A vs. TrEMBL
Match: A0A232EWD6 (Uncharacterized protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_016244 PE=3 SV=1)

HSP 1 Score: 1018.45 bits (2632), Expect = 0.000e+0
Identity = 495/609 (81.28%), Postives = 560/609 (91.95%), Query Frame = 2
Query:   44 MKNLKIEEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            + N++ E  FGYV+AVSGPVVTA  MSGSAMYELVRVGY +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++TGKPLSVELGPGI+GSIFDGIQRPLKDI  LT SIYIPKGVN PAL R+I W+F P+ +  G H++GGD++GIV ENTLVKHK+++ PK KG V ++AP G YTV++VVL TEF+  +TK+TM+QVWPVRQPRPV++KLPAN+PLLTGQRVLD+LFPCVQGGTTAIPGAFGCGKTVISQ+LSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+E+DGV ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P +R+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLIS+SKY RALDDFYDK++ EFV LRTK  EILQEEEDLSEIVQLVGK SLAE+DKITLEVA+LLKDDFLQQN YSPYD+FCPFYKTVGML+NMI  YD +RHAVE+T+QSDNKITWN+IR++MG+ +Y++SSMKFKDPVKDG+ KI  D+D+L+E+I   FRNLED
Sbjct:    6 IANVEKEAKFGYVYAVSGPVVTAEKMSGSAMYELVRVGYDELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTGSIYIPKGVNTPALSRTIAWEFNPLYIKNGSHITGGDMYGIVHENTLVKHKMILPPKAKGTVTYVAPAGNYTVEDVVLETEFDGEKTKYTMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQALSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTVEIDGVTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-DREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYLRALDDFYDKNFQEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSPYDRFCPFYKTVGMLRNMIAFYDMARHAVESTAQSDNKITWNVIRDSMGNILYQLSSMKFKDPVKDGEAKIRTDFDQLHEDIQQAFRNLED 613          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Cavefish
Match: atp6v1ab (ATPase H+ transporting V1 subunit A [Source:NCBI gene;Acc:103041856])

HSP 1 Score: 996.882 bits (2576), Expect = 0.000e+0
Identity = 487/604 (80.63%), Postives = 551/604 (91.23%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            E  FGYVH VSGPVVTAS+M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV+VGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LTKSIYIP+GVN+ AL+R +KWDF P  ++ +G H++GGDI+G+V EN+L++HKIM+ P+ +G V ++AP G Y V +VVL  EF  V+ K TMVQVWPVRQ RPV++KLPAN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EVDG  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPS+NWLIS+SKYTRALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVG+L NMI  YD +RHAVETT+QSDNKITW MIRE MG+ +Y+ISSMKFKDPVK+G+ KI  DY +L+E++ N FR LED
Sbjct:   15 EGQFGYVHGVSGPVVTASSMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINDLTKSIYIPRGVNIGALNRDLKWDFSPSKSLRIGSHITGGDIYGMVFENSLIRHKIMLPPRSRGTVTYVAPPGNYDVSDVVLELEFEGVKEKFTMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYTRALDEYYDKHFPEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGILSNMIAFYDMARHAVETTAQSDNKITWAMIREHMGEILYRISSMKFKDPVKEGEAKIKADYSQLHEDMQNSFRTLED 617          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Cavefish
Match: atp6v1ab (ATPase H+ transporting V1 subunit A [Source:NCBI gene;Acc:103041856])

HSP 1 Score: 996.882 bits (2576), Expect = 0.000e+0
Identity = 487/604 (80.63%), Postives = 551/604 (91.23%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            E  FGYVH VSGPVVTAS+M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV+VGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LTKSIYIP+GVN+ AL+R +KWDF P  ++ +G H++GGDI+G+V EN+L++HKIM+ P+ +G V ++AP G Y V +VVL  EF  V+ K TMVQVWPVRQ RPV++KLPAN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EVDG  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPS+NWLIS+SKYTRALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVG+L NMI  YD +RHAVETT+QSDNKITW MIRE MG+ +Y+ISSMKFKDPVK+G+ KI  DY +L+E++ N FR LED
Sbjct:   15 EGQFGYVHGVSGPVVTASSMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINDLTKSIYIPRGVNIGALNRDLKWDFSPSKSLRIGSHITGGDIYGMVFENSLIRHKIMLPPRSRGTVTYVAPPGNYDVSDVVLELEFEGVKEKFTMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYTRALDEYYDKHFPEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGILSNMIAFYDMARHAVETTAQSDNKITWAMIREHMGEILYRISSMKFKDPVKEGEAKIKADYSQLHEDMQNSFRTLED 617          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Cavefish
Match: ENSAMXT00000015199.2 (V-type proton ATPase catalytic subunit A-like [Source:NCBI gene;Acc:103045016])

HSP 1 Score: 992.645 bits (2565), Expect = 0.000e+0
Identity = 486/604 (80.46%), Postives = 551/604 (91.23%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            E  FG+VH VSGPVVTAS+M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV+VGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LTKSIYIP+GVN+ AL+R +KW+F P  ++ VG HV+GGD++G+V EN+L+KHKIM+ P+ +G V ++AP G Y V +VVL  EF  V+ K TM+QVWPVRQ RPV++KLPAN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EVDG  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPS+NWLIS+SKYTRALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVG+L NMI  YD +RHAVETT+QSDNKITW MIRE MG+ +Y+ISSMKFKDPVK+G+ KI  DY +L E++ N FR+LED
Sbjct:   15 EGQFGFVHGVSGPVVTASSMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINDLTKSIYIPRGVNIGALNRDLKWEFTPSQSLRVGSHVTGGDLYGMVLENSLIKHKIMLPPRSRGTVTYVAPPGNYDVSDVVLELEFEGVKEKCTMLQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYTRALDEYYDKHFPEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGILSNMIAFYDMARHAVETTAQSDNKITWAMIREHMGEILYRISSMKFKDPVKEGEGKIKADYAQLLEDMQNSFRSLED 617          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Cavefish
Match: atp5f1b (ATP synthase F1 subunit beta [Source:NCBI gene;Acc:103028518])

HSP 1 Score: 115.546 bits (288), Expect = 1.025e-26
Identity = 89/304 (29.28%), Postives = 149/304 (49.01%), Query Frame = 2
Query:  695 LLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSL---SKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVN-ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDM-GYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDD--FYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQ 1585
            L+TG +V+D L P  +GG   + G  G GKTV+   L      ++    ++ G GER  E +++  +     IE   +N +    + ALV    N P  AR     TG+T++EYFRD  G +V +  D+  R+ +A  E+S  L  +P+  GY   L   + +  ER            ++GS+T V A+  P  D +DP  + T   +     L + +A+   +P+++ L S S   R +D      +HY+    +     +ILQ+ + L +I+ ++G   L+E DK+T+  AR ++  FL Q
Sbjct:  173 LVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEM----IESGVINLKDTTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--------KKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTS---RIMDPNIVGTEHYD----VARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQ-RFLSQ 456          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Cavefish
Match: atp6v1ba (ATPase, H+ transporting, lysosomal, V1 subunit B, member a [Source:ZFIN;Acc:ZDB-GENE-030711-3])

HSP 1 Score: 85.1149 bits (209), Expect = 3.728e-17
Identity = 66/232 (28.45%), Postives = 111/232 (47.84%), Query Frame = 2
Query:  932 MKRTALVANTSNMPVAAREASIYTGITLSEYFR-DMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTR-ALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPF 1621
            M    L  N +N P   R  +    +T +EY       +V ++    S +AEALRE+S    E+P   G+P Y+   LA+ YERAGRV      E R GS+T +  ++ P  D + P+   T  I +    +D++L  R+ +P IN L S S+  + A+ +   +  +  V+ +      +   +D+  +  +VG+ +L   D + LE  +  + +F+ Q    PYD    F
Sbjct:  150 MDNVCLFLNLANDPTIERIITPRLALTSAEYLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRV------EGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQVYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSNQLYACYAIG--KDVQAMKAVVGEEALTSDDLLYLEFLQKFEKNFIAQ---GPYDNRTVF 370          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003535.1 (pep scaffold:Pmarinus_7.0:GL485919:859:7269:1 gene:ENSPMAG00000003215.1 transcript:ENSPMAT00000003535.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 2.067e-22
Identity = 80/281 (28.47%), Postives = 134/281 (47.69%), Query Frame = 2
Query:  764 GAFGCGKTVISQSL---SKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVN-ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDM-GYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYD--KHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQ 1585
            G  G GKTV+   L      ++    ++ G GER  E +++  +     IE   +N +    + ALV    N P  AR     TG+T++EYFRD  G +V +  D+  R+ +A  E+S  L  +P+  GY   L   + +  ER            ++GS+T V A+  P  D +DP  + T   +     L + +A+   +P+++ L S S   R +D      +HY     +     +ILQ+ + L +I+ ++G   L+E DK+T+  AR ++  FL Q
Sbjct:    4 GGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEM----IESGVINLKDTTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--------KKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTS---RIMDPNIVGLEHYE----VARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQ-RFLSQ 264          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001377.1 (pep scaffold:Pmarinus_7.0:GL481380:275:12300:1 gene:ENSPMAG00000001232.1 transcript:ENSPMAT00000001377.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 1.244e-15
Identity = 54/185 (29.19%), Postives = 94/185 (50.81%), Query Frame = 2
Query: 1043 NVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTR-ALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGY 1594
            +V ++    S +AEALRE+S    E+P   G+P Y+   LA+ YERAGRV      E R GS+T +  ++ P  D + P+   T  I +    +D++L  R+ +P IN L S S+  + A+ +   +  +  V+ +      +   +D+  +  +VG+ +L   D + LE  +  +  F+ Q  Y
Sbjct:  217 HVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRV------EGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHSDVSNQLYACYAIG--KDVQAMKAVVGEEALTPDDLLYLEFLQKFEKTFIAQGAY 393          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002562.1 (pep scaffold:Pmarinus_7.0:GL480249:15961:22717:1 gene:ENSPMAG00000002332.1 transcript:ENSPMAT00000002562.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 3.649e-12
Identity = 64/253 (25.30%), Postives = 117/253 (46.25%), Query Frame = 2
Query:  674 KLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKT------VISQSLSKYSNSD----VIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPA---YLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIV--QVFWGLDKKLAQRKHFPSINWLISHSK 1387
            ++    P+ TG + +D+L P  +G    I G    GKT      +I+Q      N +      IYV  G++ + ++++++            N   M+ T +V+ T++     +  + Y+G ++ E+FRD G +  ++ D  S+ A A R++S  L   P    YP    YL +RL    ERA ++        + GS+T +  +    GD S  + +  + I   Q+F  L+ +L  +   P+IN  +S S+
Sbjct:   78 RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGNDEKKKLYCIYVAIGQKRSTVAQLVKRL---------TNADAMRYTIVVSATASDAAPLQYLAPYSGCSMGEFFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRL---LERAAKMN----DNFKGGSLTALPVIETQAGDVSAYIPTNVISITDGQIF--LETELFYKGIRPAINVGLSVSR 312          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006391.1 (pep scaffold:Pmarinus_7.0:GL477089:2:6303:1 gene:ENSPMAG00000005764.1 transcript:ENSPMAT00000006391.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 1.746e-9
Identity = 60/244 (24.59%), Postives = 113/244 (46.31%), Query Frame = 2
Query:  701 TGQRVLDALFPCVQGGTTAIPGAFGCGKTVIS--QSLSKYSNSD--------VIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPA---YLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIV--QVFWGLDKKLAQRKHFPSINWLISHSK 1387
            TG + +D+L P  +G    I G     KT I+    +++   +D          IYV  G++ + ++++++            +   M+ T +V+ T++     +  + Y+G ++ E+FRD G +  ++ D  S+ A A R++S  L   P    YP    YL +RL    ERA ++        + GS+T +  +    GD S  + +  + I   Q+F  L+ +L  +   P+IN  +S S+
Sbjct:    3 TGIKAVDSLVPTFRGQRELIIGDRQTWKTAIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRL---------TDADAMRYTIVVSATASDAAPLQYLAPYSGCSMGEFFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRL---LERAAKM----NDNFKGGSLTALPVIETQAGDVSAYIPTNVISITDGQIF--LETELFYKGIRPAINVGLSVSR 228          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Yeast
Match: VMA1 (Subunit A of the V1 peripheral membrane domain of V-ATPase; protein precursor undergoes self-catalyzed splicing to yield the extein Tfp1p and the intein Vde (PI-SceI), which is a site-specific endonuclease; the V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase) has eight subunits; involved in methionine restriction extension of chronological lifespan in an autophagy-dependent manner [Source:SGD;Acc:S000002344])

HSP 1 Score: 431.409 bits (1108), Expect = 1.477e-138
Identity = 212/364 (58.24%), Postives = 271/364 (74.45%), Query Frame = 2
Query:  779 GKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            G T+   S  ++  ++ ++   CGERGNEM+EVL +FPEL  E+ G  E IMKRT LVANTSNMPVAAREASIYTGITL+EYFRD G NVSM+ADS+SRWAEALREISGRL EMPA+ G+PAYLGA+LASFYERAG+   +G P+ R GSV+IV AVSP GGDFSDPVT+ATLGI QVFWGLDKKLAQRKHFPSIN  +S+SKYT  L+ FYD +Y EF  LR +  EIL   E+L ++VQLVGK +L++SDKITL+VA L+K+DFLQQNGYS YD FCP +KT  M++  I  +D+++ AV       N   W+ + ++ GD  + +SS KF +P + G++++  ++++L   +   F    D
Sbjct:  716 GITLSDDSDHQFLLANQVVVHNCGERGNEMAEVLMEFPELYTEMSGTKEPIMKRTTLVANTSNMPVAAREASIYTGITLAEYFRDQGKNVSMIADSSSRWAEALREISGRLGEMPADQGFPAYLGAKLASFYERAGKAVALGSPD-RTGSVSIVAAVSPAGGDFSDPVTTATLGITQVFWGLDKKLAQRKHFPSINTSVSYSKYTNVLNKFYDSNYPEFPVLRDRMKEILSNAEELEQVVQLVGKSALSDSDKITLDVATLIKEDFLQQNGYSTYDAFCPIWKTFDMMRAFISYHDEAQKAVA------NGANWSKLADSTGDVKHAVSSSKFFEPSR-GEKEVHGEFEKLLSTMQERFAESTD 1071          

HSP 2 Score: 357.451 bits (916), Expect = 1.077e-110
Identity = 177/282 (62.77%), Postives = 227/282 (80.50%), Query Frame = 2
Query:   38 KDMKNLKIEE----DFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLV-KHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEM 868
            K++K + +E+    ++G +++VSGPVV A NM G AMYELV+VG+  LVGE+IR++GD AT+QVYE+T+G+TVGDPV++TGKPLSVELGPG+M +I+DGIQRPLK I   ++SIYIP+G++ PALDR+IKW F P    VG H+SGGDI+G V EN+L+  HKI++ P+ +G + WIAP G YT+DE +L  EF+  ++  T+   WPVR PRPV++KL A+YPLLTGQRVLDALFPCVQGGTT IPGAFGCGKTVISQSLSKYSNSD IIYVGC  +G  +
Sbjct:   10 KEIKRISLEDHAESEYGAIYSVSGPVVIAENMIGCAMYELVKVGHDNLVGEVIRIDGDKATIQVYEETAGLTVGDPVLRTGKPLSVELGPGLMETIYDGIQRPLKAIKEESQSIYIPRGIDTPALDRTIKWQFTPGKFQVGDHISGGDIYGSVFENSLISSHKILLPPRSRGTITWIAPAGEYTLDEKILEVEFDGKKSDFTLYHTWPVRVPRPVTEKLSADYPLLTGQRVLDALFPCVQGGTTCIPGAFGCGKTVISQSLSKYSNSDAIIYVGCFAKGTNV 291          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Yeast
Match: ATP2 (Beta subunit of the F1 sector of mitochondrial F1F0 ATP synthase; which is a large, evolutionarily conserved enzyme complex required for ATP synthesis; F1 translationally regulates ATP6 and ATP8 expression to achieve a balanced output of ATP synthase genes encoded in nucleus and mitochondria; phosphorylated [Source:SGD;Acc:S000003882])

HSP 1 Score: 120.939 bits (302), Expect = 1.804e-29
Identity = 93/303 (30.69%), Postives = 148/303 (48.84%), Query Frame = 2
Query:  695 LLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSK---YSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRD-MGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFY--DKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQ 1585
            L TG +V+D L P  +GG   + G  G GKTV  Q L      ++    ++ G GER  E +++ ++  E  +    +N     + ALV    N P  AR     TG+T++EYFRD  G +V +  D+  R+ +A  E+S  L  +P+  GY   L   +    ER            ++GSVT V AV  P  D +DP  + T   +     L + +++   +P+++ L S S   R LD      +HY+    + +K  E LQ  + L +I+ ++G   L+E DK+T+E AR ++  FL Q
Sbjct:  167 LETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGV----INLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTT--------KKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKS---RLLDAAVVGQEHYD----VASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQ-RFLSQ 449          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Yeast
Match: VMA2 (Subunit B of V1 peripheral membrane domain of vacuolar H+-ATPase; electrogenic proton pump found throughout the endomembrane system; contains nucleotide binding sites; also detected in the cytoplasm; protein abundance increases in response to DNA replication stress; human homolog ATP6V1B1, implicated in autosomal-recessive distal renal tubular acidosis (RTA) with sensorineural deafness, complements yeast null mutant [Source:SGD;Acc:S000000331])

HSP 1 Score: 87.8113 bits (216), Expect = 1.063e-18
Identity = 63/233 (27.04%), Postives = 115/233 (49.36%), Query Frame = 2
Query:  932 MKRTALVANTSNMPVAAREASIYTGITLSEY--FRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRAL----------DDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGY 1594
            ++RT+L  N +N P   R  +    +T +EY  ++   + ++++ D +S +A+ALRE+S    E+P   GYP Y+   L++ YERAGRV      E R GS+T +  ++ P  D + P+   T  I +    +D++L  +  +P IN L S S+  ++            D  ++ Y ++   +           D + +  +VG+ +L+  DK++LE     +  F+ Q  Y
Sbjct:  235 LERTSLFLNLANDPTIERIITPRLALTTAEYLAYQTERHVLTILTDMSS-YADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRV------EGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIFVDRQLHNKGIYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYAKYAIGK-----------DAAAMKAVVGEEALSIEDKLSLEFLEKFEKTFITQGAY 449          

HSP 2 Score: 49.2914 bits (116), Expect = 1.433e-6
Identity = 30/102 (29.41%), Postives = 54/102 (52.94%), Query Frame = 2
Query:   50 NLKIEEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGK---LVGEIIRLEGDFATLQVYEDTSGVTVGDPVIK-TGKPLSVELGPGIMGSIFDGIQRPLKD 343
            N+K   ++  V  V+GP+V    +      E+V +         G+++ + GD A +QV+E TSG+ V    ++ TG+ L + +   ++G IFDG  RP+ +
Sbjct:   21 NVKPRLNYNTVSGVNGPLVILEKVKFPRYNEIVNLTLPDGTVRQGQVLEIRGDRAIVQVFEGTSGIDVKKTTVEFTGESLRIPVSEDMLGRIFDGSGRPIDN 122          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Yeast
Match: ATP1 (Alpha subunit of the F1 sector of mitochondrial F1F0 ATP synthase; which is a large, evolutionarily conserved enzyme complex required for ATP synthesis; F1 translationally regulates ATP6 and ATP8 expression to achieve a balanced output of ATP synthase genes encoded in nucleus and mitochondria; phosphorylated; N-terminally propionylated in vivo [Source:SGD;Acc:S000000195])

HSP 1 Score: 70.8626 bits (172), Expect = 3.024e-13
Identity = 83/322 (25.78%), Postives = 141/322 (43.79%), Query Frame = 2
Query:  692 PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVIS----------QSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPA---YLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIV--QVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKH----YNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSP 1600
            P+ TG + +DAL P  +G    I G    GKT ++           + S  S     +YV  G++ + +++++Q     T+E        MK + +VA T++     +  + +T  ++ E+FRD G +  ++ D  S+ A A R++S  L   P    YP    YL +RL    ERA ++      +E  GS+T +  +   GGD S  + +  + I   Q+F  L+ +L  +   P+IN  +S S+   A      K        F+A   + +   Q   DL        K +L   +++T           L+QN YSP
Sbjct:  182 PVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQ-----TLE----QHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRL---LERAAKLS----EKEGSGSLTALPVIETQGGDVSAYIPTNVISITDGQIF--LEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDAST----KQTLVRGERLT---------QLLKQNQYSP 472          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Nematostella
Match: EDO33624 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRN1])

HSP 1 Score: 983.4 bits (2541), Expect = 0.000e+0
Identity = 472/600 (78.67%), Postives = 544/600 (90.67%), Query Frame = 2
Query:   71 FGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            FGYV  VSGPVV A NMSG+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGVTVGDPV++T KPLSVELGPGIMGSIFDGIQRPLKDI  +T+SIYIP+GVN  +L R+++W+F P N  +G H++GGDI+G VQENT +KH IM+HPK KG + +IAP+G Y +++ +L  +F+  ++KH M+QVWPVRQ RPV+DK+ AN+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSK+SNSDVIIYVGCGERGNEMSEVL+DFPELT+E++G  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMG++VSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV C+G P +R+GSVTIVGAVSPPGGDFSDPVTSATL IVQVFWGLDKKLAQRKHFPSINWLIS+SKY RALDD+Y+K+Y EFVALRTK  EILQEEEDLSEIVQLVGKGSLAESDKITLEVA+L+KDDFLQQNGY+PYDKFCPFYKTVGML N++  YD +RH+VETT+Q++NK+TWN+I+E MGD IY +SSMKFKDP+KDG+ KI  D+ EL+E++  GFR+LED
Sbjct:   17 FGYVFGVSGPVVIAENMSGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTKKPLSVELGPGIMGSIFDGIQRPLKDINEMTQSIYIPRGVNTQSLSRTVQWEFIPGNFKIGDHITGGDIYGYVQENTFIKHHIMLHPKAKGTITYIAPQGNYYIEDTILEIDFDGEKSKHCMLQVWPVRQMRPVTDKMAANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKFSNSDVIIYVGCGERGNEMSEVLRDFPELTVEINGQVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGHHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVSCLGNP-QREGSVTIVGAVSPPGGDFSDPVTSATLNIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDYYEKNYPEFVALRTKVKEILQEEEDLSEIVQLVGKGSLAESDKITLEVAKLIKDDFLQQNGYTPYDKFCPFYKTVGMLSNIVAFYDMARHSVETTAQAENKVTWNVIKENMGDAIYALSSMKFKDPIKDGEAKIKADFAELHEQLQQGFRSLED 615          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Nematostella
Match: EDO34337 (ATP synthase subunit beta [Source:UniProtKB/TrEMBL;Acc:A7SPP0])

HSP 1 Score: 111.694 bits (278), Expect = 2.080e-26
Identity = 91/325 (28.00%), Postives = 153/325 (47.08%), Query Frame = 2
Query:  695 LLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSL---SKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVN-ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDM-GYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDD--FYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVAR----LLKDDFLQQNGYSPYD-KFCPFYKTV 1633
            L TG +V+D L P  +GG   + G  G GKTV+   L      ++    ++ G GER  E +++  +     I    +N +    + ALV    N P  AR     TG+T++EYFRD  G +V +  D+  R+ +A  E+S  L  +P+  GY   L   + +  ER            ++GS+T V A+  P  D +DP  + T   +     L + +A+   +P+++ L S S   R +D      +HY     +     +ILQ+ + L +I+ ++G   L+E DK+T+  AR     L   F+    ++ +D K  P  +T+
Sbjct:   71 LETGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEM----IMSGVINLKDKSSKVALVYGQMNEPPGARARVALTGLTVAEYFRDKEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--------KKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRGIAELGIYPAVDPLDSTS---RIMDPNIVGTEHYE----IARGVQKILQDYKSLQDIIAILGMDELSEDDKLTVARARKIQKFLSQPFVTAEVFTGHDGKLVPLKETI 376          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Nematostella
Match: EDO42756 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0L1])

HSP 1 Score: 81.2629 bits (199), Expect = 3.325e-16
Identity = 61/223 (27.35%), Postives = 108/223 (48.43%), Query Frame = 2
Query:  932 MKRTALVANTSNMPVAAREASIYTGITLSEYFR-DMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTR-ALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGY 1594
            M+   L  N +N P   R  +    +T +E+       +V ++    S +AEALRE+S    E+P   G+P Y+   LA+ YERAGRV      E R GS+T +  ++ P  D + P+   T  I +    +D++L  R+ +P IN L S S+  + A+ +   +  +  V+ +   +  +   +D+  +  +VG+ +L   D + LE     + + + Q  Y
Sbjct:  235 MENVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATVYERAGRV------EGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHSDVSNQLYANYAIG--KDVQAMKAVVGEEALTSEDLLYLEFLTKFEKNLIAQGTY 449          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Medaka
Match: atp6v1ab (ATPase H+ transporting V1 subunit A [Source:NCBI gene;Acc:101175115])

HSP 1 Score: 978.393 bits (2528), Expect = 0.000e+0
Identity = 484/604 (80.13%), Postives = 551/604 (91.23%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPV-NVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            E +FGYVH VSGPVVTA+ M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV+VGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  +T+SIYIP+GVN+ AL+R  KW+F P+ ++ VG H++GGDI+G+V EN+L+KHKIM+ PK +G V ++AP G Y + +VV+  EF  V+ K TMVQVWPVRQ RPV++KLP+N+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EVDG  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPS+NWLIS+SKYTRALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVG+L NMI  YD +RHAVETT+QSDNKITW MIRE MG+ +Y+ISSMKFKDPVKDG+ KI  DY +L E++ NGFR LE+
Sbjct:   15 ESEFGYVHGVSGPVVTATAMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINDITQSIYIPRGVNIGALNRDSKWEFTPIKSLRVGSHITGGDIYGMVFENSLIKHKIMLPPKNRGTVTYVAPPGNYDISDVVMELEFEGVKEKFTMVQVWPVRQVRPVTEKLPSNHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYTRALDEYYDKHFPEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGILSNMIAFYDMARHAVETTAQSDNKITWAMIREHMGEILYRISSMKFKDPVKDGEAKIKADYAQLLEDMQNGFRTLEE 617          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Medaka
Match: ENSORLT00000008339.2 (V-type proton ATPase catalytic subunit A [Source:NCBI gene;Acc:101165416])

HSP 1 Score: 967.222 bits (2499), Expect = 0.000e+0
Identity = 480/604 (79.47%), Postives = 548/604 (90.73%), Query Frame = 2
Query:   62 EEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQP-VNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            E  FG+VH VSGPVVTA+ M+G+AMYELVRVG+ +LVGEIIRLEGD AT+QVYE+TSGV+VGDPV++TGKPLSVELGPGIMGSIFDGIQRPLKDI  LT+SIYIP+GVN+ AL+R +KW+F P  N+ VG H++GGDI+G V EN+L+KHK+M+ P+ +G V ++AP G Y + +VVL  EF  ++ K TMVQVWPVRQ RPV++KLP+N+PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVL+DFPELT+EVDG  ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPA+SGYPAYLGARLASFYERAGRV+C+G P ER+GSV+IVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPS+NWLIS+SKYTRALD++YDKH+ EFV LRTK  EILQEEEDL+EIVQLVGK SLAE+DKITLEVA+L+KDDFLQQNGY+PYD+FCPFYKTVG+L NMI  YD + HAVE+T+QSDNKITW MIRE MG+ +YKISSMKFKDPVKDG+ KI  D+ +L E++ N FR+LE+
Sbjct:   15 ESQFGFVHGVSGPVVTATAMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINDLTQSIYIPRGVNIGALNRDLKWEFSPGQNLRVGSHITGGDIYGSVFENSLIKHKLMLPPRNRGTVTYLAPPGNYDLSDVVLELEFEGIKEKFTMVQVWPVRQVRPVTEKLPSNHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNP-EREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYTRALDEYYDKHFPEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGILSNMIAFYDMASHAVESTAQSDNKITWAMIREHMGEILYKISSMKFKDPVKDGEAKIKADFAQLLEDMQNSFRSLEE 617          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Medaka
Match: atp5f1b (ATP synthase F1 subunit beta [Source:NCBI gene;Acc:101164037])

HSP 1 Score: 115.161 bits (287), Expect = 1.326e-26
Identity = 89/304 (29.28%), Postives = 149/304 (49.01%), Query Frame = 2
Query:  695 LLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSL---SKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVN-ESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDM-GYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDD--FYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQ 1585
            L+TG +V+D L P  +GG   + G  G GKTV+   L      ++    ++ G GER  E +++  +     IE   +N +    + ALV    N P  AR     TG+T++EYFRD  G +V +  D+  R+ +A  E+S  L  +P+  GY   L   + +  ER            ++GS+T V A+  P  D +DP  + T   +     L + +A+   +P+++ L S S   R +D      +HY+    +     +ILQ+ + L +I+ ++G   L+E DK+T+  AR ++  FL Q
Sbjct:  172 LVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEM----IESGVINLKDTTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT--------KKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTS---RIMDPNIVGAEHYD----VARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVARARKIQ-RFLSQ 455          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Medaka
Match: atp6v1ba (V-type proton ATPase subunit B, brain isoform-like [Source:NCBI gene;Acc:101173571])

HSP 1 Score: 86.6557 bits (213), Expect = 1.775e-17
Identity = 72/261 (27.59%), Postives = 122/261 (46.74%), Query Frame = 2
Query:  833 IYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFR-DMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTR-ALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDK 1609
            I+   G   NE++     F +   E +G     M    L  N +N P   R  +    +T +EY       +V ++    S +AEALRE+S    E+P   G+P Y+   LA+ YERAGRV      E R GS+T +  ++ P  D + P+   T  I +    +D++L  R+ +P IN L S S+  + A+ +   +  +  V+ +      +   +D+  +  +VG+ +L   D + LE  +  + +F+ Q    PYD 
Sbjct:  182 IFSAAGLPHNEVNMETARFFKSDFEENGS----MDNVCLFLNLANDPTIERIITPRLALTTAEYLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRV------EGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQVYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSNQLYACYAIG--KDVQAMKAVVGEEALTSDDLLYLEFLQKFEKNFIAQ---GPYDN 427          
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Medaka
Match: atp6v1ba (V-type proton ATPase subunit B, brain isoform-like [Source:NCBI gene;Acc:101173571])

HSP 1 Score: 85.8853 bits (211), Expect = 3.058e-17
Identity = 65/228 (28.51%), Postives = 110/228 (48.25%), Query Frame = 2
Query:  932 MKRTALVANTSNMPVAAREASIYTGITLSEYFR-DMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTR-ALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDK 1609
            M    L  N +N P   R  +    +T +EY       +V ++    S +AEALRE+S    E+P   G+P Y+   LA+ YERAGRV      E R GS+T +  ++ P  D + P+   T  I +    +D++L  R+ +P IN L S S+  + A+ +   +  +  V+ +      +   +D+  +  +VG+ +L   D + LE  +  + +F+ Q    PYD 
Sbjct:  245 MDNVCLFLNLANDPTIERIITPRLALTTAEYLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRV------EGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQVYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSNQLYACYAIG--KDVQAMKAVVGEEALTSDDLLYLEFLQKFEKNFIAQ---GPYDN 461          
BLAST of V-type proton ATPase catalytic subunit A vs. Planmine SMEST
Match: SMESG000028157.1 (SMESG000028157.1)

HSP 1 Score: 1234.94 bits (3194), Expect = 0.000e+0
Identity = 613/613 (100.00%), Postives = 613/613 (100.00%), Query Frame = 2
Query:   32 MEKDMKNLKIEEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMXXXXXXXXXXXXSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 1870
            MEKDMKNLKIEEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMVQVWPVRQPRPVSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED
Sbjct:    1 MEKDMKNLKIEEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEIIRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQRPLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGIVQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTMVQVWPVRQPRPVSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHAVETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDELYEEISNGFRNLED 613          
BLAST of V-type proton ATPase catalytic subunit A vs. Planmine SMEST
Match: SMESG000036539.1 (SMESG000036539.1)

HSP 1 Score: 108.997 bits (271), Expect = 1.132e-24
Identity = 88/304 (28.95%), Postives = 145/304 (47.70%), Query Frame = 2
Query:  695 LLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSK---YSNSDVIIYVGCGERGNEMSEVLQDFPEL-TIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDM-GYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTRALDD--FYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQ 1585
            L TG +V+D L P  +GG   + G  G GKTV+   L      ++    ++ G GER  E +++  +      I++ G       + +LV    N P  AR     TG+T++EYFRD  G +V +  D+  R+ +A  E+S  L  +P+  GY   L   + +  ER             +GS+T V A+  P  D +DP  + T   +     L + +A+   +P+++ L S S   R LD     ++HY    ++     +ILQ    L +I+ ++G   L+E DK+T+  AR ++  FL Q
Sbjct:  180 LETGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIARAHGGYSVFAGVGERTREGNDLYHEMITTGVIDLKGDK----SKVSLVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTN--------KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRGIAELGIYPAVDPLDSIS---RILDPNIVGEEHY----SVARGVQKILQNYRSLQDIIAILGMDELSEEDKLTVSRARKIQ-RFLSQ 463          
BLAST of V-type proton ATPase catalytic subunit A vs. Planmine SMEST
Match: SMESG000022877.1 (SMESG000022877.1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.182e-20
Identity = 81/299 (27.09%), Postives = 139/299 (46.49%), Query Frame = 2
Query:  734 CVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEY--FRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISHSKYTR-ALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAESDKITLEVARLLKDDFLQQNGY---SPYDKF 1612
            C Q G   +PG     K+V    L  + ++  I++   G         +QDF E            M+   L  N +N P   R  +    +T +EY  ++   + + ++ D TS +AEALRE+S    E+P   G+P Y+   LA+ YERAGRV      E R GS+T +  ++ P  D + P+   T  I +    +D++L  R+ +P IN L S S+  + A+ +   +  +  V+ +      +   +D+  +  +VG+ +L++ D + LE     + +F+ Q  Y   S YD  
Sbjct:  186 CRQAGLVRLPG-----KSV----LDDHQDNFAIVFAAMGVNMETARFFMQDFKE---------HGSMENVCLFLNLANDPTIERIITPRIALTTAEYLAYQCEKHVLVILTDMTS-YAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRV------EGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEEMTREDHSDVSNQLYACYAIG--KDVQAMKAVVGEEALSQDDLLYLEFLTKFEKNFINQGSYDNRSVYDSL 457          
BLAST of V-type proton ATPase catalytic subunit A vs. Planmine SMEST
Match: SMESG000004897.1 (SMESG000004897.1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.863e-12
Identity = 67/247 (27.13%), Postives = 116/247 (46.96%), Query Frame = 2
Query:  692 PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQS--LSKYSNSD--------VIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPA---YLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIV--QVFWGLDKKLAQRKHFPSINWLISHSK 1387
            P+ TG + +D+L P  +G    I G    GKT I+    +++   +D          IYV  G++ + ++++++            N   MK T +V+ T++     +  S Y+G  + EYFRD G +  ++ D  S+ A A R++S  L   P    YP    YL +RL    ERA ++  + G     GS+T +  +    GD S  + +  + I   Q+F  L+ +L  +   P+IN  +S S+
Sbjct:  180 PMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLS---------NADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRL---LERAAKMSDVYGG----GSLTALPVIETQAGDVSAYIPTNVISITDGQIF--LETELFYKGIRPAINVGLSVSR 408          
BLAST of V-type proton ATPase catalytic subunit A vs. Planmine SMEST
Match: SMESG000004897.1 (SMESG000004897.1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.868e-12
Identity = 67/247 (27.13%), Postives = 116/247 (46.96%), Query Frame = 2
Query:  692 PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQS--LSKYSNSD--------VIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPA---YLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIV--QVFWGLDKKLAQRKHFPSINWLISHSK 1387
            P+ TG + +D+L P  +G    I G    GKT I+    +++   +D          IYV  G++ + ++++++            N   MK T +V+ T++     +  S Y+G  + EYFRD G +  ++ D  S+ A A R++S  L   P    YP    YL +RL    ERA ++  + G     GS+T +  +    GD S  + +  + I   Q+F  L+ +L  +   P+IN  +S S+
Sbjct:  177 PMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLS---------NADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRL---LERAAKMSDVYGG----GSLTALPVIETQAGDVSAYIPTNVISITDGQIF--LETELFYKGIRPAINVGLSVSR 405          
The following BLAST results are available for this feature:
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP6V1A0.000e+080.46ATPase H+ transporting V1 subunit A [Source:HGNC S... [more]
ATP6V1A6.773e-8769.11ATPase H+ transporting V1 subunit A [Source:HGNC S... [more]
ATP6V1A1.309e-7668.60ATPase H+ transporting V1 subunit A [Source:HGNC S... [more]
ATP5F1B1.608e-2627.20ATP synthase F1 subunit beta [Source:HGNC Symbol;A... [more]
ATP5F1B8.162e-2129.24ATP synthase F1 subunit beta [Source:HGNC Symbol;A... [more]
back to top
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vha-130.000e+076.61V-type proton ATPase catalytic subunit A [Source:... [more]
vha-130.000e+076.61V-type proton ATPase catalytic subunit A [Source:... [more]
vha-130.000e+076.61V-type proton ATPase catalytic subunit A [Source:... [more]
vha-130.000e+076.61V-type proton ATPase catalytic subunit A [Source:... [more]
vha-130.000e+076.61V-type proton ATPase catalytic subunit A [Source:... [more]
back to top
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vha68-20.000e+080.49gene:FBgn0263598 transcript:FBtr0080420[more]
Vha68-20.000e+080.49gene:FBgn0263598 transcript:FBtr0080418[more]
Vha68-20.000e+080.49gene:FBgn0263598 transcript:FBtr0305551[more]
Vha68-20.000e+080.49gene:FBgn0263598 transcript:FBtr0336614[more]
Vha68-20.000e+080.49gene:FBgn0263598 transcript:FBtr0080419[more]
back to top
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp6v1aa0.000e+080.63ATPase H+ transporting V1 subunit Aa [Source:ZFIN;... [more]
atp6v1aa0.000e+080.63ATPase H+ transporting V1 subunit Aa [Source:ZFIN;... [more]
atp6v1ab0.000e+080.79ATPase H+ transporting V1 subunit Ab [Source:ZFIN;... [more]
atp6v1ab0.000e+080.79ATPase H+ transporting V1 subunit Ab [Source:ZFIN;... [more]
atp5f1b1.313e-2627.89ATP synthase F1 subunit beta [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpc50.000e+079.66glypican 5 [Source:Xenbase;Acc:XB-GENE-6031723][more]
gpc50.000e+075.13glypican 5 [Source:Xenbase;Acc:XB-GENE-6031723][more]
gpc50.000e+075.13glypican 5 [Source:Xenbase;Acc:XB-GENE-6031723][more]
gpc50.000e+075.00glypican 5 [Source:Xenbase;Acc:XB-GENE-6031723][more]
gpc50.000e+075.13glypican 5 [Source:Xenbase;Acc:XB-GENE-6031723][more]
back to top
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp6v1a0.000e+080.13ATPase, H+ transporting, lysosomal V1 subunit A [S... [more]
Atp6v1a0.000e+080.13ATPase, H+ transporting, lysosomal V1 subunit A [S... [more]
Atp6v1a1.427e-9670.85ATPase, H+ transporting, lysosomal V1 subunit A [S... [more]
Atp6v1a7.600e-8469.78ATPase, H+ transporting, lysosomal V1 subunit A [S... [more]
Atp5b5.348e-2727.20ATP synthase, H+ transporting mitochondrial F1 com... [more]
back to top
BLAST of V-type proton ATPase catalytic subunit A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P31400|VATA_MANSE0.000e+080.69V-type proton ATPase catalytic subunit A OS=Manduc... [more]
sp|Q5TTG1|VATA_ANOGA0.000e+080.81V-type proton ATPase catalytic subunit A OS=Anophe... [more]
sp|Q2TJ56|VATA_AEDAL0.000e+081.59V-type proton ATPase catalytic subunit A OS=Aedes ... [more]
sp|O16109|VATA_AEDAE0.000e+081.59V-type proton ATPase catalytic subunit A OS=Aedes ... [more]
sp|Q27331|VATA2_DROME0.000e+080.49V-type proton ATPase catalytic subunit A isoform 2... [more]
back to top
BLAST of V-type proton ATPase catalytic subunit A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4P9I7S30.000e+081.14V-ATPase A OS=Harmonia axyridis OX=115357 PE=2 SV=... [more]
A0A4P9I7S00.000e+081.67V-ATPase A OS=Hippodamia convergens OX=64696 PE=2 ... [more]
A0A182FQV40.000e+081.30Uncharacterized protein OS=Anopheles albimanus OX=... [more]
A0A2M3ZZX20.000e+081.30Putative vacuolar h+-atpase v1 sector subunit a OS... [more]
A0A232EWD60.000e+081.28Uncharacterized protein OS=Trichomalopsis sarcopha... [more]
back to top
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp6v1ab0.000e+080.63ATPase H+ transporting V1 subunit A [Source:NCBI g... [more]
atp6v1ab0.000e+080.63ATPase H+ transporting V1 subunit A [Source:NCBI g... [more]
ENSAMXT00000015199.20.000e+080.46V-type proton ATPase catalytic subunit A-like [Sou... [more]
atp5f1b1.025e-2629.28ATP synthase F1 subunit beta [Source:NCBI gene;Acc... [more]
atp6v1ba3.728e-1728.45ATPase, H+ transporting, lysosomal, V1 subunit B, ... [more]
back to top
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000003535.12.067e-2228.47pep scaffold:Pmarinus_7.0:GL485919:859:7269:1 gene... [more]
ENSPMAT00000001377.11.244e-1529.19pep scaffold:Pmarinus_7.0:GL481380:275:12300:1 gen... [more]
ENSPMAT00000002562.13.649e-1225.30pep scaffold:Pmarinus_7.0:GL480249:15961:22717:1 g... [more]
ENSPMAT00000006391.11.746e-924.59pep scaffold:Pmarinus_7.0:GL477089:2:6303:1 gene:E... [more]
back to top
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
VMA11.477e-13858.24Subunit A of the V1 peripheral membrane domain of ... [more]
ATP21.804e-2930.69Beta subunit of the F1 sector of mitochondrial F1F... [more]
VMA21.063e-1827.04Subunit B of V1 peripheral membrane domain of vacu... [more]
ATP13.024e-1325.78Alpha subunit of the F1 sector of mitochondrial F1... [more]
back to top
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO336240.000e+078.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343372.080e-2628.00ATP synthase subunit beta [Source:UniProtKB/TrEMB... [more]
EDO427563.325e-1627.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of V-type proton ATPase catalytic subunit A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp6v1ab0.000e+080.13ATPase H+ transporting V1 subunit A [Source:NCBI g... [more]
ENSORLT00000008339.20.000e+079.47V-type proton ATPase catalytic subunit A [Source:N... [more]
atp5f1b1.326e-2629.28ATP synthase F1 subunit beta [Source:NCBI gene;Acc... [more]
atp6v1ba1.775e-1727.59V-type proton ATPase subunit B, brain isoform-like... [more]
atp6v1ba3.058e-1728.51V-type proton ATPase subunit B, brain isoform-like... [more]
back to top
BLAST of V-type proton ATPase catalytic subunit A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028157.10.000e+0100.00SMESG000028157.1[more]
SMESG000036539.11.132e-2428.95SMESG000036539.1[more]
SMESG000022877.11.182e-2027.09SMESG000022877.1[more]
SMESG000004897.11.863e-1227.13SMESG000004897.1[more]
SMESG000004897.11.868e-1227.13SMESG000004897.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025367 ID=SMED30025367|Name=V-type proton ATPase catalytic subunit A|organism=Schmidtea mediterranea sexual|type=transcript|length=2059bp
ATTTTAATTACCTACGCATTAACAAATACAAATGGAAAAAGATATGAAGA
ATTTAAAAATTGAGGAGGATTTTGGATATGTTCATGCCGTTTCTGGACCA
GTCGTTACTGCAAGTAATATGTCTGGCTCTGCTATGTATGAATTGGTTCG
GGTTGGTTATGGAAAGTTAGTCGGTGAAATTATTCGTCTTGAAGGTGATT
TTGCAACTCTTCAAGTATACGAAGATACATCTGGTGTAACCGTTGGAGAT
CCCGTTATTAAAACTGGGAAACCACTTTCAGTTGAATTAGGTCCTGGAAT
AATGGGCAGCATTTTCGATGGTATTCAAAGACCTTTGAAAGATATTGCTT
CATTAACTAAAAGTATCTATATTCCTAAAGGAGTTAACCTTCCAGCTTTG
GATCGTTCAATTAAATGGGATTTTCAACCCGTTAATGTCAGTGTAGGATT
ACACGTTTCAGGTGGTGATATTTTTGGGATTGTTCAAGAAAACACTTTAG
TCAAACATAAAATTATGGTTCATCCCAAAGAAAAAGGTATTGTAAAATGG
ATCGCTCCTCGAGGTCTTTATACAGTTGATGAAGTTGTGCTAGTAACTGA
ATTCAACAAAGTTCAAACCAAACATACAATGGTCCAAGTCTGGCCTGTTC
GACAGCCACGTCCCGTCTCAGACAAATTGCCGGCTAATTATCCTTTGTTA
ACTGGTCAGCGTGTTCTTGATGCTCTTTTTCCATGTGTACAAGGAGGAAC
TACCGCAATTCCAGGAGCTTTCGGTTGTGGGAAAACTGTTATTTCACAAT
CGTTGTCAAAATACTCGAATTCTGATGTTATTATCTATGTTGGTTGTGGA
GAAAGAGGAAATGAAATGTCAGAGGTGTTGCAAGATTTCCCAGAATTGAC
AATTGAAGTTGACGGAGTGAATGAATCGATTATGAAGCGTACAGCGTTGG
TTGCAAATACTTCCAACATGCCTGTGGCTGCTCGTGAGGCATCTATTTAC
ACTGGGATCACGTTGTCGGAGTATTTCCGTGACATGGGCTACAATGTCAG
TATGATGGCTGACTCGACAAGTCGATGGGCAGAAGCACTGAGAGAAATTA
GTGGTCGATTAGCAGAAATGCCTGCCGAATCCGGCTATCCAGCTTATTTA
GGCGCTAGATTAGCAAGTTTCTATGAACGAGCCGGTCGAGTTCAGTGCAT
CGGTGGACCGGAAGAACGACAAGGCTCAGTGACAATTGTTGGGGCTGTTT
CGCCTCCTGGTGGTGATTTCTCGGATCCTGTCACTTCAGCTACGCTTGGT
ATAGTGCAAGTATTTTGGGGTCTCGACAAAAAACTGGCGCAAAGAAAACA
TTTCCCGAGCATCAATTGGTTGATATCTCATAGCAAATACACGAGAGCTC
TTGATGATTTCTATGACAAGCATTACAATGAATTTGTTGCTTTGAGAACA
AAAACCTCAGAAATTTTACAGGAGGAAGAAGATTTGTCAGAAATCGTTCA
ATTGGTCGGCAAAGGTTCACTTGCAGAAAGTGATAAAATCACCTTAGAAG
TGGCCCGTTTACTAAAGGATGACTTCTTGCAACAGAACGGTTATTCTCCA
TATGATAAATTTTGTCCATTCTACAAGACAGTAGGCATGTTGAAAAACAT
GATACATCTCTATGACCAGTCACGACACGCCGTAGAGACCACATCGCAGT
CGGACAACAAAATCACCTGGAATATGATCCGTGAAGCAATGGGTGATACC
ATTTACAAGATTTCCTCTATGAAATTTAAAGATCCAGTCAAAGATGGCAA
AGAGAAAATATTGCGAGATTACGATGAATTATATGAGGAAATATCCAATG
GATTCCGCAATTTGGAAGATTAATATTGTTACGCAGTTACGCAATTTCTT
GAAGCATAATATTAACTTACAAATACTGTAATTGACTTTTATAATTAATA
ATTGATTTTGTAATGAGGTTTGTTAGTAATAATTAGTCTATTAATGTTGT
CAATAATTATTATTATTAGAACTGACTTGTCACGCTATTTTTGTTAATAT
TAATAAAAC
back to top

protein sequence of SMED30025367-orf-1

>SMED30025367-orf-1 ID=SMED30025367-orf-1|Name=SMED30025367-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=614bp
MEKDMKNLKIEEDFGYVHAVSGPVVTASNMSGSAMYELVRVGYGKLVGEI
IRLEGDFATLQVYEDTSGVTVGDPVIKTGKPLSVELGPGIMGSIFDGIQR
PLKDIASLTKSIYIPKGVNLPALDRSIKWDFQPVNVSVGLHVSGGDIFGI
VQENTLVKHKIMVHPKEKGIVKWIAPRGLYTVDEVVLVTEFNKVQTKHTM
VQVWPVRQPRPVSDKLPANYPLLTGQRVLDALFPCVQGGTTAIPGAFGCG
KTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLQDFPELTIEVDGVNESI
MKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWA
EALREISGRLAEMPAESGYPAYLGARLASFYERAGRVQCIGGPEERQGSV
TIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISH
SKYTRALDDFYDKHYNEFVALRTKTSEILQEEEDLSEIVQLVGKGSLAES
DKITLEVARLLKDDFLQQNGYSPYDKFCPFYKTVGMLKNMIHLYDQSRHA
VETTSQSDNKITWNMIREAMGDTIYKISSMKFKDPVKDGKEKILRDYDEL
YEEISNGFRNLED*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1902600hydrogen ion transmembrane transport
GO:0015992proton transport
GO:0046034ATP metabolic process
GO:0015991ATP hydrolysis coupled proton transport
GO:0006810transport
GO:0006811ion transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005725ATPase_V1-cplx_asu
IPR023366ATP_synth_asu-like_sf
IPR022878V-ATPase_asu
IPR036121ATPase_F1/V1/A1_a/bsu_N_sf
IPR031686ATP-synth_a_Xtn
IPR024034ATPase_F1/V1_b/a_C
IPR027417P-loop_NTPase
IPR004100ATPase_F1/V1/A1_a/bsu_N
IPR000194ATPase_F1/V1/A1_a/bsu_nucl-bd
IPR000793ATP_synth_asu_C
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0016820hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
GO:0000166nucleotide binding
GO:0016787hydrolase activity
GO:0046961proton-transporting ATPase activity, rotational mechanism
Vocabulary: cellular component
TermDefinition
GO:0033178proton-transporting two-sector ATPase complex, catalytic domain
GO:0005765lysosomal membrane
GO:0005886plasma membrane
GO:0033180proton-transporting V-type ATPase, V1 domain
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR024034ATPase, F1/V1 complex, beta/alpha subunit, C-terminalGENE3DG3DSA:1.10.1140.10coord: 452..612
e-value: 5.2E-50
score: 171.0
IPR005725ATPase, V1 complex, subunit ATIGRFAMTIGR01042TIGR01042coord: 14..604
e-value: 0.0
score: 1129.1
IPR031686ATPsynthase alpha/beta subunit, N-terminal extensionPFAMPF16886ATP-synt_ab_Xtncoord: 95..216
e-value: 7.1E-44
score: 148.6
IPR000194ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domainPFAMPF00006ATP-synt_abcoord: 225..451
e-value: 2.1E-108
score: 360.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 83..451
e-value: 1.0E-180
score: 602.3
NoneNo IPR availableGENE3DG3DSA:2.40.50.100coord: 127..198
e-value: 1.0E-180
score: 602.3
NoneNo IPR availableCDDcd18111ATP-synt_V_A-type_alpha_Ccoord: 468..572
e-value: 1.88381E-50
score: 167.951
NoneNo IPR availableCDDcd18119ATP-synt_V_A-type_alpha_Ncoord: 14..80
e-value: 1.44807E-36
score: 128.798
NoneNo IPR availableCDDcd01134V_A-ATPase_Acoord: 81..453
e-value: 0.0
score: 781.793
NoneNo IPR availableSUPERFAMILYSSF47917C-terminal domain of alpha and beta subunits of F1 ATP synthasecoord: 466..570
IPR004100ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal domainPFAMPF02874ATP-synt_ab_Ncoord: 18..79
e-value: 1.0E-13
score: 51.6
IPR023366ATP synthase subunit alpha, N-terminal domain-like superfamilyGENE3DG3DSA:2.40.30.20coord: 13..82
e-value: 1.1E-31
score: 110.4
IPR022878V-type ATP synthase catalytic alpha chainPANTHERPTHR43607FAMILY NOT NAMEDcoord: 6..613
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 197..455
IPR036121ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal domain superfamilySUPERFAMILYSSF50615N-terminal domain of alpha and beta subunits of F1 ATP synthasecoord: 12..82