E3 ubiquitin-protein ligase CBL

Overview
NameE3 ubiquitin-protein ligase CBL
Smed IDSMED30025338
Length (bp)2494
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase CBL (SMED30025338) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase CBL (SMED30025338) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase CBL (SMED30025338) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase CBL (SMED30025338) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025338

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30025338h1SMcG0019919 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30025338h1SMcG0019919 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025338h1SMcG0019919 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025338h1SMcG0019919 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025338h1SMcG0019919 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025338h1SMcG0019919 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025338h1SMcG0019919 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025338h1SMcG0019919 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025338h1SMcG0019919 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30025338h1SMcG0019920 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30025338h1SMcG0019920 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025338h1SMcG0019920 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025338h1SMcG0019920 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025338h1SMcG0019920 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025338h1SMcG0019920 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025338h1SMcG0019920 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025338h1SMcG0019920 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025338h1SMcG0019920 dd_Smed_v4_330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30025338h1SMcG0019920 dd_Smed_v6_330_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025338h1SMcG0019920 dd_Smed_v6_330_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30025338h1SMcG0019919 dd_Smed_v6_330_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025338h1SMcG0019919 dd_Smed_v6_330_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Human
Match: CBLB (Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:1542])

HSP 1 Score: 319.701 bits (818), Expect = 1.732e-96
Identity = 159/398 (39.95%), Postives = 250/398 (62.81%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSIDCPLVPP 1396
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FPN  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +   PG  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++E ++  SI  P   P
Sbjct:   52 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGD-KTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPG--SYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQES-DGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCCSIIDPFGMP 445          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Human
Match: CBLB (Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:1542])

HSP 1 Score: 320.857 bits (821), Expect = 1.906e-96
Identity = 159/398 (39.95%), Postives = 250/398 (62.81%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSIDCPLVPP 1396
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FPN  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +   PG  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++E ++  SI  P   P
Sbjct:   52 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGD-KTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPG--SYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQES-DGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCCSIIDPFGMP 445          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Human
Match: CBLB (Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:1542])

HSP 1 Score: 320.472 bits (820), Expect = 7.457e-96
Identity = 157/391 (40.15%), Postives = 248/391 (63.43%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSI 1375
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FPN  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +   PG  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++E ++  SI
Sbjct:   52 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGD-KTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPG--SYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQES-DGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCCSI 438          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Human
Match: CBLB (Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:1542])

HSP 1 Score: 320.472 bits (820), Expect = 8.006e-96
Identity = 159/398 (39.95%), Postives = 250/398 (62.81%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSIDCPLVPP 1396
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FPN  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +   PG  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++E ++  SI  P   P
Sbjct:   52 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGD-KTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPG--SYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQES-DGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCCSIIDPFGMP 445          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Human
Match: CBLB (Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:1542])

HSP 1 Score: 320.472 bits (820), Expect = 1.005e-95
Identity = 157/391 (40.15%), Postives = 248/391 (63.43%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSI 1375
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FPN  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +   PG  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++E ++  SI
Sbjct:   74 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGD-KTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPG--SYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQES-DGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCCSI 460          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Celegans
Match: sli-1 (Suppressor of LIneage defect [Source:UniProtKB/TrEMBL;Acc:Q95ZR5])

HSP 1 Score: 282.337 bits (721), Expect = 1.506e-85
Identity = 155/400 (38.75%), Postives = 242/400 (60.50%), Query Frame = 2
Query:  251 INFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFSFDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAA--LRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNII-VSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKS-FRCQSCPFCRLEIKG-----IEKISLIPYD---SKNENTQNKSID--CPLVPPRQMS 1408
            +N K +PP++  IL +    +M I   +    + L   ++ ++ + ++I +CKEI+++ +  +  +++ SE R+KL  +S+  SH+   + ALFP   Y  + FR+TK +A  +W+  F     +V W+ FF    K ++ S + ++ A  L+ TI+++G+ F+S F+FDVF RLF P+  ++++W+ +   HPG  +++TY++V + L+  +    PGSY+FR SCT+PGQWAIGY+   GKIYQTI  NKSL  AL+EG + G Y YPNG+  D + L  L+  P  + + V+ E++E Y  + ++FELCKIC  N KNIK+EPCGHLLC  CL+ WQ S     +CPFCR EIKG     I++    P +   +KN     K +    P VPPR  S
Sbjct:   71 LNLKNSPPFILDILPDTYTHLMLI---FTQNNDILQDNDYLKIFLESMINKCKEIIKLFK-TSAIYNDQSEERRKLTKMSLTFSHMLFEIKALFPEGIYIEDRFRMTKKEAESFWSHHFTK-KNIVPWSTFFTALEK-HHGSTIGKMEAAELKATIDLSGDDFISNFEFDVFTRLFYPFKTLIKNWQTLTTAHPGYCAFLTYDEVKKRLE--KLTKKPGSYIFRLSCTRPGQWAIGYVAPDGKIYQTIPQNKSLIQALHEGHKEGFYIYPNGRDQDIN-LSKLMDVPQADRVQVTSEQYELYCEMGTTFELCKICDDNEKNIKIEPCGHLLCAKCLANWQDSDGGGNTCPFCRYEIKGTNRVIIDRFKPTPVEIEKAKNVAAAEKKLISLVPDVPPRTSS 461          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Celegans
Match: sli-1 (Suppressor of LIneage defect [Source:UniProtKB/TrEMBL;Acc:Q95ZR5])

HSP 1 Score: 283.108 bits (723), Expect = 2.560e-85
Identity = 170/469 (36.25%), Postives = 264/469 (56.29%), Query Frame = 2
Query:  251 INFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFSFDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAA--LRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNII-VSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKS-FRCQSCPFCRLEIKG-----IEKISLIPYD---SKNENTQNKSID--CPLVPPRQMSFLQKQVSDEKCSLSNDNGNKV----------------NYAQLDWV-SGNDSGSLINSYETENIEFTSKT 1564
            +N K +PP++  IL +    +M I   +    + L   ++ ++ + ++I +CKEI+++ +  +  +++ SE R+KL  +S+  SH+   + ALFP   Y  + FR+TK +A  +W+  F     +V W+ FF    K ++ S + ++ A  L+ TI+++G+ F+S F+FDVF RLF P+  ++++W+ +   HPG  +++TY++V + L+  +    PGSY+FR SCT+PGQWAIGY+   GKIYQTI  NKSL  AL+EG + G Y YPNG+  D + L  L+  P  + + V+ E++E Y  + ++FELCKIC  N KNIK+EPCGHLLC  CL+ WQ S     +CPFCR EIKG     I++    P +   +KN     K +    P VPPR        VS    SL +D  N +                    LD + S   S S +N  E EN+E + + 
Sbjct:   71 LNLKNSPPFILDILPDTYTHLMLI---FTQNNDILQDNDYLKIFLESMINKCKEIIKLFK-TSAIYNDQSEERRKLTKMSLTFSHMLFEIKALFPEGIYIEDRFRMTKKEAESFWSHHFTK-KNIVPWSTFFTALEK-HHGSTIGKMEAAELKATIDLSGDDFISNFEFDVFTRLFYPFKTLIKNWQTLTTAHPGYCAFLTYDEVKKRLE--KLTKKPGSYIFRLSCTRPGQWAIGYVAPDGKIYQTIPQNKSLIQALHEGHKEGFYIYPNGRDQDIN-LSKLMDVPQADRVQVTSEQYELYCEMGTTFELCKICDDNEKNIKIEPCGHLLCAKCLANWQDSDGGGNTCPFCRYEIKGTNRVIIDRFKPTPVEIEKAKNVAAAEKKLISLVPDVPPRTY------VSQCSQSLLHDASNSIPSVDELPLVPPPLPPKALGTLDTLNSSQTSSSYVNIKELENVETSGEA 524          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Celegans
Match: sli-1 (Suppressor of LIneage defect [Source:UniProtKB/TrEMBL;Acc:Q95ZR5])

HSP 1 Score: 282.337 bits (721), Expect = 7.033e-85
Identity = 170/469 (36.25%), Postives = 264/469 (56.29%), Query Frame = 2
Query:  251 INFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFSFDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAA--LRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNII-VSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKS-FRCQSCPFCRLEIKG-----IEKISLIPYD---SKNENTQNKSID--CPLVPPRQMSFLQKQVSDEKCSLSNDNGNKV----------------NYAQLDWV-SGNDSGSLINSYETENIEFTSKT 1564
            +N K +PP++  IL +    +M I   +    + L   ++ ++ + ++I +CKEI+++ +  +  +++ SE R+KL  +S+  SH+   + ALFP   Y  + FR+TK +A  +W+  F     +V W+ FF    K ++ S + ++ A  L+ TI+++G+ F+S F+FDVF RLF P+  ++++W+ +   HPG  +++TY++V + L+  +    PGSY+FR SCT+PGQWAIGY+   GKIYQTI  NKSL  AL+EG + G Y YPNG+  D + L  L+  P  + + V+ E++E Y  + ++FELCKIC  N KNIK+EPCGHLLC  CL+ WQ S     +CPFCR EIKG     I++    P +   +KN     K +    P VPPR        VS    SL +D  N +                    LD + S   S S +N  E EN+E + + 
Sbjct:   88 LNLKNSPPFILDILPDTYTHLMLI---FTQNNDILQDNDYLKIFLESMINKCKEIIKLFK-TSAIYNDQSEERRKLTKMSLTFSHMLFEIKALFPEGIYIEDRFRMTKKEAESFWSHHFTK-KNIVPWSTFFTALEK-HHGSTIGKMEAAELKATIDLSGDDFISNFEFDVFTRLFYPFKTLIKNWQTLTTAHPGYCAFLTYDEVKKRLE--KLTKKPGSYIFRLSCTRPGQWAIGYVAPDGKIYQTIPQNKSLIQALHEGHKEGFYIYPNGRDQDIN-LSKLMDVPQADRVQVTSEQYELYCEMGTTFELCKICDDNEKNIKIEPCGHLLCAKCLANWQDSDGGGNTCPFCRYEIKGTNRVIIDRFKPTPVEIEKAKNVAAAEKKLISLVPDVPPRTY------VSQCSQSLLHDASNSIPSVDELPLVPPPLPPKALGTLDTLNSSQTSSSYVNIKELENVETSGEA 541          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Fly
Match: Cbl (gene:FBgn0020224 transcript:FBtr0076614)

HSP 1 Score: 316.235 bits (809), Expect = 3.973e-99
Identity = 161/395 (40.76%), Postives = 247/395 (62.53%), Query Frame = 2
Query:  188 KDFHYVLSLIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQN-IIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQN 1366
            K       L++K  K      +N K +PP++  IL +   ++  I    E++++ L     F V I  L+++CK+ +++ +      FDE S  R+ L  +S++ SH+   + A+FPN  +A + FRITK+DAAD+W S FG  +T+V W  F    +K++ I    +  AL+ TI++T N F+S F+FDVF RLFQPW  +L +W+++ + HPG ++++TY++V   L+  R     GSYVFR SCT+ GQWAIGY+   G+I QTI  NKSL  AL +G + G Y YP+G+ Y N  L + V SP ++ I V+ E++E Y  + S+F+LCKIC++N+K+I++EPCGHLLC  CL+ WQ     Q CPFCR EIKG E+I +  +D + ++ +N
Sbjct:   42 KTLEKTWKLMDKVVKLCQQPKMNLKNSPPFILDILPDTYQRLRLIYSKNEDQMHLLHANEHFNVFINNLMRKCKQAIKLFKEGKEKMFDENSHYRRNLTKLSLVFSHMLSELKAIFPNGVFAGDQFRITKADAADFWKSNFGN-STLVPWKIFRQELNKVHPIISGLEAMALKTTIDLTCNDFISNFEFDVFTRLFQPWVTLLRNWQILAVTHPGYVAFLTYDEVKARLQ--RYILKAGSYVFRLSCTRLGQWAIGYVTAEGEILQTIPQNKSLCQALLDGHREGFYLYPDGQAY-NPDLSSAVQSPTEDHITVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGTEQIVVDAFDPRKQHNRN 432          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Fly
Match: Cbl (gene:FBgn0020224 transcript:FBtr0076615)

HSP 1 Score: 320.472 bits (820), Expect = 5.180e-96
Identity = 160/395 (40.51%), Postives = 247/395 (62.53%), Query Frame = 2
Query:  188 KDFHYVLSLIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQN-IIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQN 1366
            K       L++K  K      +N K +PP++  IL +   ++  I    E++++ L     F V I  L+++CK+ +++ +      FDE S  R+ L  +S++ SH+   + A+FPN  +A + FRITK+DAAD+W S FG  +T+V W  F    +K++ I    +  AL+ TI++T N F+S F+FDVF RLFQPW  +L +W+++ + HPG ++++TY++V   L+ +    G  SYVFR SCT+ GQWAIGY+   G+I QTI  NKSL  AL +G + G Y YP+G+ Y N  L + V SP ++ I V+ E++E Y  + S+F+LCKIC++N+K+I++EPCGHLLC  CL+ WQ     Q CPFCR EIKG E+I +  +D + ++ +N
Sbjct:   42 KTLEKTWKLMDKVVKLCQQPKMNLKNSPPFILDILPDTYQRLRLIYSKNEDQMHLLHANEHFNVFINNLMRKCKQAIKLFKEGKEKMFDENSHYRRNLTKLSLVFSHMLSELKAIFPNGVFAGDQFRITKADAADFWKSNFGN-STLVPWKIFRQELNKVHPIISGLEAMALKTTIDLTCNDFISNFEFDVFTRLFQPWVTLLRNWQILAVTHPGYVAFLTYDEVKARLQRYILKAG--SYVFRLSCTRLGQWAIGYVTAEGEILQTIPQNKSLCQALLDGHREGFYLYPDGQAY-NPDLSSAVQSPTEDHITVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGTEQIVVDAFDPRKQHNRN 432          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Fly
Match: CG32847 (gene:FBgn0052847 transcript:FBtr0075639)

HSP 1 Score: 48.521 bits (114), Expect = 3.547e-6
Identity = 29/98 (29.59%), Postives = 44/98 (44.90%), Query Frame = 2
Query: 1157 DSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQS-CPFCRLEIKGIEKISLIPYDSKNENTQNKSIDCPLVPPRQMSFLQKQVSDEKCSL 1447
            D SF  C IC    +N  +  CGHL C  CL +W  +    + CP C+    G+++  +IP  ++N+  Q    D    PPR         +D +  L
Sbjct:   12 DESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCK---SGVDRSKVIPVYARNDKRQEDPRD--KTPPRPTGIWSDYANDLELGL 104          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Zebrafish
Match: cbl (Cbl proto-oncogene, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-041114-207])

HSP 1 Score: 323.939 bits (829), Expect = 6.932e-97
Identity = 157/390 (40.26%), Postives = 241/390 (61.79%), Query Frame = 2
Query:  215 IEKCQKYIG-------NSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENT 1360
            +EKC K++        N  +  K +PPY+  +L +    +  IL  YE K+  L    +FRV +  L K+ K+ + + +      F+E S+PR+ L  +S++ SH+   + A+FPN  +  + FRITK+DAA++W   FG   T+V W  F     + + IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW+++L +W  + + HPG M+++TY++V   L+ F   PG  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y +P+G+  +         SP  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D K+ N+
Sbjct:   40 VEKCWKFMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGDNEYFRVFMENLTKKTKQTISLFKDGKERMFEENSQPRRNLTKLSLIFSHMLAELKAIFPNGLFQGDNFRITKADAAEFWRRSFGD-KTIVPWKVFRQALHEFHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPG--SYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRTQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQES-EGQGCPFCRCEIKGTEPIVVDPFDPKDPNS 425          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Zebrafish
Match: cblb (Cbl proto-oncogene B, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-030616-417])

HSP 1 Score: 317.775 bits (813), Expect = 1.837e-94
Identity = 155/387 (40.05%), Postives = 242/387 (62.53%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYE--NKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQ 1363
            L++K  +   N  +  K +PPY+  IL +    +  IL  YE   +L +LS+ ++F+V I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FP   +  + FRITK+DAA++W   FG   T+V W  F      ++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +     PGSY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y +P+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ S   Q CPFCR EIKG E I + P+D +NE  +
Sbjct:   47 LMDKVVRLCQNPRLQLKNSPPYILDILPDTYQHLRLILCKYEENQRLTQLSENDYFKVYIDSLMKKSKRAIRLFKEAKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPGGQFQGDTFRITKADAAEFWRRSFGE-KTIVPWKMFRQCLHDVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKY--INKPGSYIFRLSCTRLGQWAIGYVTSDGNILQTIPHNKPLFQALIDGCREGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQDS-DGQGCPFCRCEIKGTEPIIVDPFDPRNEGAK 429          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Zebrafish
Match: cblb (Cbl proto-oncogene B, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-030616-417])

HSP 1 Score: 317.39 bits (812), Expect = 1.992e-94
Identity = 155/387 (40.05%), Postives = 242/387 (62.53%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYE--NKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQ 1363
            L++K  +   N  +  K +PPY+  IL +    +  IL  YE   +L +LS+ ++F+V I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FP   +  + FRITK+DAA++W   FG   T+V W  F      ++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +     PGSY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y +P+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ S   Q CPFCR EIKG E I + P+D +NE  +
Sbjct:   47 LMDKVVRLCQNPRLQLKNSPPYILDILPDTYQHLRLILCKYEENQRLTQLSENDYFKVYIDSLMKKSKRAIRLFKEAKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPGGQFQGDTFRITKADAAEFWRRSFGE-KTIVPWKMFRQCLHDVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKY--INKPGSYIFRLSCTRLGQWAIGYVTSDGNILQTIPHNKPLFQALIDGCREGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQDS-DGQGCPFCRCEIKGTEPIIVDPFDPRNEGAK 429          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Zebrafish
Match: cblb (Cbl proto-oncogene B, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-030616-417])

HSP 1 Score: 317.775 bits (813), Expect = 2.027e-94
Identity = 155/387 (40.05%), Postives = 242/387 (62.53%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYE--NKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQ 1363
            L++K  +   N  +  K +PPY+  IL +    +  IL  YE   +L +LS+ ++F+V I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FP   +  + FRITK+DAA++W   FG   T+V W  F      ++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +     PGSY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y +P+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ S   Q CPFCR EIKG E I + P+D +NE  +
Sbjct:   47 LMDKVVRLCQNPRLQLKNSPPYILDILPDTYQHLRLILCKYEENQRLTQLSENDYFKVYIDSLMKKSKRAIRLFKEAKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPGGQFQGDTFRITKADAAEFWRRSFGE-KTIVPWKMFRQCLHDVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKY--INKPGSYIFRLSCTRLGQWAIGYVTSDGNILQTIPHNKPLFQALIDGCREGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQDS-DGQGCPFCRCEIKGTEPIIVDPFDPRNEGAK 429          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Zebrafish
Match: cblc (Cbl proto-oncogene C, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-080220-20])

HSP 1 Score: 273.478 bits (698), Expect = 3.829e-82
Identity = 137/385 (35.58%), Postives = 227/385 (58.96%), Query Frame = 2
Query:  203 VLSLIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKIN---FFRVSIWTLI-KQCKEILRVIRRVNFSFDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQ--NIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPY 1339
            VL  ++K  K   +  +  K +PPYLP +L   +  + ++   Y      + + +   + R+ I  L+ K  + +L         F+E S  R+ L  +S+L SH+ + +  +FP   +  + +R+TK++A ++W   FG    +V+WN F     +++Y  E  +  AL+ T+++T N  +SIF+FD+F RLFQPW+ ++ +W  + + HPG M+++TY+QV   L+ +R    PGSY+FR SCT+ GQWAIG++   G I QTI  N  L  AL +G + G Y YP+G+  +     + + SP+    + V+ E++E Y  I S+F+LCKIC++ +K+ +++PCGHLLC  CL+ WQKS    +CP+CR +I+G E I + PY
Sbjct:   38 VLKRLDKLHKLSVDPRLALKNSPPYLPELLSETAIHLTEVWAPYRGSAMAVPRWDEGDYMRIHIRHLLDKTDRAVLLFKEGKEKMFEETSNYRRNLTKLSLLFSHMLNELRTIFPGGRFQGDTYRVTKTEAKEFWRKTFGH-KCIVQWNVFKQQLKRVHYFEEGMEAMALKSTVDLTCNDHISIFEFDIFTRLFQPWSTLIRNWNHLAVTHPGYMAFLTYDQVKARLEHYRHR--PGSYIFRLSCTQMGQWAIGHVTSDGSIVQTIPQNTPLYQALIQGFREGCYLYPDGRDVNPDL--SSLCSPVHKGRVKVTEEQYELYCEIGSTFQLCKICTERDKDTRIQPCGHLLCQPCLTGWQKS-DGHTCPYCRCDIRGTESILIEPY 416          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Xenopus
Match: cblb (Cbl proto-oncogene B, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:448509])

HSP 1 Score: 319.701 bits (818), Expect = 1.071e-96
Identity = 155/385 (40.26%), Postives = 245/385 (63.64%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNEN 1357
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FP+  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +     PGSY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++EN
Sbjct:   63 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQERRNLTKLSLIFSHMLAEIKAIFPSGQFQGDNFRITKADAAEFWRKFFGE-RTIVPWKIFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWTSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYST--KPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTDLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQES-DGQGCPFCRCEIKGTEPIVVDPFDPRDEN 443          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Xenopus
Match: cblb (Cbl proto-oncogene B, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:448509])

HSP 1 Score: 320.472 bits (820), Expect = 1.137e-95
Identity = 155/385 (40.26%), Postives = 245/385 (63.64%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNEN 1357
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FP+  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +     PGSY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++EN
Sbjct:   63 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQERRNLTKLSLIFSHMLAEIKAIFPSGQFQGDNFRITKADAAEFWRKFFGE-RTIVPWKIFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWTSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYST--KPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTDLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQES-DGQGCPFCRCEIKGTEPIVVDPFDPRDEN 443          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Xenopus
Match: cblb (Cbl proto-oncogene B, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:448509])

HSP 1 Score: 320.087 bits (819), Expect = 1.785e-95
Identity = 155/385 (40.26%), Postives = 245/385 (63.64%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNEN 1357
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FP+  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +     PGSY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++EN
Sbjct:   63 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQERRNLTKLSLIFSHMLAEIKAIFPSGQFQGDNFRITKADAAEFWRKFFGE-RTIVPWKIFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWTSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYST--KPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTDLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQES-DGQGCPFCRCEIKGTEPIVVDPFDPRDEN 443          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Xenopus
Match: cblb (Cbl proto-oncogene B, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:448509])

HSP 1 Score: 320.087 bits (819), Expect = 3.091e-95
Identity = 155/385 (40.26%), Postives = 245/385 (63.64%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNEN 1357
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FP+  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +     PGSY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++EN
Sbjct:   63 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQERRNLTKLSLIFSHMLAEIKAIFPSGQFQGDNFRITKADAAEFWRKFFGE-RTIVPWKIFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWTSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYST--KPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTDLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQES-DGQGCPFCRCEIKGTEPIVVDPFDPRDEN 443          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Xenopus
Match: cblb (Cbl proto-oncogene B, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:448509])

HSP 1 Score: 320.087 bits (819), Expect = 3.841e-95
Identity = 155/385 (40.26%), Postives = 245/385 (63.64%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNEN 1357
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FP+  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +     PGSY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++EN
Sbjct:   63 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQERRNLTKLSLIFSHMLAEIKAIFPSGQFQGDNFRITKADAAEFWRKFFGE-RTIVPWKIFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWTSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYST--KPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTDLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQES-DGQGCPFCRCEIKGTEPIVVDPFDPRDEN 443          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Mouse
Match: Cblb (Casitas B-lineage lymphoma b [Source:MGI Symbol;Acc:MGI:2146430])

HSP 1 Score: 320.857 bits (821), Expect = 1.380e-95
Identity = 159/398 (39.95%), Postives = 250/398 (62.81%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSIDCPLVPP 1396
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FPN  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +   PG  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++E ++  SI  P   P
Sbjct:   52 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGD-KTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPG--SYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQES-DGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCCSIIDPFSIP 445          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Mouse
Match: Cblb (Casitas B-lineage lymphoma b [Source:MGI Symbol;Acc:MGI:2146430])

HSP 1 Score: 320.857 bits (821), Expect = 1.380e-95
Identity = 159/398 (39.95%), Postives = 250/398 (62.81%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSIDCPLVPP 1396
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FPN  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +   PG  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++E ++  SI  P   P
Sbjct:   52 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGD-KTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPG--SYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQES-DGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCCSIIDPFSIP 445          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Mouse
Match: Cblb (Casitas B-lineage lymphoma b [Source:MGI Symbol;Acc:MGI:2146430])

HSP 1 Score: 321.627 bits (823), Expect = 1.875e-95
Identity = 159/398 (39.95%), Postives = 250/398 (62.81%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSIDCPLVPP 1396
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FPN  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +   PG  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++E ++  SI  P   P
Sbjct:   52 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGD-KTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPG--SYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQES-DGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCCSIIDPFSIP 445          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Mouse
Match: Cblb (Casitas B-lineage lymphoma b [Source:MGI Symbol;Acc:MGI:2146430])

HSP 1 Score: 321.627 bits (823), Expect = 1.875e-95
Identity = 159/398 (39.95%), Postives = 250/398 (62.81%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSIDCPLVPP 1396
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FPN  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +   PG  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++E ++  SI  P   P
Sbjct:   52 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGD-KTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPG--SYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQES-DGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCCSIIDPFSIP 445          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Mouse
Match: Cbl (Casitas B-lineage lymphoma [Source:MGI Symbol;Acc:MGI:88279])

HSP 1 Score: 318.161 bits (814), Expect = 4.516e-95
Identity = 150/391 (38.36%), Postives = 241/391 (61.64%), Query Frame = 2
Query:  212 LIEKCQKYIG-------NSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENT 1360
            ++EKC K +        N  +  K +PPY+  +L +    +  +L  YE K+  L +  +FRV +  L+K+ K+ + + +      ++E S+PR+ L  +S++ SH+   +  +FP+  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW+++L +W  + + HPG M+++TY++V   L+ F     PGSY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y +P+G+  +         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D +   +
Sbjct:   53 MVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTVLSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGE-KTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKF--IHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQES-EGQGCPFCRCEIKGTEPIVVDPFDPRGSGS 439          
BLAST of E3 ubiquitin-protein ligase CBL vs. UniProt/SwissProt
Match: sp|Q6GQL0|CBLBA_XENLA (E3 ubiquitin-protein ligase CBL-B-A OS=Xenopus laevis OX=8355 GN=cblb-a PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 7.207e-95
Identity = 155/385 (40.26%), Postives = 246/385 (63.90%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNEN 1357
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +LIK+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FP+  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +   PG  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG+E I + P+D ++E+
Sbjct:   63 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLIKKSKRAMRLFKEGKERMYEEQSQERRNLTKLSLIFSHMLAEIKAIFPSGQFQGDNFRITKADAAEFWRKFFGE-RTIVPWKIFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSLKPG--SYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQES-DGQGCPFCRCEIKGMEPIIVDPFDPRDES 443          
BLAST of E3 ubiquitin-protein ligase CBL vs. UniProt/SwissProt
Match: sp|Q8K4S7|CBLB_RAT (E3 ubiquitin-protein ligase CBL-B OS=Rattus norvegicus OX=10116 GN=Cblb PE=1 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 1.016e-94
Identity = 157/391 (40.15%), Postives = 248/391 (63.43%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSI 1375
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FPN  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +   PG  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++E ++  SI
Sbjct:   52 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGD-KTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPG--SYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQES-DGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCCSI 438          
BLAST of E3 ubiquitin-protein ligase CBL vs. UniProt/SwissProt
Match: sp|Q3TTA7|CBLB_MOUSE (E3 ubiquitin-protein ligase CBL-B OS=Mus musculus OX=10090 GN=Cblb PE=1 SV=3)

HSP 1 Score: 321.627 bits (823), Expect = 1.311e-94
Identity = 159/398 (39.95%), Postives = 250/398 (62.81%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSIDCPLVPP 1396
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FPN  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +   PG  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++E ++  SI  P   P
Sbjct:   52 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGD-KTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPG--SYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQES-DGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCCSIIDPFSIP 445          
BLAST of E3 ubiquitin-protein ligase CBL vs. UniProt/SwissProt
Match: sp|Q6NRE7|CBLBB_XENLA (E3 ubiquitin-protein ligase CBL-B-B OS=Xenopus laevis OX=8355 GN=cblb-b PE=2 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 1.320e-94
Identity = 154/385 (40.00%), Postives = 244/385 (63.38%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNEN 1357
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FP+  +  + FRITK+DAA++W   FG   T+V W  F     ++  IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW++IL +W  + + HPG M+++TY++V   L+ +    G  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++EN
Sbjct:   65 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQERRNLTKLSLIFSHMLAEIKAIFPSGQFQGDTFRITKADAAEFWRKFFGE-RTIVPWKIFRQCLHEVQQISSGLEAMALKSTIDLTCNDYISVFEFDIFARLFQPWSSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSLKHG--SYIFRLSCTRLGQWAIGYVTAGGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTDLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQES-DGQGCPFCRCEIKGTEPIIVDPFDPRDEN 445          
BLAST of E3 ubiquitin-protein ligase CBL vs. UniProt/SwissProt
Match: sp|Q6DFR2|CBLB_XENTR (E3 ubiquitin-protein ligase CBL-B OS=Xenopus tropicalis OX=8364 GN=cblb PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 2.366e-94
Identity = 155/385 (40.26%), Postives = 245/385 (63.64%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYEN--KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNEN 1357
            L++K  +   N  +  K +PPY+  IL +    +  IL  Y++  KL +LS+  +F++ I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FP+  +  + FRITK+DAA++W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +   PG  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y YP+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D ++EN
Sbjct:   63 LMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQERRNLTKLSLIFSHMLAEIKAIFPSGQFQGDNFRITKADAAEFWRKFFGE-RTIVPWKIFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWTSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPG--SYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTDLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQES-DGQGCPFCRCEIKGTEPIVVDPFDPRDEN 443          
BLAST of E3 ubiquitin-protein ligase CBL vs. TrEMBL
Match: A0A0R3W623 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5614 PE=4 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 8.342e-112
Identity = 182/387 (47.03%), Postives = 260/387 (67.18%), Query Frame = 2
Query:  215 IEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRV-NFSFDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDF----FHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQ-NIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNEN 1357
            +EK      +  +  + +PPYL  IL + + K+ +I+  Y+  L+EL K  +F+V ++ L ++C+   ++ +   +  +D+ SEPR+KL   S++LSH+   + ALFPN+ YAPEAFRITK +AADWW   FG  +++V+W  F    F  F ++    E S+   L+ TI++T N  VS+F+FDVFVRLFQPW N+L++W+ + + H G M+++TY++V  +LK FR +PGPGSYV+R SCTK GQWAIGYI  + +I QTI+ NKSLA AL +GE+ G Y YPNG    +S L  LVS+    +I VS E+H+ YS I S+FE+CKIC++NNKNI+LEPCGHLLC  CL   Q +   Q+CPFCRLE+K  E+I L P+   NE 
Sbjct:   61 LEKLTDLCRDPRVMLRNSPPYLLDILPDIADKLKNIMYAYQGCLDELFKSLYFQVFLYNLSEKCELTSKLFKEAKDKMYDDHSEPRRKLTKYSLILSHILKDLEALFPNNKYAPEAFRITKREAADWWRENFGE-SSIVRWEMFRTRLFATFGEL----EHSEARELQNTIDLTCNYHVSVFEFDVFVRLFQPWTNVLQTWRALTIMHAGYMAFMTYDEVKAVLKKFRSHPGPGSYVYRLSCTKLGQWAIGYITENLRILQTIIQNKSLAQALLDGERDGFYLYPNGTPSQSSILTPLVSNITHTHIQVSEEQHQLYSRIGSTFEVCKICTENNKNIRLEPCGHLLCKVCLLNCQNATSSQTCPFCRLEVKSTEEIILDPFVPPNEG 442          
BLAST of E3 ubiquitin-protein ligase CBL vs. TrEMBL
Match: A0A3P7NGE8 (Uncharacterized protein (Fragment) OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS16965 PE=4 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 1.753e-110
Identity = 185/414 (44.69%), Postives = 265/414 (64.01%), Query Frame = 2
Query:  140 IKSRSSNWFSNNVLISKD---FHYVLSLIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRV-NFSFDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSS-PLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQN 1366
            + S SS   +  VL+  D      V   +EK  +   +  +  + +PPYL  IL +   K+  I+  Y + L+EL    +F+V +  LI +CK   ++ +      +DE SE R+KL   S++ SH+   + AL+PN+ ++PE FRITK +AA+WW S F   + +V W  F    S+  +I   S+  AL+ TI++T N +VS+F+FDVFVRLFQPWNN++E+WK + + H G M+++TY++V  +LK FR +PGPGSYV+R SCTK GQWAIGYI    +I QTI+ NKSLA AL +GE+ G Y YPNG    +S L +LV + P  ++ VS E+++ Y  + S+FELCKIC++NNKN++LEPCGHLLC  CL   Q S   Q+CPFCRLEIK IE+I L PY    + T++
Sbjct:   16 VPSASSTSANRLVLLRPDKKVIDEVYKRLEKLVRLCQHPRLQLRNSPPYLLEILPDMYEKLKAIITAYSSTLDELFNTLYFQVFLNNLINKCKSTSKLFKEAKELMYDEQSEYRRKLTKNSLVFSHILKDLEALYPNNHFSPENFRITKKEAAEWWRSHFD-YSPIVPWQLFQAALSESFHIDCRSEFRALQNTIDLTCNDYVSVFEFDVFVRLFQPWNNVIETWKALAILHAGYMAFMTYDEVKAVLKRFRHHPGPGSYVYRLSCTKLGQWAIGYITQDRRILQTIIQNKSLAQALIDGEREGFYLYPNGTPSQSSILSSLVENLPQTHLRVSQEQYQLYCKMGSTFELCKICTENNKNVQLEPCGHLLCKSCLISCQGSGTGQTCPFCRLEIKSIEEIILDPYLPDEDATES 428          
BLAST of E3 ubiquitin-protein ligase CBL vs. TrEMBL
Match: A0A068Y1R3 (E3 ubiquitin protein ligase CBL OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000424900 PE=4 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 1.853e-110
Identity = 205/567 (36.16%), Postives = 317/567 (55.91%), Query Frame = 2
Query:  215 IEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRV-NFSFDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQ-NIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPY-DSKNENTQNKSIDCPLVPPRQMSFLQKQVSDEKCSLSNDNGNKVNYAQLDWVSGNDSGSLINSYETENIEFTSKTNDTKPDSSFIISEIQSAPTSSQN--------------KCPNDNSTNYESCSSHYLNLRNSNFSDNHNTLMHITN-----------NSEAMKKLLKITGNDVTMSKEILKHFSPR 1831
            +EK      +  +  + +PPYL  IL + + K+  I+  Y+ +L+EL K  +F+V ++ L ++C+   ++ +   +  +D+ SEPR+ L   S++LSH+   + ALFPN+ YAPEAFRITK +AA+WW+  FG  +++V W  F         + + ++   L+ TI++T N +VS+F+FDVFVRLFQPW N+LE+WK + + H G M+++TY++V  +LK FR +PGPGSYV+R SCTK GQWAIGYI  + +I QTI+ NKSLA AL +GE+ G Y YPNG    +S L  LV +     I VS E+H+ YS + S+FE+CKIC++NNKNI+LEPCGHLLC  CL   Q +   Q+CPFCRLE+K  E+I L P+  S +E+     I  P V        +K+ +D++  +  +  NK +                   E + +  T  +  T  D+ F  S ++S     +N                   N+  + +  S  LN      + +  T M  ++            +E  ++LL+I   +  ++  + +HF PR
Sbjct:   61 LEKLINLCRDPRVMLRNSPPYLLDILPDITDKLKHIMYAYQGRLDELFKSPYFQVFLYNLNEKCERTSQLFKEEKDKMYDDHSEPRRTLTRYSLILSHILKDLEALFPNNKYAPEAFRITKREAAEWWHENFGE-SSIVSWEVFRTRLFATFGVLDCNETRELQNTIDLTCNNYVSVFEFDVFVRLFQPWTNVLETWKALTIMHAGYMAFMTYDEVKAVLKKFRSHPGPGSYVYRLSCTKLGQWAIGYITDNLRILQTIIQNKSLAQALLDGERDGFYLYPNGTPSQSSILTPLVRNITHARIQVSEEQHQLYSRMGSTFEVCKICTENNKNIRLEPCGHLLCKVCLINCQNATSGQTCPFCRLEVKSTEEIILDPFIPSNDEDVIGHHI--PEVTVEVEEEEEKEENDDEAVIEREEVNKTD-------------PRFQDKEIDAVPSTRPSASTSTDAMFCSSSVESTSDGEENVVNSSRRQRNSSSCSLRGTNAEVHIAGGSSCLNEAAQAVAFDTTTFMRRSDIAGVVLEGPPLTTEIARRLLEICEGNADIAARVWRHFMPR 611          
BLAST of E3 ubiquitin-protein ligase CBL vs. TrEMBL
Match: A0A0R3SR78 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7647 PE=4 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 2.172e-110
Identity = 184/394 (46.70%), Postives = 261/394 (66.24%), Query Frame = 2
Query:  191 DFHYVLSLIEKCQKYIG---NSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDF-FHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQ-NIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNE 1354
            D   + S+I +  K I    +  +  + +PPYL  IL + + K+ +I+  Y+  L+EL +  +F+V ++ L ++C+ I ++ +      +D+ SEPR KL   S++LSH+   + ALFPN+ YAPEAFRITK +AADWW   FG  + +V W  F    F+    +   S+   L+ TI++T N +VSIF+FDVFVRLFQPW N+LE+W+ + + H G M+++TY++V  +LK FR +PGPGSYV+R SCTK GQWAIGYI  + +I QTI+ NKSLA AL +GEQ G Y YPNG    +S L  LV +  Q +I VS E+++ YS I S+FE+CKIC++NNKNI+LEPCGHLLC  CL   Q +   Q+CPFCRLE+K  E++ L P+  K E
Sbjct:   50 DKKTIDSVIRRLDKLINLCRDPRVVLRNSPPYLLDILPDIAEKLRNIMFAYQGSLDELFRSVYFQVFLFNLNEKCELISKLFKEAKEKMYDDHSEPRIKLTKYSLVLSHILKDLEALFPNNRYAPEAFRITKREAADWWKQNFGE-SAIVAWELFRTRLFATFGTLDR-SESRELQSTIDLTCNYYVSIFEFDVFVRLFQPWTNVLETWRALTIMHAGYMAFMTYDEVKAVLKKFRGHPGPGSYVYRLSCTKLGQWAIGYITENFRILQTIIQNKSLAQALLDGEQDGFYLYPNGTPSQSSILTPLVRNITQTHIQVSEEQYQLYSRIGSTFEVCKICTENNKNIRLEPCGHLLCKTCLVNCQNTGNGQTCPFCRLEVKSTEEVVLDPFIPKGE 441          
BLAST of E3 ubiquitin-protein ligase CBL vs. TrEMBL
Match: A0A183SZA1 (E3 ubiquitin-protein ligase CBL OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS9549 PE=4 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 2.799e-110
Identity = 186/405 (45.93%), Postives = 261/405 (64.44%), Query Frame = 2
Query:  140 IKSRSSNWFSNNVLISKD---FHYVLSLIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRV-NFSFDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSS-PLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPY 1339
            I S SS   S  VL+  D      V   +EK  +   +  +  + +PPYL  IL +   K+  I+  Y + L+EL    +F+V +  LI +CK   ++ +      +DE SE R+KL   S++ SH+   + AL+PN+ ++PE FRITK +AADWW S F   + ++ W  F    S+  +I   S++ AL+ TI++T N  VS+F+FDVFVRLFQPWNN++E+WK + + H G M+++TY++V  +LK FR +PGPGSYV+R SCTK GQWAIGYI    +I QTI+ NKSLA AL +GE+ G Y YPNG    +S L +LV + P  ++ VS E+++ Y  + S+FELCKIC++NNKN++LEPCGHLLC  CL   Q S   Q+CPFCRLEIK IE+I L PY
Sbjct:   16 IPSASSTSASRLVLLRADKKVIDEVYKRLEKLVRLCQHPRLQLRNSPPYLLEILPDMYEKLKGIITAYNSTLDELFNTLYFQVFLNNLINKCKSTSKLFKEAKELMYDEHSEYRRKLTKNSLVFSHILKDLEALYPNNRFSPETFRITKKEAADWWRSHFD-YSPIIPWQLFQAALSESFHIDCRSELRALQSTIDLTCNDHVSVFEFDVFVRLFQPWNNVIETWKALAILHAGYMAFMTYDEVKAVLKRFRHHPGPGSYVYRLSCTKLGQWAIGYITQDRRILQTIIQNKSLAQALIDGEREGFYLYPNGTPSQSSILSSLVENLPQTHLRVSQEQYQLYCKMGSTFELCKICTENNKNVQLEPCGHLLCKSCLISCQGSGTGQTCPFCRLEIKSIEEIILDPY 419          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Cavefish
Match: cbl (Cbl proto-oncogene [Source:NCBI gene;Acc:103032411])

HSP 1 Score: 318.546 bits (815), Expect = 1.266e-95
Identity = 152/381 (39.90%), Postives = 239/381 (62.73%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKN 1351
            L++K  +   N  +  K +PPY+  +L +    +  IL  YE K+  L    +FRV +  L+K+ K+ + + +      ++E S+PR+ L  +S++ SH+   + A+FP+  +  + FRITK+DAA++W   FG   T+V+W  F     + + IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW+++L +W  + + HPG M+++TY++V   L+ F     PGSY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y +P+G+  +         SP  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D K+
Sbjct:   46 LMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGDNEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKAIFPSGLFQGDNFRITKADAAEFWRKSFGD-KTIVQWKIFRQALHEFHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKF--IHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRTQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQES-EGQGCPFCRCEIKGTEPIVVDPFDPKD 422          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Cavefish
Match: cbl (Cbl proto-oncogene [Source:NCBI gene;Acc:103032411])

HSP 1 Score: 319.701 bits (818), Expect = 2.072e-95
Identity = 152/381 (39.90%), Postives = 239/381 (62.73%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKN 1351
            L++K  +   N  +  K +PPY+  +L +    +  IL  YE K+  L    +FRV +  L+K+ K+ + + +      ++E S+PR+ L  +S++ SH+   + A+FP+  +  + FRITK+DAA++W   FG   T+V+W  F     + + IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW+++L +W  + + HPG M+++TY++V   L+ F   PG  SY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y +P+G+  +         SP  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+D K+
Sbjct:   46 LMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGDNEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKAIFPSGLFQGDNFRITKADAAEFWRKSFGD-KTIVQWKIFRQALHEFHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPG--SYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRTQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQES-EGQGCPFCRCEIKGTEPIVVDPFDPKD 422          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Cavefish
Match: cblb (Cbl proto-oncogene B [Source:NCBI gene;Acc:103034711])

HSP 1 Score: 315.464 bits (807), Expect = 1.555e-93
Identity = 156/387 (40.31%), Postives = 249/387 (64.34%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRN-FSHKIMDILKCYEN-KLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQ 1363
            L++K  +   N  +  K +PPY+  IL + + H  M + K  EN KL +LS+ ++F+V I +L+K+ K  +R+ +      ++E S+ R+ L  +S++ SH+   + A+FP+  +  + FRITK+DAA++W  +F +  T+V W  F     +++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V   L+ +     PGSY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y +P+G+ Y+         +P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG E+I + P+D +NE  +
Sbjct:   52 LMDKVVRLCQNPRLQLKNSPPYILDILPDTYQHLRMILCKYEENQKLVQLSENDYFKVYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPDGQFQGDTFRITKADAAEFWR-RFFSEKTIVPWKVFRQCLHEMHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKY--INKPGSYIFRLSCTRLGQWAIGYVTSDGNILQTIPHNKPLFQALIDGCREGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQES-DGQGCPFCRCEIKGTERIIVDPFDPRNEGAK 434          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Cavefish
Match: cblc (E3 ubiquitin-protein ligase CBL-like [Source:NCBI gene;Acc:103042889])

HSP 1 Score: 271.166 bits (692), Expect = 1.510e-80
Identity = 133/371 (35.85%), Postives = 223/371 (60.11%), Query Frame = 2
Query:  242 NSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSK---INFFRVSIWTLI-KQCKEILRVIRRVNFSFDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNII-VSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPY 1339
            +S +  K +PPYLP ++      + ++   Y      + +    +F ++ +  L+ K  + IL      +  F+E S  R+ L  +S+L SH+   + A+FP+  +  + +++TK++A ++W   FG    +V+W+ F H   +++   E  +  AL+ T+++T N  +S+F+FD+F RLFQPW+ +L +W  + + HPG M+++TY+QV   L+  R  PG  SY+FR SCT+ GQWA+G++   G I QTI  N  L  AL +G + G Y YP+G+   N  L +L  +P +  + V+ E++E Y  I S+F+LCKIC++ +K+ +++PCGHLLC  CL+ WQKS    +CP+CR +I+G E I + PY
Sbjct:   50 DSRLGLKNSPPYLPDLVSETVILLTEVWDPYRGPAPAVPRGDEADFLKIHVRHLLDKTNRAILLFKEGKDKMFEERSSYRRNLTKLSLLFSHMLWELRAMFPDGRFQGDIYKLTKTEAQEFWKKTFG-YRCIVQWSQFKHQLKRVHGFEEGMEAMALKSTVDLTCNDHISVFEFDIFTRLFQPWSTLLRNWNQLAVTHPGYMAFLTYDQVRARLEHHRHRPG--SYIFRLSCTRMGQWAVGHVTFDGSIVQTIPENTPLFQALIQGFREGCYLYPDGRDV-NPDLTSLCMAPQKGRVKVTEEQYELYCEIGSTFQLCKICTERDKDTRIQPCGHLLCRPCLTGWQKS-DGHTCPYCRCDIRGTESILVEPY 415          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Cavefish
Match: cblc (E3 ubiquitin-protein ligase CBL-like [Source:NCBI gene;Acc:103042889])

HSP 1 Score: 271.166 bits (692), Expect = 1.510e-80
Identity = 133/371 (35.85%), Postives = 223/371 (60.11%), Query Frame = 2
Query:  242 NSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSK---INFFRVSIWTLI-KQCKEILRVIRRVNFSFDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNII-VSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPY 1339
            +S +  K +PPYLP ++      + ++   Y      + +    +F ++ +  L+ K  + IL      +  F+E S  R+ L  +S+L SH+   + A+FP+  +  + +++TK++A ++W   FG    +V+W+ F H   +++   E  +  AL+ T+++T N  +S+F+FD+F RLFQPW+ +L +W  + + HPG M+++TY+QV   L+  R  PG  SY+FR SCT+ GQWA+G++   G I QTI  N  L  AL +G + G Y YP+G+   N  L +L  +P +  + V+ E++E Y  I S+F+LCKIC++ +K+ +++PCGHLLC  CL+ WQKS    +CP+CR +I+G E I + PY
Sbjct:   50 DSRLGLKNSPPYLPDLVSETVILLTEVWDPYRGPAPAVPRGDEADFLKIHVRHLLDKTNRAILLFKEGKDKMFEERSSYRRNLTKLSLLFSHMLWELRAMFPDGRFQGDIYKLTKTEAQEFWKKTFG-YRCIVQWSQFKHQLKRVHGFEEGMEAMALKSTVDLTCNDHISVFEFDIFTRLFQPWSTLLRNWNQLAVTHPGYMAFLTYDQVRARLEHHRHRPG--SYIFRLSCTRMGQWAVGHVTFDGSIVQTIPENTPLFQALIQGFREGCYLYPDGRDV-NPDLTSLCMAPQKGRVKVTEEQYELYCEIGSTFQLCKICTERDKDTRIQPCGHLLCRPCLTGWQKS-DGHTCPYCRCDIRGTESILVEPY 415          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Sea Lamprey
Match: cblc (Cbl proto-oncogene C, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-080220-20])

HSP 1 Score: 168.318 bits (425), Expect = 4.478e-47
Identity = 83/235 (35.32%), Postives = 141/235 (60.00%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFSF-DEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVF 913
            L++K  +Y  N  +  K +PPY+  IL +    +  +L  +++++  L    FFRV I  L+ + K+ + + +       DE S  R+ L  +S++ SH+   + A+FPN  Y  ++FRITK+DAAD+W   FG   T+V W  F     +++ IS   +  AL+ TI++T N ++SIF+FD+F RLFQPW+++L +W V+ + HPG M+++TY++V   L+ +     PGSY++
Sbjct:   51 LMDKVVRYCQNPKVQLKNSPPYMLDILPDTYQHLRLVLARHDDRMAALGDNEFFRVFIDNLLSKSKQAVNLFKEGKERMHDEHSHCRRNLTKLSLIFSHMLTELKAVFPNGSYQGDSFRITKADAADFWRRAFGD-RTIVSWKAFRQCLHEVHPISSGLEAMALKSTIDLTCNDYISIFEFDIFTRLFQPWSSLLRNWNVLAVTHPGYMAFLTYDEVKARLQKY--ISKPGSYIY 282          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Medaka
Match: cblb (Cbl proto-oncogene B [Source:NCBI gene;Acc:101157475])

HSP 1 Score: 316.62 bits (810), Expect = 2.219e-94
Identity = 157/388 (40.46%), Postives = 241/388 (62.11%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYE--NKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQV-VQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQ 1363
            L++K  +   N  +  K +PPY+  IL +    +  IL  YE   +L +LS+  +F++ I  L+ + K  +R+ +      ++E S+ R+ L  +S++ SH+   + ALFP   +  + FRITK+DAAD+W + FG   TVV W  F      ++ IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW +IL +W  + + HPG M+++TY++V  +LLK       PGSY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y +P+G+ Y+          P  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S   Q CPFCR EIKG   I++ P+D +NE  +
Sbjct:   52 LMDKVVRLCQNPRLQLKNSPPYILDILPDAYQHLRLILGKYEENQRLTQLSENEYFKIYIDGLMNKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKALFPGGQFQGDTFRITKADAADFWRTYFGE-KTVVPWRVFRQCLHDVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLLKFIN---KPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGFREGFYLFPDGRSYNPDLTDLCDPLPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTLCLTAWQES-DGQGCPFCRCEIKGTAPITVDPFDPRNEGAK 434          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Medaka
Match: cbl (Cbl proto-oncogene [Source:NCBI gene;Acc:101170289])

HSP 1 Score: 317.005 bits (811), Expect = 3.821e-94
Identity = 151/382 (39.53%), Postives = 237/382 (62.04%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKS-FRCQSCPFCRLEIKGIEKISLIPYDSKN 1351
            L++K  +   N  +  K +PPY+  +L +    +  IL  Y+ K+  L    +FRV +  L K+ K+ + + +      ++E S+PR+ L  +S++ SH+   + A+FPN  +  + FRITK+DAA++W   FG   T+V W  F     + + IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW+++L +W  + + HPG M+++TY++V   L+ F     PGSY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y +P+G+  +         SP  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPCGHL+C  CL+ WQ+S  +   CPFCR EIKG E I + P+D K+
Sbjct:   46 LMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYDGKMETLGDNEYFRVFVENLTKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKAIFPNGLFQGDNFRITKADAAEFWRRAFGD-KTIVPWKVFRQSLHEFHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKF--IHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRTQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESEGQGTGCPFCRCEIKGTEPIVVDPFDPKD 424          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Medaka
Match: ENSORLT00000018206.2 (E3 ubiquitin-protein ligase CBL [Source:NCBI gene;Acc:101163758])

HSP 1 Score: 312.768 bits (800), Expect = 2.403e-93
Identity = 151/380 (39.74%), Postives = 234/380 (61.58%), Query Frame = 2
Query:  212 LIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSK 1348
            L++K  +   N  +  K +PPY+  +L +    +  IL  YE K+  L +  +FRV I  L  + K+ + + +      ++E S+PR+ L  +S++ SH+   + A+FPN  +  + FRITK+DAA++W   FG   T+V W  F     + + IS   +  AL+ TI++T N ++S+F+FD+F RLFQPW+++L +W  + + HPG M+++TY++V   L+ F     PGSY+FR SCT+ GQWAIGY+   G I QTI HNK L  AL +G + G Y +P+G+  +         SP  +I V+ E++E Y  + S+F+LCKIC++N+K++K+EPC HL+C  CL+ WQ+S   Q CPFCR EIKG E I + P+  K
Sbjct:   45 LMDKVVRLCQNPKVALKNSPPYILDLLPDTYQHLRTILSRYEGKIEILGENEYFRVFIDNLTNKTKQTMSLFKEAKERMYEENSQPRRNLTKLSLIFSHMLAELKAIFPNGLFQGDNFRITKADAAEFWRRSFGD-KTIVPWRTFRQALHEFHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQRF--IHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGYREGFYLFPDGRAQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCRHLMCTSCLTAWQES-EGQGCPFCRCEIKGTEPIVVDPFHPK 420          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Medaka
Match: cblc (E3 ubiquitin-protein ligase CBL [Source:NCBI gene;Acc:101158476])

HSP 1 Score: 265.774 bits (678), Expect = 8.031e-79
Identity = 133/402 (33.08%), Postives = 229/402 (56.97%), Query Frame = 2
Query:  164 FSNNVLISKDFHYV---LSLIEKCQKYIGNSDINFKTNPPYLPCILR---NFSHKIMDILKCYENKLNELSK---INFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPY 1339
             S+   +SK+   V   L  +++      N  +  K +PPYLP ++R      H++ +    Y +   +  +     +  V +  L+ + ++ + + +      FDE S  R+ L  +S+L SH+   + A+FP   +  + +++TKS A ++W   FG    +V WN F      ++   E  +  AL+ TI++T N ++S+F+FD+F RLFQPW++++ +W  + + HPG M+++TY+QVV+ L+ +     PGSY+FR SCT+ GQWA+G++   G I QT+  +  L  AL +G + G Y YP+G+  +        ++  Q + V+ E++  Y  I S+FELCKIC++ +K+ +++PCGHLLC  CL  WQKS    +CP+CR +IKG E + + P+
Sbjct:   15 LSSQPPLSKERQMVDKSLKKLDRLHNLCTNPRLGLKNSPPYLPDLVRETLTLLHQVWEPYLGYSSAGGQFPRGDEATYLGVHVRNLLDKTEKAMLLFKDGREKIFDETSSCRRNLTKLSLLFSHMLWELKAMFPGGHFQGDTYKLTKSKAEEFWRRSFGN-KCIVPWNHFKQQLRTVHPFEERMEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLIRNWNHMAVTHPGYMAFLTYDQVVERLEHY--LHKPGSYIFRLSCTRMGQWAVGHVTAEGDIIQTLPGDTPLYQALIQGFKEGCYLYPDGRDVNPELTCLCETAQKQTVQVTEEQYGLYCEIGSTFELCKICAEKDKDTRIKPCGHLLCKSCLFGWQKSV-GNTCPYCRCDIKGTESVLIEPF 412          
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Medaka
Match: cblc (E3 ubiquitin-protein ligase CBL [Source:NCBI gene;Acc:101158476])

HSP 1 Score: 265.774 bits (678), Expect = 8.031e-79
Identity = 133/402 (33.08%), Postives = 229/402 (56.97%), Query Frame = 2
Query:  164 FSNNVLISKDFHYV---LSLIEKCQKYIGNSDINFKTNPPYLPCILR---NFSHKIMDILKCYENKLNELSK---INFFRVSIWTLIKQCKEILRVIRRVNFS-FDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPY 1339
             S+   +SK+   V   L  +++      N  +  K +PPYLP ++R      H++ +    Y +   +  +     +  V +  L+ + ++ + + +      FDE S  R+ L  +S+L SH+   + A+FP   +  + +++TKS A ++W   FG    +V WN F      ++   E  +  AL+ TI++T N ++S+F+FD+F RLFQPW++++ +W  + + HPG M+++TY+QVV+ L+ +     PGSY+FR SCT+ GQWA+G++   G I QT+  +  L  AL +G + G Y YP+G+  +        ++  Q + V+ E++  Y  I S+FELCKIC++ +K+ +++PCGHLLC  CL  WQKS    +CP+CR +IKG E + + P+
Sbjct:   15 LSSQPPLSKERQMVDKSLKKLDRLHNLCTNPRLGLKNSPPYLPDLVRETLTLLHQVWEPYLGYSSAGGQFPRGDEATYLGVHVRNLLDKTEKAMLLFKDGREKIFDETSSCRRNLTKLSLLFSHMLWELKAMFPGGHFQGDTYKLTKSKAEEFWRRSFGN-KCIVPWNHFKQQLRTVHPFEERMEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLIRNWNHMAVTHPGYMAFLTYDQVVERLEHY--LHKPGSYIFRLSCTRMGQWAVGHVTAEGDIIQTLPGDTPLYQALIQGFKEGCYLYPDGRDVNPELTCLCETAQKQTVQVTEEQYGLYCEIGSTFELCKICAEKDKDTRIKPCGHLLCKSCLFGWQKSV-GNTCPYCRCDIKGTESVLIEPF 412          
BLAST of E3 ubiquitin-protein ligase CBL vs. Planmine SMEST
Match: SMESG000072524.1 (SMESG000072524.1)

HSP 1 Score: 1227.62 bits (3175), Expect = 0.000e+0
Identity = 597/600 (99.50%), Postives = 599/600 (99.83%), Query Frame = 2
Query:   56 MLCRMFKRHKNKPKIGKEETDNFMIFKEIKSRSSNWFSNNVLISKDFHYVLSLIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFSFDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSIDCPLVPPRQMSFLQKQVSDEKCSLSNDNGNKVNYAQLDWVSGNDSGSLINSYETENIEFTSKTNDTKPDSSFIISEIQSAPTSSQNKCPNDNSTNYESCSSHYLNLRNSNFSDNHNTLMHITNNSEAMKKLLKITGNDVTMSKEILKHFSPRPVTICSNS 1855
            MLCRMFKRHKNKPKIGKEETDNFMIFKEIKSRSSNWFSNNVLISKDFHYVLSLIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCK+ILRVIRRVNFSFDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSIDCPLVPPRQMSFLQKQ+SDEKCSLSNDNGNKVNYAQLDWVSGNDSGSLINSYETENIE TSKTNDTKPDSSFIISEIQSAPTSSQNKCPNDNSTNYESCSSHYLNLRNSNFSDNHNTLMHITNNSEAMKKLLKITGNDVTMSKEILKHFSPRPVTICSNS
Sbjct:    1 MLCRMFKRHKNKPKIGKEETDNFMIFKEIKSRSSNWFSNNVLISKDFHYVLSLIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKDILRVIRRVNFSFDEFSEPRQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSIDCPLVPPRQMSFLQKQISDEKCSLSNDNGNKVNYAQLDWVSGNDSGSLINSYETENIESTSKTNDTKPDSSFIISEIQSAPTSSQNKCPNDNSTNYESCSSHYLNLRNSNFSDNHNTLMHITNNSEAMKKLLKITGNDVTMSKEILKHFSPRPVTICSNS 600          
BLAST of E3 ubiquitin-protein ligase CBL vs. Planmine SMEST
Match: SMESG000056433.1 (SMESG000056433.1)

HSP 1 Score: 350.132 bits (897), Expect = 1.081e-110
Identity = 201/535 (37.57%), Postives = 305/535 (57.01%), Query Frame = 2
Query:  242 NSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNELSKINFFRVSIWTLIKQCKEILRVIRRVNFSFDEFSEP-RQKLIDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSF------LHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSIDCPLVPPRQMSFLQKQVSDEKCSLSNDNGNKVNYAQLDWVSGNDSGSLINSYETENIEFTSKTNDTKPDSSFIISEIQSAPTSSQNKCPNDNSTNYESCSSHYLNLRNSNFSDNHNTLMHITN-NSEAMKKLLKITGNDVTMSKEILKHF 1822
            NS +N K +PP+L   + +    + +++  Y++K++EL  I +F+V + T+I Q + ++++ +       + S P R+KL  +S++ SH++      F    Y  E FRITK DAA+WW   F    T++ W +F+   S    ++++SQ  AL+ TIN+  N +V++++FDVFVRL+QPWNNILE+WK + + HPG MS++TY+ V  +L +F   PGPG+YVFR SCTK GQWAIGYI    +I QTI+ NKSLA AL +GE+ G YKYPNG I  N++      +HNL  + +Q   VS E+++ Y  +DS+FELCKICS+N+KNI+LEPC HLLC  CL  W+ S    +CPFCRLEIK +E I + PY+ K    +   +  P +PPR +       ++    L   +  ++NYA LD+                            PD         ++  +  N  P  + TN   C    ++ ++ +   N  TL+     + +  K +LKIT ND+  S+ ILK+F
Sbjct:   68 NSKLNLKNSPPFLIGTITDIQLLLNNVIFYYKDKIDELLGITYFKVMLLTIIDQSERLIKLFKDEKDRILQVSSPARKKLTKLSLIFSHVYKTFNEFFQKGFYCVENFRITKLDAANWWKVNFND-KTIISWKNFYESLSLTYKLNDLSQGIALKSTINLCCNNYVTMYEFDVFVRLYQPWNNILETWKALAVLHPGYMSFMTYDDVKLVLMNFIENPGPGTYVFRSSCTKLGQWAIGYITEDKQILQTIIQNKSLARALLDGEKEGYYKYPNGSITYNAYQHLYSLVHNLTQTHIQ---VSHEQYKVYCEMDSTFELCKICSENDKNIRLEPCQHLLCRPCLVSWESS-SGLTCPFCRLEIKSVEDIVVKPYEMKESADK---LTAPPLPPRPIMSTSTISTNSDNDLMATSNIELNYAVLDF----------------------------PDYPI------ASKATQVNFMPTSSHTN--GCQLQDIDCQH-DLEKNLKTLIENEKIDMKVAKLILKITDNDINKSRTILKYF 557          
BLAST of E3 ubiquitin-protein ligase CBL vs. Planmine SMEST
Match: SMESG000006795.1 (SMESG000006795.1)

HSP 1 Score: 145.976 bits (367), Expect = 3.330e-36
Identity = 92/282 (32.62%), Postives = 139/282 (49.29%), Query Frame = 2
Query:  506 LFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSPLQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSRWQKSFRCQSCPFCRLEIKGIEKISLIPYDSKN 1351
            L+  + A FPN  Y+P   +I+K+ A  WW  +FG        ++ F       Y        +L KT             FD+F RL+ PW  ILE W+VI   HP  + + TY      L   R    PG+YVFR SC   G W IGY+  S ++ Q  V   +L  AL EG +  +Y YPNG+  +     + ++   + I+V+ E+ + Y   D  F+ CKIC ++ K+++LE CGH +C  C    +K +  ++CPFC  +I+   KI  +   SK+
Sbjct:  106 LYFEIQAYFPNGIYSPHNVKISKNPARMWWEKKFG--------DNIFVDLDVRKY--------SLSKT-------------FDLFTRLYSPWERILEVWRVI-YSHPAYLHFSTYGDTKDTLS--RYLNEPGTYVFRISCKDLGFWTIGYVKSSKEMGQVKVDKSNLIEALVEGNKRNMYLYPNGESCNPDL--STLNEFRKEIVVNNEDLQLYECFD-DFKECKICRESEKDLQLESCGHQICQSCYKLLRK-YDKRNCPFCNQKIQSTTKIVNVKDPSKD 351          
BLAST of E3 ubiquitin-protein ligase CBL vs. Planmine SMEST
Match: SMESG000042167.1 (SMESG000042167.1)

HSP 1 Score: 51.9878 bits (123), Expect = 3.846e-7
Identity = 46/201 (22.89%), Postives = 89/201 (44.28%), Query Frame = 2
Query:  479 IDISILLSHLFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYE------QVVQLLKSFRCYPGPGSYVFRFSCTKP-GQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNG 1060
            +++ I    L   +  LFPN  +  + F + +  A +WW + F     +     F  F  K   +S ++ +       ++   G+++   F++F+R +  W  I   W + +  HPG M+ IT E      + +Q + +F       SY+F    T P G W + Y D + +I   I+  + L  +L   + +  +++P G
Sbjct:    1 MNMCIHFKFLNRDLETLFPNGVFVKKYF-LEEDSAEEWWKNNFNNEIFIEPERFFIPFSDKFPTLSRINDVMKRICFTSLEWCGYINKNSFNMFLRYYGGWYKIDSFW-LDITTHPGNMNLITLESGLEEFEKIQRMMAFSNKNIEKSYLFFIDWTSPDGLWILIYGDKNVEIKYEILKIEQLMSSL---KTSTKFQFPRG 196          
BLAST of E3 ubiquitin-protein ligase CBL vs. Planmine SMEST
Match: SMESG000042167.1 (SMESG000042167.1)

HSP 1 Score: 51.2174 bits (121), Expect = 6.556e-7
Identity = 44/186 (23.66%), Postives = 83/186 (44.62%), Query Frame = 2
Query:  524 ALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFFSKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWKVIVLEHPGCMSYITYE------QVVQLLKSFRCYPGPGSYVFRFSCTKP-GQWAIGYIDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNG 1060
             LFPN  +  + F + +  A +WW + F     +     F  F  K   +S ++ +       ++   G+++   F++F+R +  W  I   W + +  HPG M+ IT E      + +Q + +F       SY+F    T P G W + Y D + +I   I+  + L  +L   + +  +++P G
Sbjct:   14 TLFPNGVFVKKYF-LEEDSAEEWWKNNFNNEIFIEPERFFIPFSDKFPTLSRINDVMKRICFTSLEWCGYINKNSFNMFLRYYGGWYKIDSFW-LDITTHPGNMNLITLESGLEEFEKIQRMMAFSNKNIEKSYLFFIDWTSPDGLWILIYGDKNVEIKYEILKIEQLMSSL---KTSTKFQFPRG 194          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CBLB1.732e-9639.95Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:... [more]
CBLB1.906e-9639.95Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:... [more]
CBLB7.457e-9640.15Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:... [more]
CBLB8.006e-9639.95Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:... [more]
CBLB1.005e-9540.15Cbl proto-oncogene B [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sli-11.506e-8538.75Suppressor of LIneage defect [Source:UniProtKB/Tr... [more]
sli-12.560e-8536.25Suppressor of LIneage defect [Source:UniProtKB/Tr... [more]
sli-17.033e-8536.25Suppressor of LIneage defect [Source:UniProtKB/Tr... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cbl3.973e-9940.76gene:FBgn0020224 transcript:FBtr0076614[more]
Cbl5.180e-9640.51gene:FBgn0020224 transcript:FBtr0076615[more]
CG328473.547e-629.59gene:FBgn0052847 transcript:FBtr0075639[more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbl6.932e-9740.26Cbl proto-oncogene, E3 ubiquitin protein ligase [S... [more]
cblb1.837e-9440.05Cbl proto-oncogene B, E3 ubiquitin protein ligase ... [more]
cblb1.992e-9440.05Cbl proto-oncogene B, E3 ubiquitin protein ligase ... [more]
cblb2.027e-9440.05Cbl proto-oncogene B, E3 ubiquitin protein ligase ... [more]
cblc3.829e-8235.58Cbl proto-oncogene C, E3 ubiquitin protein ligase ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cblb1.071e-9640.26Cbl proto-oncogene B, E3 ubiquitin protein ligase ... [more]
cblb1.137e-9540.26Cbl proto-oncogene B, E3 ubiquitin protein ligase ... [more]
cblb1.785e-9540.26Cbl proto-oncogene B, E3 ubiquitin protein ligase ... [more]
cblb3.091e-9540.26Cbl proto-oncogene B, E3 ubiquitin protein ligase ... [more]
cblb3.841e-9540.26Cbl proto-oncogene B, E3 ubiquitin protein ligase ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cblb1.380e-9539.95Casitas B-lineage lymphoma b [Source:MGI Symbol;Ac... [more]
Cblb1.380e-9539.95Casitas B-lineage lymphoma b [Source:MGI Symbol;Ac... [more]
Cblb1.875e-9539.95Casitas B-lineage lymphoma b [Source:MGI Symbol;Ac... [more]
Cblb1.875e-9539.95Casitas B-lineage lymphoma b [Source:MGI Symbol;Ac... [more]
Cbl4.516e-9538.36Casitas B-lineage lymphoma [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6GQL0|CBLBA_XENLA7.207e-9540.26E3 ubiquitin-protein ligase CBL-B-A OS=Xenopus lae... [more]
sp|Q8K4S7|CBLB_RAT1.016e-9440.15E3 ubiquitin-protein ligase CBL-B OS=Rattus norveg... [more]
sp|Q3TTA7|CBLB_MOUSE1.311e-9439.95E3 ubiquitin-protein ligase CBL-B OS=Mus musculus ... [more]
sp|Q6NRE7|CBLBB_XENLA1.320e-9440.00E3 ubiquitin-protein ligase CBL-B-B OS=Xenopus lae... [more]
sp|Q6DFR2|CBLB_XENTR2.366e-9440.26E3 ubiquitin-protein ligase CBL-B OS=Xenopus tropi... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3W6238.342e-11247.03Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A3P7NGE81.753e-11044.69Uncharacterized protein (Fragment) OS=Dibothriocep... [more]
A0A068Y1R31.853e-11036.16E3 ubiquitin protein ligase CBL OS=Echinococcus mu... [more]
A0A0R3SR782.172e-11046.70Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A183SZA12.799e-11045.93E3 ubiquitin-protein ligase CBL OS=Schistocephalus... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbl1.266e-9539.90Cbl proto-oncogene [Source:NCBI gene;Acc:103032411... [more]
cbl2.072e-9539.90Cbl proto-oncogene [Source:NCBI gene;Acc:103032411... [more]
cblb1.555e-9340.31Cbl proto-oncogene B [Source:NCBI gene;Acc:1030347... [more]
cblc1.510e-8035.85E3 ubiquitin-protein ligase CBL-like [Source:NCBI ... [more]
cblc1.510e-8035.85E3 ubiquitin-protein ligase CBL-like [Source:NCBI ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cblc4.478e-4735.32Cbl proto-oncogene C, E3 ubiquitin protein ligase ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase CBL vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cblb2.219e-9440.46Cbl proto-oncogene B [Source:NCBI gene;Acc:1011574... [more]
cbl3.821e-9439.53Cbl proto-oncogene [Source:NCBI gene;Acc:101170289... [more]
ENSORLT00000018206.22.403e-9339.74E3 ubiquitin-protein ligase CBL [Source:NCBI gene;... [more]
cblc8.031e-7933.08E3 ubiquitin-protein ligase CBL [Source:NCBI gene;... [more]
cblc8.031e-7933.08E3 ubiquitin-protein ligase CBL [Source:NCBI gene;... [more]
back to top
BLAST of E3 ubiquitin-protein ligase CBL vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072524.10.000e+099.50SMESG000072524.1[more]
SMESG000056433.11.081e-11037.57SMESG000056433.1[more]
SMESG000006795.13.330e-3632.62SMESG000006795.1[more]
SMESG000042167.13.846e-722.89SMESG000042167.1[more]
SMESG000042167.16.556e-723.66SMESG000042167.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025338 ID=SMED30025338|Name=E3 ubiquitin-protein ligase CBL|organism=Schmidtea mediterranea sexual|type=transcript|length=2494bp
TCCGATCTAAATAATGTTGTAGTGTATACTAATTATTTTTTATGGAAATT
TAAATATGTTATGTCGCATGTTTAAACGGCATAAGAATAAGCCAAAAATT
GGCAAAGAAGAAACAGATAATTTTATGATTTTTAAAGAAATCAAATCTAG
ATCAAGTAATTGGTTTTCAAATAACGTTCTAATTTCCAAGGATTTTCATT
ATGTATTATCATTGATAGAAAAGTGCCAAAAGTACATTGGTAATTCTGAT
ATTAATTTTAAAACCAATCCGCCTTATTTACCATGTATTTTGAGAAATTT
TAGCCACAAAATTATGGATATATTAAAATGCTATGAAAATAAATTGAATG
AACTCAGTAAAATAAATTTTTTTCGTGTATCTATATGGACTCTTATCAAA
CAATGCAAGGAGATTTTACGTGTTATTCGTCGTGTCAATTTTTCTTTTGA
CGAATTTTCAGAACCAAGACAGAAATTAATAGACATATCAATTTTATTAT
CTCATTTATTTCATGCAGTTGTCGCATTATTTCCAAATAGTTGTTATGCC
CCTGAAGCATTTCGAATCACAAAGTCTGATGCAGCAGATTGGTGGAATTC
TCAGTTCGGCGCTCTCACAACTGTGGTAAAATGGAATGACTTTTTTCACT
TTTTCTCAAAGATAAATTATATTTCTGAAGTTTCTCAAATTGCAGCTTTG
CGAAAAACAATTAATGTTACAGGGAATGGTTTTGTGTCAATATTTGATTT
TGATGTATTCGTTAGATTATTTCAACCGTGGAATAATATTCTTGAATCTT
GGAAAGTAATAGTTTTAGAACACCCAGGATGCATGTCTTACATTACATAT
GAACAAGTTGTGCAATTGTTAAAATCATTTAGATGTTATCCTGGCCCTGG
TTCATATGTATTTCGTTTCAGTTGTACAAAGCCTGGTCAATGGGCCATAG
GGTATATTGATTTAAGTGGTAAAATATACCAAACAATAGTTCACAATAAA
TCTCTGGCAATAGCTCTTTATGAAGGAGAACAAGCTGGTATATATAAATA
TCCAAATGGGAAAATCTACGATAACTCTTTTCTCCATAATTTGGTGAGTT
CTCCACTTCAGAACATTATAGTATCTCTTGAAGAACATGAAGCTTACAGT
TTAATTGATTCTTCTTTTGAATTATGTAAAATATGTTCTCAAAATAATAA
AAACATTAAATTAGAGCCATGTGGACATTTATTGTGTAATTTCTGTCTAA
GCCGATGGCAAAAATCTTTTCGTTGCCAAAGTTGTCCATTTTGTCGATTA
GAAATTAAAGGAATAGAGAAAATATCATTGATTCCCTATGACAGTAAAAA
TGAAAATACACAAAATAAGTCAATCGACTGTCCTCTTGTGCCTCCAAGAC
AAATGAGCTTTCTACAAAAACAAGTTTCGGACGAAAAATGCTCTCTATCC
AATGACAATGGAAACAAAGTCAATTACGCACAATTGGATTGGGTATCAGG
AAATGATTCCGGTTCTTTGATTAATTCTTATGAAACTGAAAATATAGAGT
TTACTTCTAAAACAAACGACACAAAACCCGATTCTTCCTTTATTATTTCA
GAAATTCAATCAGCTCCAACCTCAAGTCAGAATAAGTGTCCAAATGACAA
TTCTACGAATTATGAATCTTGTTCATCTCATTATTTAAATTTACGAAATT
CAAATTTCAGTGATAATCACAACACATTAATGCATATCACAAATAATTCT
GAGGCAATGAAAAAACTATTAAAAATTACCGGGAATGATGTAACGATGTC
AAAGGAAATTTTGAAACATTTTTCACCTCGTCCTGTCACGATTTGCAGTA
ATAGTTGATGTTGTTATAACTTTTTATTGGCCAAATCAATTTTCACTTTC
TCAAAAAAACTATTTTTCATAATTTTACAGTTTCTTTCATGTTTCAAGTC
TTCCATGCAGCTGTTTTTAAAAAAAAAAATTCTAATATCATTTGGTTATA
TGGATATTGTTGGCATGTAAAATGTGCATTGATTTTTTCTCCATATTTTT
AGTTTCTCATAAAAATTGTAAGTTTTACTATTTTCCTATTAATTTTATTT
ATTATAAATTTGTTTAAGTGATTTTGAGAATGCAATTTATTACGTTAACA
TCTCAGATAAAGGATTTCATAACTGTAATTCAATAAATTATGTAATTTGT
TACATAGTTCGTTTAATCCCTCGTTCTAGAATTTTCGTTAAAATTGTTTT
TTTAATTATTTACAAATCAGTATATTCTAATTTCGTTTTGACCTGCCGTT
AGTGAACTTTGACTTTAATTTAATCAAAATTAATTGTGCAGCTAAGGTTT
AATGAACATTCAAAAATTAATTCTATTAAATTAAATGGTTTGAATTGGTT
TTGTATTTGTGTTTTTTCATTTTCAAATTTGTTTAATTATAAAATTATTT
CATCTGCAATGTTTTATTATCTCCATGTAATTACCAAAATTGCG
back to top

protein sequence of SMED30025338-orf-1

>SMED30025338-orf-1 ID=SMED30025338-orf-1|Name=SMED30025338-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=601bp
MLCRMFKRHKNKPKIGKEETDNFMIFKEIKSRSSNWFSNNVLISKDFHYV
LSLIEKCQKYIGNSDINFKTNPPYLPCILRNFSHKIMDILKCYENKLNEL
SKINFFRVSIWTLIKQCKEILRVIRRVNFSFDEFSEPRQKLIDISILLSH
LFHAVVALFPNSCYAPEAFRITKSDAADWWNSQFGALTTVVKWNDFFHFF
SKINYISEVSQIAALRKTINVTGNGFVSIFDFDVFVRLFQPWNNILESWK
VIVLEHPGCMSYITYEQVVQLLKSFRCYPGPGSYVFRFSCTKPGQWAIGY
IDLSGKIYQTIVHNKSLAIALYEGEQAGIYKYPNGKIYDNSFLHNLVSSP
LQNIIVSLEEHEAYSLIDSSFELCKICSQNNKNIKLEPCGHLLCNFCLSR
WQKSFRCQSCPFCRLEIKGIEKISLIPYDSKNENTQNKSIDCPLVPPRQM
SFLQKQVSDEKCSLSNDNGNKVNYAQLDWVSGNDSGSLINSYETENIEFT
SKTNDTKPDSSFIISEIQSAPTSSQNKCPNDNSTNYESCSSHYLNLRNSN
FSDNHNTLMHITNNSEAMKKLLKITGNDVTMSKEILKHFSPRPVTICSNS
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR036537Adaptor_Cbl_N_dom_sf
IPR024162Adaptor_Cbl
IPR001841Znf_RING
IPR000980SH2
IPR013083Znf_RING/FYVE/PHD
IPR003153Adaptor_Cbl_N_hlx
IPR014741Adaptor_Cbl_EF_hand-like
IPR014742Adaptor_Cbl_SH2-like
IPR011992EF-hand-dom_pair
IPR017907Znf_RING_CS
IPR024159Cbl_PTB
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0004871signal transducer activity
GO:0005509calcium ion binding
GO:0001784phosphotyrosine binding
GO:0004842ubiquitin-protein transferase activity
GO:0016874ligase activity
Vocabulary: biological process
TermDefinition
GO:0007166cell surface receptor signaling pathway
GO:0016567protein ubiquitination
GO:0023051regulation of signaling
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 374..413
e-value: 3.9E-5
score: 33.1
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 374..414
score: 12.283
IPR014742Adaptor protein Cbl, SH2-like domainPFAMPF02762Cbl_N3coord: 256..337
e-value: 1.5E-31
score: 108.1
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 351..427
e-value: 2.0E-13
score: 51.5
IPR014741Adaptor protein Cbl, EF hand-likePFAMPF02761Cbl_N2coord: 169..252
e-value: 4.2E-26
score: 91.5
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 256..342
e-value: 1.4E-29
score: 103.7
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 256..339
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 166..255
e-value: 3.0E-27
score: 97.0
NoneNo IPR availablePFAMPF14447Prok-RING_4coord: 374..418
e-value: 6.2E-11
score: 42.0
NoneNo IPR availablePANTHERPTHR23007:SF5E3 UBIQUITIN-PROTEIN LIGASE CBLcoord: 51..435
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 350..428
IPR003153Adaptor protein Cbl, N-terminal helicalPFAMPF02262Cbl_Ncoord: 48..164
e-value: 3.2E-18
score: 65.9
IPR036537Adaptor protein Cbl, N-terminal domain superfamilyGENE3DG3DSA:1.20.930.20coord: 41..165
e-value: 5.9E-18
score: 66.9
IPR036537Adaptor protein Cbl, N-terminal domain superfamilySUPERFAMILYSSF47668N-terminal domain of cbl (N-cbl)coord: 49..165
IPR024162Adaptor protein CblPANTHERPTHR23007CBLcoord: 51..435
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 389..398
IPR024159Adaptor protein Cbl, PTB domainPROSITEPS51506CBL_PTBcoord: 36..344
score: 55.839
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 169..253