Lon protease homolog, mitochondrial

Overview
NameLon protease homolog, mitochondrial
Smed IDSMED30025331
Length (bp)3005
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lon protease homolog, mitochondrial (SMED30025331) t-SNE clustered cells

Violin plots show distribution of expression levels for Lon protease homolog, mitochondrial (SMED30025331) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lon protease homolog, mitochondrial (SMED30025331) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lon protease homolog, mitochondrial (SMED30025331) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025331

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025331SMESG000079071.1 SmedASXL_009393SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025331SMESG000079071.1 SmedASXL_009393SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30025331SMESG000079071.1 dd_Smed_v4_3971_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025331SMESG000079071.1 dd_Smed_v4_3971_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025331SMESG000079071.1 dd_Smed_v4_3971_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025331SMESG000079071.1 Contig39480newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025331SMESG000079071.1 Contig39480uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Human
Match: LONP1 (lon peptidase 1, mitochondrial [Source:HGNC Symbol;Acc:HGNC:9479])

HSP 1 Score: 1025 bits (2649), Expect = 0.000e+0
Identity = 529/878 (60.25%), Postives = 663/878 (75.51%), Query Frame = 3
Query:  279 SLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXXX---XXXXXXXXXXLNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFNHSEKEMEA 2903
            +L    +P+ FP++PLIAI   P+FP+F+K+IEV ++ LV LLRR+++L  PY+GVF+K+D +N S ++  L+++Y  GTFA+I +  D+   +R I  GHRR+ I ++++ +  E E      KP  K     R +K  +++       E     + EL   +LMVE  N  HE +  T E+KA+T EIV TIR++I +NPLYRESV+     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ +L L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEK+DKDA+ EKFR RL++L VP+HV +V+DEEL+KL  LD HSSEFNVTRNYLDWLT++PWG  S E L L+ A+ +LEEDHYGM+DVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDE+DKIG+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN  +TIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQA A  GL+ +  K   ++ + L LLIKQYCRESGVRNLQK +EK++RKSA+ IVS   +  + VTPENLQDFVGKP++T +R+Y  TP GVV GLAWT MGGS LF+ET+ +R +D   K  K+       GS+ +TGQLG+VMKES  IA+TFA  FL       D              +L  + IH+HVP+GA  KDGPSAG T+VTAL+SL++  PV QN+AMTGEVSLTGK+LPVGGIKEK IAAKR+G+  I+LP ENKKD+ DL   ITEGL +HFV HY E+F IAF   + E  A
Sbjct:   47 ALTPMTIPDVFPHLPLIAITRNPVFPRFIKIIEVKNKKLVELLRRKVRLAQPYVGVFLKRDDSNESDVVESLDEIYHTGTFAQIHEMQDLGDKLRMIVMGHRRVHISRQLEVEPEEPEAENKH-KPRRKSK---RGKKEAEDELSARHPAELAMEPTPELPAEVLMVEVENVVHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIGRGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARALCGLDESKAK---LSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAES-VEVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKD-------GSLEVTGQLGEVMKESARIAYTFARAFLMQHAPAND--------------YLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDEQAEALA 892          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Human
Match: LONP1 (lon peptidase 1, mitochondrial [Source:HGNC Symbol;Acc:HGNC:9479])

HSP 1 Score: 1024.62 bits (2648), Expect = 0.000e+0
Identity = 528/873 (60.48%), Postives = 660/873 (75.60%), Query Frame = 3
Query:  294 NVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXXXXXXXXXXXX---XLNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFNHSEKEMEA 2903
             +P+ FP++PLIAI   P+FP+F+K+IEV ++ LV LLRR+++L  PY+GVF+K+D +N S ++  L+++Y  GTFA+I +  D+   +R I  GHRR+ I ++++ +  E E      KP  K     R +K  +++       E       EL   +LMVE  N  HE +  T E+KA+T EIV TIR++I +NPLYRESV+     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ +L L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEK+DKDA+ EKFR RL++L VP+HV +V+DEEL+KL  LD HSSEFNVTRNYLDWLT++PWG  S E L L+ A+ +LEEDHYGM+DVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDE+DKIG+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN  +TIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQA A  GL+ +  K   ++ + L LLIKQYCRESGVRNLQK +EK++RKSA+ IVS   +  + VTPENLQDFVGKP++T +R+Y  TP GVV GLAWT MGGS LF+ET+ +R +D   K  K+       GS+ +TGQLG+VMKES  IA+TFA  FL       D              +L  + IH+HVP+GA  KDGPSAG T+VTAL+SL++  PV QN+AMTGEVSLTGK+LPVGGIKEK IAAKR+G+  I+LP ENKKD+ DL   ITEGL +HFV HY E+F IAF   + E  A
Sbjct:    2 TIPDVFPHLPLIAITRNPVFPRFIKIIEVKNKKLVELLRRKVRLAQPYVGVFLKRDDSNESDVVESLDEIYHTGTFAQIHEMQDLGDKLRMIVMGHRRVHISRQLEVEPEEPEAENKH-KPRRKSK---RGKKEAEDELSARHPAELAMEPTPELPAEVLMVEVENVVHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIGRGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARALCGLDESKAK---LSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAES-VEVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKD-------GSLEVTGQLGEVMKESARIAYTFARAFLMQHAPAND--------------YLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDEQAEALA 842          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Human
Match: LONP1 (lon peptidase 1, mitochondrial [Source:HGNC Symbol;Acc:HGNC:9479])

HSP 1 Score: 1022.69 bits (2643), Expect = 0.000e+0
Identity = 529/878 (60.25%), Postives = 663/878 (75.51%), Query Frame = 3
Query:  279 SLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXXX---XXXXXXXXXXLNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFNHSEKEMEA 2903
            +L    +P+ FP++PLIAI   P+FP+F+K+IEV ++ LV LLRR+++L  PY+GVF+K+D +N S ++  L+++Y  GTFA+I +  D+   +R I  GHRR+ I ++++ +  E E      KP  K     R +K  +++       E     + EL   +LMVE  N  HE +  T E+KA+T EIV TIR++I +NPLYRESV+     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ +L L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEK+DKDA+ EKFR RL++L VP+HV +V+DEEL+KL  LD HSSEFNVTRNYLDWLT++PWG  S E L L+ A+ +LEEDHYGM+DVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDE+DKIG+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN  +TIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQA A  GL+ +  K   ++ + L LLIKQYCRESGVRNLQK +EK++RKSA+ IVS   +  + VTPENLQDFVGKP++T +R+Y  TP GVV GLAWT MGGS LF+ET+ +R +D   K  K+       GS+ +TGQLG+VMKES  IA+TFA  FL       D              +L  + IH+HVP+GA  KDGPSAG T+VTAL+SL++  PV QN+AMTGEVSLTGK+LPVGGIKEK IAAKR+G+  I+LP ENKKD+ DL   ITEGL +HFV HY E+F IAF   + E  A
Sbjct:  111 ALTPMTIPDVFPHLPLIAITRNPVFPRFIKIIEVKNKKLVELLRRKVRLAQPYVGVFLKRDDSNESDVVESLDEIYHTGTFAQIHEMQDLGDKLRMIVMGHRRVHISRQLEVEPEEPEAENKH-KPRRKSK---RGKKEAEDELSARHPAELAMEPTPELPAEVLMVEVENVVHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIGRGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARALCGLDESKAK---LSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAES-VEVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKD-------GSLEVTGQLGEVMKESARIAYTFARAFLMQHAPAND--------------YLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDEQAEALA 956          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Human
Match: LONP1 (lon peptidase 1, mitochondrial [Source:HGNC Symbol;Acc:HGNC:9479])

HSP 1 Score: 1006.13 bits (2600), Expect = 0.000e+0
Identity = 522/873 (59.79%), Postives = 652/873 (74.68%), Query Frame = 3
Query:  294 NVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXXXXXXXXXXXX---XLNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFNHSEKEMEA 2903
             +P+ FP++PLIAI   P+FP+F+K+IEV ++ LV LLRR+++L  PY+GVF+K+D +N S ++  L+++Y  GTFA+I +  D+   +R I  GHRR+ I ++++ +  E E      KP  K     R +K  +++       E       EL   +LMVE                A+T EIV TIR++I +NPLYRESV+     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ +L L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEK+DKDA+ EKFR RL++L VP+HV +V+DEEL+KL  LD HSSEFNVTRNYLDWLT++PWG  S E L L+ A+ +LEEDHYGM+DVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDE+DKIG+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN  +TIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQA A  GL+ +  K   ++ + L LLIKQYCRESGVRNLQK +EK++RKSA+ IVS   +  + VTPENLQDFVGKP++T +R+Y  TP GVV GLAWT MGGS LF+ET+ +R +D   K  K+       GS+ +TGQLG+VMKES  IA+TFA  FL       D              +L  + IH+HVP+GA  KDGPSAG T+VTAL+SL++  PV QN+AMTGEVSLTGK+LPVGGIKEK IAAKR+G+  I+LP ENKKD+ DL   ITEGL +HFV HY E+F IAF   + E  A
Sbjct:    2 TIPDVFPHLPLIAITRNPVFPRFIKIIEVKNKKLVELLRRKVRLAQPYVGVFLKRDDSNESDVVESLDEIYHTGTFAQIHEMQDLGDKLRMIVMGHRRVHISRQLEVEPEEPEAENKH-KPRRKSK---RGKKEAEDELSARHPAELAMEPTPELPAEVLMVE----------------ALTAEIVKTIRDIIALNPLYRESVLQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIGRGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARALCGLDESKAK---LSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAES-VEVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKD-------GSLEVTGQLGEVMKESARIAYTFARAFLMQHAPAND--------------YLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDEQAEALA 826          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Human
Match: LONP1 (lon peptidase 1, mitochondrial [Source:HGNC Symbol;Acc:HGNC:9479])

HSP 1 Score: 934.865 bits (2415), Expect = 0.000e+0
Identity = 489/790 (61.90%), Postives = 597/790 (75.57%), Query Frame = 3
Query:  543 DMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXXXXXXXXXXXX---XLNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFNHSEKEMEA 2903
            D+   +R I  GHRR+ I ++++ +  E E      KP  K     R +K  +++       E       EL   +LMVE  N  HE +  T E+KA+T EIV TIR++I +NPLYRESV+     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ +L L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEK+DKDA+ EKFR RL++L VP+HV +V+DEEL+KL  LD HSSEFNVTRNYLDWLT++PWG  S E L L+ A+ +LEEDHYGM+DVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDE+DKIG+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN  +TIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQA A  GL+ +  K   ++ + L LLIKQYCRESGVRNLQK +EK++RKSA+ IVS   +  + VTPENLQDFVGKP++T +R+Y  TP GVV GLAWT MGGS LF+ET+ +R +D   K  K+       GS+ +TGQLG+VMKES  IA+TFA  FL       D              +L  + IH+HVP+GA  KDGPSAG T+VTAL+SL++  PV QN+AMTGEVSLTGK+LPVGGIKEK IAAKR+G+  I+LP ENKKD+ DL   ITEGL +HFV HY E+F IAF   + E  A
Sbjct:    3 DLGDKLRMIVMGHRRVHISRQLEVEPEEPEAENKH-KPRRKSK---RGKKEAEDELSARHPAELAMEPTPELPAEVLMVEVENVVHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIGRGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARALCGLDESKAK---LSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAES-VEVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKD-------GSLEVTGQLGEVMKESARIAYTFARAFLMQHAPAND--------------YLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDEQAEALA 760          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Celegans
Match: lonp-1 (Lon protease homolog, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O44952])

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 461/925 (49.84%), Postives = 597/925 (64.54%), Query Frame = 3
Query:  294 NVPENFPNVPLIAIHSTPLFPKFVKMIE-VTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSV---------------------------DNDXXXXXXXXXXXXXLNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKI-GKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQ----------------------------TVDGI------INVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFN 2879
             VP + PNVP++AI+  PLFP F+K ++ V D++L  L+RR++ L  PY GVFVK+D  N  + IT L++VY  G+F +II+  D    +  +   HRRI+ ++ ID      E  P    P N +    ++  S                            +   ++T        +    I+MV T N   EP     E KA    IV TIR+++Q N L+ + + +  H   ++N  DNP+YLCDL A L   A+  + Q +++E D+ KRL ++L LI+KE  ++ L++ I K+VE+KV+  HRKY+L EQLKVIKKELG+EK++K  + EK   R++ L VPE+  +VI+EE  KL FLD HSSEF+VTRNYL+WLT++PWG++S E   LS AK  L+E HYGM DVK+RI+EFIAV+ L+ S  GKILCFHGPPGVGKTSIAKSIA ALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGK+IQC+KK KTENPL+LIDE+DKI G G+ GDP+SALLELLDPEQN NF DH+LDV VDLS+VLFICTAN +  IP PLRDRMEMI+VSGY++ EK+ IA   LIPQ   ++ L     + L I D +LE LIK YCRESGVRNLQ+HIE+I RK+A  I  Q                            + D +      I V  ENLQ FVG+P +T DR+Y  TP GV+ GLAWT MGGS L+IET  KR  D    +  +KD     GSI  TG LGDVMKESV  A T A   L+    + D             KF   A IHIHVP+GA  KDGPSAG+T+V++L+SL+L+ PV Q++AMTGE+SLTGKVLPVGGI+EK+IAA+R G   + LPNEN++D+DDLP  +   L I FV+HY+E++   F 
Sbjct:   81 QVPADMPNVPMLAINRYPLFPGFIKKVDIVKDDNLKALIRRQLSLKQPYAGVFVKRDDENKEETITSLSEVYPTGSFVQIIEVRDQGSVLELVLSAHRRIRALEPID------EITPKNETPLNGRRARGKRAASATSPLTPPPSPPPLAPSVASVAPEISATEEKEEKTTPPSATGEKQKKGIIMVRTENVVAEPVPKNNETKATMMAIVQTIRDVVQFNQLFGQQINLLLHP--SQNVIDNPVYLCDLVATLVQSAETKDLQEMMDEIDVSKRLKIALLLIQKEKAVAKLKYDINKDVEKKVQDHHRKYLLNEQLKVIKKELGIEKDEKTTIIEKIDERIKTLAVPEYALKVINEEKTKLQFLDPHSSEFSVTRNYLEWLTSVPWGLTSPENRRLSVAKKALDEGHYGMKDVKERIMEFIAVNLLRKSIGGKILCFHGPPGVGKTSIAKSIATALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKMIQCMKKVKTENPLVLIDEVDKIGGAGFHGDPASALLELLDPEQNANFNDHFLDVPVDLSRVLFICTANEISKIPGPLRDRMEMIDVSGYLAEEKVEIAHQHLIPQLRKDTSLAT---EQLKIEDSALEELIKHYCRESGVRNLQQHIERIFRKAALQIAEQQNEDEEPAEKATTAITENSEAEPITSTSSADCLKSSAEQIVVCTENLQKFVGRPKFTSDRMYEVTPPGVIMGLAWTAMGGSALYIETVLKRPVD----LTNDKD-----GSIETTGNLGDVMKESVRTALTVAKGILA--REQPDN------------KFFDKAHIHIHVPEGATPKDGPSAGVTLVSSLLSLALDRPVVQDMAMTGEISLTGKVLPVGGIREKVIAARRVGAKRVFLPNENRRDFDDLPEFMKSELDIRFVSHYDELYEHLFQ 971          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Celegans
Match: lonp-2 (Lon protease homolog 2, peroxisomal [Source:UniProtKB/Swiss-Prot;Acc:Q9XW87])

HSP 1 Score: 404.445 bits (1038), Expect = 5.055e-127
Identity = 215/542 (39.67%), Postives = 331/542 (61.07%), Query Frame = 3
Query: 1215 EKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNI-----------VSQTVDGIINVTPENLQDFVG----KPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDY 2795
            E+   +L  +   + V + +  EL++L  ++A  SE+N+  N+L+ +++LPW  S+ + + L  A+ IL E H  MDDVK+R+LE +AV  +  S +G ILCF GPPG+GKTSIAK+IA ++ RK+ R S+GG+ D S+I+GHRRTYV AMPG+II+ LK  KT NP+ L+DE+DK+  G QG PS+ALLELLDPEQN  F DHYL++  D+SK++FI TAN ++ +   LRDR+E+IE+SGY   EK+ I ++ L+ +      +   +   + +  +++  +I++Y  E+GVR L++++  I R  A  +           V   ++  I ++  N+   +     K +   +++ P  P GV  GL+ T +GG ++ IE +  +                  G IV TG LG V+KES+ +A  +               LSA +  L     L +  IH+H+P GAV+KDGPSAG  +  ALVSL+ NIP+  + A+TGE+SLTG VLP+GG+KEK++AA+R G+  ++LP  N+++Y
Sbjct:  232 EQLEEKLNAIEFSDEVSDRVYSELHRLKSMNAQQSEYNILMNWLELVSSLPWNTSTIDDIELHKARTILTESHEAMDDVKERVLEHLAVCKMNNSVKGMILCFTGPPGIGKTSIAKAIAESMGRKFQRVSLGGIRDESDIRGHRRTYVAAMPGRIIEALKTCKTNNPVFLLDEVDKLYSGNQGSPSAALLELLDPEQNSTFHDHYLNIPFDVSKIMFIATANDIDRLEPALRDRLEIIEMSGYSLKEKVKICENHLLTRQLTKHCI---SHDYVKLERQAIVAMIEEYTMEAGVRQLERNVGAICRNVALRLAEALNSDPGADVLPVMELPIQISASNIHKILKNKHMKRVKIVEKMRP-LPAGVCFGLSVTTIGGRVMPIEASKSKG----------------TGKIVTTGHLGKVLKESILVAKGW---------------LSANSERLGLGT-LEDQDIHVHLPAGAVNKDGPSAGTGLACALVSLATNIPLRSDAAVTGEISLTGHVLPIGGVKEKVLAAQREGLRRVVLPKSNEEEY 737          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Fly
Match: Lon (gene:FBgn0036892 transcript:FBtr0074967)

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 462/706 (65.44%), Postives = 560/706 (79.32%), Query Frame = 3
Query:  759 ILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAF 2876
            +L+VE  N     Y  T E+KA+T EI+ T+R++I MNPLYRES+    H   N+   DNPIYLCDLGA+LS+G +  E Q ILEE+DI +RL L+L L+KKELELS LQ KIG+EVEEKVKQQHRKY+LQEQLKVIKKELG+EK+DKDA+GEK+R +L+D  VPE +  VIDEEL KL+FL++HSSEFNVTRNYLDWLT+LPWG+ S E L L  A + L +DHYGM+D+KKRILEFIAVS+LKGSTQGKILCFHGPPGVGKTSIAKSIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGK+IQCLKKTK ENPL+LIDE+DKIGKG+QGDPSSALLELLDPEQN NFLDHYLDV VDLS+VLFICTAN ++TIPEPLRDRME+IE+SGY++ EK+AIA+ +L+PQA  + GL     K++NI++++L +LI+ YCRESGVRNLQKHIEK++RK AF +V +  +    V  +NL  F+GK I++ DR+Y  TP GVV GLAWT MGGS L+IET+ +  R        + D + + GS+ +TG LGDVMKES  IA T A NFL           S E N L    FL    IH+HVP+GA  KDGPSAGIT++TALVSL+   PV Q+IAMTGEVSL GKVLPVGGIKEK IAA+RSG+N +ILP +NKKD+++LPT IT+GL +HF T Y +V+ IAF
Sbjct:  293 VLIVEVENVKQPIYKQTEEVKALTQEIIKTLRDIITMNPLYRESLQQMLHQ--NQRVVDNPIYLCDLGASLSAG-EPAELQKILEETDIPERLQLALTLLKKELELSRLQQKIGREVEEKVKQQHRKYILQEQLKVIKKELGIEKDDKDAIGEKYREKLKDKVVPEAIMTVIDEELTKLNFLESHSSEFNVTRNYLDWLTSLPWGVISTENLCLEKATETLNDDHYGMEDIKKRILEFIAVSSLKGSTQGKILCFHGPPGVGKTSIAKSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKLIQCLKKTKIENPLVLIDEVDKIGKGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSRVLFICTANVIDTIPEPLRDRMELIEMSGYVAEEKIAIARQYLMPQAMKDCGL---TDKHINISEDALNMLIRSYCRESGVRNLQKHIEKVIRKVAFRVVKKEGEH-FPVNADNLTTFLGKQIFSSDRMYATTPVGVVMGLAWTAMGGSSLYIETSRRHIRQG-----AKTDPNTVAGSLHITGNLGDVMKESAQIALTVARNFL----------YSLEPNNL----FLEQEHIHLHVPEGATPKDGPSAGITIITALVSLATGKPVRQDIAMTGEVSLKGKVLPVGGIKEKTIAARRSGVNCLILPVDNKKDFEELPTYITDGLEVHFATTYEDVYKIAF 972          

HSP 2 Score: 112.079 bits (279), Expect = 9.749e-25
Identity = 62/172 (36.05%), Postives = 101/172 (58.72%), Query Frame = 3
Query:  156 VRNSRKLTVNLSFKEFSSSKIPNDNNESAEKPVTSTESDGKSLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKN 671
            +R  R    NL  + F S K  + N +    P   ++ D     T  VP+ +P+VPL+A+   PLFP+F+K++EV++  +++LLRR++KL  PY+GVF+KK      ++IT+LN VY +GTFA+I +  D+   +R +   HRRI+I  ++       E  PP  KP+  ++
Sbjct:   40 LRLQRLHGANLMVQRFYSRKRDDSNGDIIMGPDLMSDQDTHLPATVAVPDVWPHVPLLAMRKNPLFPRFMKIVEVSNPIIMDLLRRKVKLNQPYVGVFLKKT-DGEEELITNLNDVYNLGTFAQIQELQDLGDKLRMVVVAHRRIRITGQV------VEDVPPP-KPAEDQS 203          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Fly
Match: Lon (gene:FBgn0036892 transcript:FBtr0273410)

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 462/706 (65.44%), Postives = 560/706 (79.32%), Query Frame = 3
Query:  759 ILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAF 2876
            +L+VE  N     Y  T E+KA+T EI+ T+R++I MNPLYRES+    H   N+   DNPIYLCDLGA+LS+G +  E Q ILEE+DI +RL L+L L+KKELELS LQ KIG+EVEEKVKQQHRKY+LQEQLKVIKKELG+EK+DKDA+GEK+R +L+D  VPE +  VIDEEL KL+FL++HSSEFNVTRNYLDWLT+LPWG+ S E L L  A + L +DHYGM+D+KKRILEFIAVS+LKGSTQGKILCFHGPPGVGKTSIAKSIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGK+IQCLKKTK ENPL+LIDE+DKIGKG+QGDPSSALLELLDPEQN NFLDHYLDV VDLS+VLFICTAN ++TIPEPLRDRME+IE+SGY++ EK+AIA+ +L+PQA  + GL     K++NI++++L +LI+ YCRESGVRNLQKHIEK++RK AF +V +  +    V  +NL  F+GK I++ DR+Y  TP GVV GLAWT MGGS L+IET+ +  R        + D + + GS+ +TG LGDVMKES  IA T A NFL           S E N L    FL    IH+HVP+GA  KDGPSAGIT++TALVSL+   PV Q+IAMTGEVSL GKVLPVGGIKEK IAA+RSG+N +ILP +NKKD+++LPT IT+GL +HF T Y +V+ IAF
Sbjct:  311 VLIVEVENVKQPIYKQTEEVKALTQEIIKTLRDIITMNPLYRESLQQMLHQ--NQRVVDNPIYLCDLGASLSAG-EPAELQKILEETDIPERLQLALTLLKKELELSRLQQKIGREVEEKVKQQHRKYILQEQLKVIKKELGIEKDDKDAIGEKYREKLKDKVVPEAIMTVIDEELTKLNFLESHSSEFNVTRNYLDWLTSLPWGVISTENLCLEKATETLNDDHYGMEDIKKRILEFIAVSSLKGSTQGKILCFHGPPGVGKTSIAKSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKLIQCLKKTKIENPLVLIDEVDKIGKGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSRVLFICTANVIDTIPEPLRDRMELIEMSGYVAEEKIAIARQYLMPQAMKDCGL---TDKHINISEDALNMLIRSYCRESGVRNLQKHIEKVIRKVAFRVVKKEGEH-FPVNADNLTTFLGKQIFSSDRMYATTPVGVVMGLAWTAMGGSSLYIETSRRHIRQG-----AKTDPNTVAGSLHITGNLGDVMKESAQIALTVARNFL----------YSLEPNNL----FLEQEHIHLHVPEGATPKDGPSAGITIITALVSLATGKPVRQDIAMTGEVSLKGKVLPVGGIKEKTIAARRSGVNCLILPVDNKKDFEELPTYITDGLEVHFATTYEDVYKIAF 990          

HSP 2 Score: 112.079 bits (279), Expect = 1.070e-24
Identity = 60/163 (36.81%), Postives = 96/163 (58.90%), Query Frame = 3
Query:  156 VRNSRKLTVNLSFKEFSSSKIPNDNNESAEKPVTSTESDGKSLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPP 644
            +R  R    NL  + F S K  + N +    P   ++ D     T  VP+ +P+VPL+A+   PLFP+F+K++EV++  +++LLRR++KL  PY+GVF+KK      ++IT+LN VY +GTFA+I +  D+   +R +   HRRI+I  ++       E  PP
Sbjct:   40 LRLQRLHGANLMVQRFYSRKRDDSNGDIIMGPDLMSDQDTHLPATVAVPDVWPHVPLLAMRKNPLFPRFMKIVEVSNPIIMDLLRRKVKLNQPYVGVFLKKT-DGEEELITNLNDVYNLGTFAQIQELQDLGDKLRMVVVAHRRIRITGQV------VEDVPP 195          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Zebrafish
Match: lonp1 (lon peptidase 1, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-030131-4006])

HSP 1 Score: 919.842 bits (2376), Expect = 0.000e+0
Identity = 470/707 (66.48%), Postives = 568/707 (80.34%), Query Frame = 3
Query:  759 ILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFN 2879
            +LMVE  N  HE +  T E+KA+T EIV TIR++I +NPLYRESV+     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ +L L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEKEDKDA+ EKFR RL+D TVP+H+ +VI+EELNKL  LD HSSEFNVTRNYLDWLT++PWG +SEE L L  AK++LEEDHYGMDDVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPL+LIDE+DKIG+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN  +TIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQ     GL   +++ + I  E+L LLI+QYCRESGVRNLQK +EK+ RK AF IVS   +  ++VT  NLQD+VGKP++T DR+Y  TP GVV GLAWT MGGS LFIET+ +R RD   K    KD     GS+ +TGQLGDVMKES  IA+TFA +FL  M  + D             +FL ++ IH+HVP+GA  KDGPSAG T+VTAL+SL+ N  + QN+AMTGE+SLTGK+LPVGGIKEK IAAKR+G+  IILP EN+KD+ DLP  ITEGL +HFV +Y+E++ + F+
Sbjct:  284 VLMVEVDNVAHEEFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNIPKRLYKALSLLKKEYELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKEDKDAIEEKFRERLRDRTVPQHIMDVINEELNKLGLLDNHSSEFNVTRNYLDWLTSMPWGTNSEENLELRRAKEVLEEDHYGMDDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLVLIDEVDKIGRGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANITDTIPEPLRDRMEMINVSGYVAQEKLAIAEKYLVPQLRTLCGL---DEQKVKINPEALNLLIRQYCRESGVRNLQKQVEKVFRKVAFRIVSGE-ETAVDVTSNNLQDYVGKPLFTVDRMYDVTPPGVVMGLAWTAMGGSTLFIETSLRRPRDPPGK-DGPKD-----GSLEVTGQLGDVMKESAKIAYTFARSFL--MKEQPDN------------EFLVSSHIHLHVPEGATPKDGPSAGCTIVTALLSLATNTALRQNVAMTGELSLTGKILPVGGIKEKTIAAKRAGVTCIILPAENRKDFSDLPEYITEGLEVHFVENYSEIYNLVFS 963          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Zebrafish
Match: lonp2 (lon peptidase 2, peroxisomal [Source:NCBI gene;Acc:494030])

HSP 1 Score: 451.055 bits (1159), Expect = 1.091e-143
Identity = 249/592 (42.06%), Postives = 348/592 (58.78%), Query Frame = 3
Query: 1230 RLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIV---------------------SQTVDGIINVTPE--------NLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLE--AAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEV--------FPIAFNHSE 2888
            +++   +PE    V  +EL +L  +     E+ +TRNYL+ +  LPW  S+ + L +  A+ +L+ DHY M+ +KKR+LE++AV  LK + +G ILCF GPPGVGKTS+ +SIAR L R++ R ++GG+ D S+I+GHRRTYVG+MPG+II  LK     NP+ L+DE+DK+GK  QGDP++ALLE+LDPEQNH+F DHYL+V  DLS+VLFI TAN   TIP  L DRME+++V GY   EK+ IA   LIP      GL     + L I  ++   +I +Y RE+GVR+L++ I  + R  A  +                      S+  D  I   PE         L+D +G P++  +     T  GV  GLAWTPMGG I+F+E +         +M       E +G + LTGQLGDVMKES   AH  A+++L           +A+T  L   +A  L    IH+H P GAV+KDGPSAG+T+VT L SL     V  ++AMTGE++L G VLPVGGIK+K++AA R+ +  II+P  N+KD +++P  +   L        +EV        FP A NH +
Sbjct:  276 KVKAAAMPEAALRVCLKELRRLKKMPQSMPEYALTRNYLEMMVELPWSKSTTDCLDIRAARVLLDNDHYAMEKLKKRVLEYLAVRQLKSTLKGPILCFVGPPGVGKTSVGRSIARTLGREFHRIALGGVCDQSDIRGHRRTYVGSMPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHSFTDHYLNVPFDLSQVLFIATANTTATIPPALLDRMEVLQVPGYTQEEKVEIAHRHLIPHQLEQHGL---TPQQLQIPQDTTLQIISKYTREAGVRSLERKIGAVCRAVAVKVAEGQKVSRSEAPTEQHAEQNTDSKVEDSGIAAPPEMPIVIDHIALKDILGPPLFEMEVSERLTLPGVAIGLAWTPMGGEIMFVEAS---------RM-------EGEGQLTLTGQLGDVMKES---AH-LAISWLRS---------NAKTYLLNDGSADLLEGTDIHLHFPAGAVTKDGPSAGVTIVTCLASLLSGRLVRSDVAMTGEITLRGLVLPVGGIKDKVLAAHRANLKRIIIPKRNEKDLEEIPANVRADLDFVLAGTLDEVLNAAFDGGFPSAVNHPQ 835          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Zebrafish
Match: lonp1 (lon peptidase 1, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-030131-4006])

HSP 1 Score: 317.775 bits (813), Expect = 5.820e-101
Identity = 145/176 (82.39%), Postives = 163/176 (92.61%), Query Frame = 3
Query: 1206 AVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDE 1733
            A+ EKFR RL+D TVP+H+ +VI+EELNKL  LD HSSEFNVTRNYLDWLT++PWG +SEE L L  AK++LEEDHYGMDDVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPL+LIDE
Sbjct:    7 AIEEKFRERLRDRTVPQHIMDVINEELNKLGLLDNHSSEFNVTRNYLDWLTSMPWGTNSEENLELRRAKEVLEEDHYGMDDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLVLIDE 182          

HSP 2 Score: 69.3218 bits (168), Expect = 2.009e-12
Identity = 34/64 (53.12%), Postives = 45/64 (70.31%), Query Frame = 3
Query: 1965 IAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVS 2156
            I + +L+PQ     GL+   ++ + I  E+L LLI+QYCRESGVRNLQK +EK+ RK AF IVS
Sbjct:  180 IDEKYLVPQLRTLCGLD---EQKVKINPEALNLLIRQYCRESGVRNLQKQVEKVFRKVAFRIVS 240          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Xenopus
Match: LONP1 (lon peptidase 1, mitochondrial [Source:NCBI gene;Acc:100492505])

HSP 1 Score: 1038.48 bits (2684), Expect = 0.000e+0
Identity = 538/864 (62.27%), Postives = 656/864 (75.93%), Query Frame = 3
Query:  297 VPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXXXXXXXXXXXXXLNNR---ILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFN 2879
            VPE FPNVP+IA+   P+FP+FVK+IEV + +L+ LLRR+++L  PY G+F+KKD +N S ++  L+++Y  GTF +I +  DM   +R I  GHRRI+I K++D   +E E    E K   KK     KR++V     +      +     +    +LMVE  N  HE + NT E+KA+T EIV TIR++I +NPLYRESVM     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ SL L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEKEDKDA+ EKFR RL+DLTVP+HV EVIDEEL KL  LD HSSEFNVTRNYLDWLT++PWG  S+E L L  A+++LEEDHYGM+DVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDE+DK+G+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN  ETIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQA    GL+    +   IT ++L +LIKQYCRESGVRNLQK +EK++RKSA+ IV+      + VTP NLQDFVGKP++T DR+Y  TP GVV GLAWT MGGS LFIET+ +R  D           D   GS+ +TGQLGDVMKES  IA+TFA  FL  M    D              FL  + IH+HVP+GA  KDGPSAG T+VTAL+SL+++ P+ QN+AMTGEVSLTGK+LPVGGIKEK IAAKR+G+  IILP+ENKKDY DL   ITEGL +HFV HY+E++ I F+
Sbjct:  132 VPEVFPNVPVIAVSRNPVFPRFVKIIEVKNPNLMALLRRKVRLAQPYAGIFLKKDDSNESDVVNSLDEIYNTGTFVQIHEMHDMEDKLRMIVMGHRRIRINKELD---VEAEGEQSEEKGEGKK-----KRRNVVPKLTKEMEKLEQVLIDPSSPPGVLMVEVDNVAHEDFQNTEEVKALTAEIVKTIRDIIALNPLYRESVMQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNIPKRLYKSLSLLKKEYELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKEDKDAIEEKFRERLKDLTVPKHVMEVIDEELGKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSQENLDLRRAEEVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKLGRGYQGDPSSALLELLDPEQNSNFLDHYLDVPVDLSKVLFICTANVTETIPEPLRDRMEMINVSGYVAQEKLAIAEKYLVPQALTMCGLDEVKTR---ITSDALTVLIKQYCRESGVRNLQKQVEKVLRKSAYKIVNGEAQ-FVEVTPHNLQDFVGKPVFTVDRMYSVTPAGVVMGLAWTAMGGSTLFIETSLRRPLDK----------DSKDGSLEVTGQLGDVMKESAKIAYTFARAFL--MKKHPDN------------GFLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMDRPLRQNVAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIILPSENKKDYYDLAAFITEGLEVHFVEHYHEIYDIVFS 956          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Xenopus
Match: LONP1 (lon peptidase 1, mitochondrial [Source:NCBI gene;Acc:100492505])

HSP 1 Score: 1038.48 bits (2684), Expect = 0.000e+0
Identity = 538/864 (62.27%), Postives = 656/864 (75.93%), Query Frame = 3
Query:  297 VPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXXXXXXXXXXXXXLNNR---ILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFN 2879
            VPE FPNVP+IA+   P+FP+FVK+IEV + +L+ LLRR+++L  PY G+F+KKD +N S ++  L+++Y  GTF +I +  DM   +R I  GHRRI+I K++D   +E E    E K   KK     KR++V     +      +     +    +LMVE  N  HE + NT E+KA+T EIV TIR++I +NPLYRESVM     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ SL L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEKEDKDA+ EKFR RL+DLTVP+HV EVIDEEL KL  LD HSSEFNVTRNYLDWLT++PWG  S+E L L  A+++LEEDHYGM+DVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDE+DK+G+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN  ETIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQA    GL+    +   IT ++L +LIKQYCRESGVRNLQK +EK++RKSA+ IV+      + VTP NLQDFVGKP++T DR+Y  TP GVV GLAWT MGGS LFIET+ +R  D           D   GS+ +TGQLGDVMKES  IA+TFA  FL  M    D              FL  + IH+HVP+GA  KDGPSAG T+VTAL+SL+++ P+ QN+AMTGEVSLTGK+LPVGGIKEK IAAKR+G+  IILP+ENKKDY DL   ITEGL +HFV HY+E++ I F+
Sbjct:  111 VPEVFPNVPVIAVSRNPVFPRFVKIIEVKNPNLMALLRRKVRLAQPYAGIFLKKDDSNESDVVNSLDEIYNTGTFVQIHEMHDMEDKLRMIVMGHRRIRINKELD---VEAEGEQSEEKGEGKK-----KRRNVVPKLTKEMEKLEQVLIDPSSPPGVLMVEVDNVAHEDFQNTEEVKALTAEIVKTIRDIIALNPLYRESVMQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNIPKRLYKSLSLLKKEYELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKEDKDAIEEKFRERLKDLTVPKHVMEVIDEELGKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSQENLDLRRAEEVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKLGRGYQGDPSSALLELLDPEQNSNFLDHYLDVPVDLSKVLFICTANVTETIPEPLRDRMEMINVSGYVAQEKLAIAEKYLVPQALTMCGLDEVKTR---ITSDALTVLIKQYCRESGVRNLQKQVEKVLRKSAYKIVNGEAQ-FVEVTPHNLQDFVGKPVFTVDRMYSVTPAGVVMGLAWTAMGGSTLFIETSLRRPLDK----------DSKDGSLEVTGQLGDVMKESAKIAYTFARAFL--MKKHPDN------------GFLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMDRPLRQNVAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIILPSENKKDYYDLAAFITEGLEVHFVEHYHEIYDIVFS 935          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Xenopus
Match: LONP1 (lon peptidase 1, mitochondrial [Source:NCBI gene;Acc:100492505])

HSP 1 Score: 1034.63 bits (2674), Expect = 0.000e+0
Identity = 537/863 (62.22%), Postives = 654/863 (75.78%), Query Frame = 3
Query:  297 VPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXXXXXXXXXXXXXLNNR---ILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAF 2876
            VPE FPNVP+IA+   P+FP+FVK+IEV + +L+ LLRR+++L  PY G+F+KKD +N S ++  L+++Y  GTF +I +  DM   +R I  GHRRI+I K++D   +E E    E K   KK     KR++V     +      +     +    +LMVE  N  HE + NT E+KA+T EIV TIR++I +NPLYRESVM     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ SL L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEKEDKDA+ EKFR RL+DLTVP+HV EVIDEEL KL  LD HSSEFNVTRNYLDWLT++PWG  S+E L L  A+++LEEDHYGM+DVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDE+DK+G+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN  ETIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQA    GL+    +   IT ++L +LIKQYCRESGVRNLQK +EK++RKSA+ IV+      + VTP NLQDFVGKP++T DR+Y  TP GVV GLAWT MGGS LFIET+ +R  D           D   GS+ +TGQLGDVMKES  IA+TFA  FL  M    D              FL  + IH+HVP+GA  KDGPSAG T+VTAL+SL+++ P+ QN+AMTGEVSLTGK+LPVGGIKEK IAAKR+G+  IILP+ENKKDY DL   ITEGL +HFV HY+E++ I  
Sbjct:  144 VPEVFPNVPVIAVSRNPVFPRFVKIIEVKNPNLMALLRRKVRLAQPYAGIFLKKDDSNESDVVNSLDEIYNTGTFVQIHEMHDMEDKLRMIVMGHRRIRINKELD---VEAEGEQSEEKGEGKK-----KRRNVVPKLTKEMEKLEQVLIDPSSPPGVLMVEVDNVAHEDFQNTEEVKALTAEIVKTIRDIIALNPLYRESVMQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNIPKRLYKSLSLLKKEYELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKEDKDAIEEKFRERLKDLTVPKHVMEVIDEELGKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSQENLDLRRAEEVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKLGRGYQGDPSSALLELLDPEQNSNFLDHYLDVPVDLSKVLFICTANVTETIPEPLRDRMEMINVSGYVAQEKLAIAEKYLVPQALTMCGLDEVKTR---ITSDALTVLIKQYCRESGVRNLQKQVEKVLRKSAYKIVNGEAQ-FVEVTPHNLQDFVGKPVFTVDRMYSVTPAGVVMGLAWTAMGGSTLFIETSLRRPLDK----------DSKDGSLEVTGQLGDVMKESAKIAYTFARAFL--MKKHPDN------------GFLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMDRPLRQNVAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIILPSENKKDYYDLAAFITEGLEVHFVEHYHEIYDITL 967          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Xenopus
Match: LONP1 (lon peptidase 1, mitochondrial [Source:NCBI gene;Acc:100492505])

HSP 1 Score: 1033.86 bits (2672), Expect = 0.000e+0
Identity = 537/865 (62.08%), Postives = 655/865 (75.72%), Query Frame = 3
Query:  297 VPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXXXXXXXXXXXXXLNNR---ILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFNH 2882
            VPE FPNVP+IA+   P+FP+FVK+IEV + +L+ LLRR+++L  PY G+F+KKD +N S ++  L+++Y  GTF +I +  DM   +R I  GHRRI+I K++D   +E E    E K   KK     KR++V     +      +     +    +LMVE  N  HE + NT E+KA+T EIV TIR++I +NPLYRESVM     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ SL L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEKEDKDA+ EKFR RL+DLTVP+HV EVIDEEL KL  LD HSSEFNVTRNYLDWLT++PWG  S+E L L  A+++LEEDHYGM+DVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDE+DK+G+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN  ETIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQA    GL+    +   IT ++L +LIKQYCRESGVRNLQK +EK++RKSA+ IV+      + VTP NLQDFVGKP++T DR+Y  TP GVV GLAWT MGGS LFIET+ +R  D           D   GS+ +TGQLGDVMKES  IA+TFA  FL  M    D              FL  + IH+HVP+GA  KDGPSAG T+VTAL+SL+++ P+ QN+AMTGEVSLTGK+LPVGGIKEK IAAKR+G+  IILP+ENKKDY DL   ITEGL +HFV HY+E++ I  + 
Sbjct:  144 VPEVFPNVPVIAVSRNPVFPRFVKIIEVKNPNLMALLRRKVRLAQPYAGIFLKKDDSNESDVVNSLDEIYNTGTFVQIHEMHDMEDKLRMIVMGHRRIRINKELD---VEAEGEQSEEKGEGKK-----KRRNVVPKLTKEMEKLEQVLIDPSSPPGVLMVEVDNVAHEDFQNTEEVKALTAEIVKTIRDIIALNPLYRESVMQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNIPKRLYKSLSLLKKEYELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKEDKDAIEEKFRERLKDLTVPKHVMEVIDEELGKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSQENLDLRRAEEVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKLGRGYQGDPSSALLELLDPEQNSNFLDHYLDVPVDLSKVLFICTANVTETIPEPLRDRMEMINVSGYVAQEKLAIAEKYLVPQALTMCGLDEVKTR---ITSDALTVLIKQYCRESGVRNLQKQVEKVLRKSAYKIVNGEAQ-FVEVTPHNLQDFVGKPVFTVDRMYSVTPAGVVMGLAWTAMGGSTLFIETSLRRPLDK----------DSKDGSLEVTGQLGDVMKESAKIAYTFARAFL--MKKHPDN------------GFLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMDRPLRQNVAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIILPSENKKDYYDLAAFITEGLEVHFVEHYHEIYDIWLHQ 969          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Xenopus
Match: LONP1 (lon peptidase 1, mitochondrial [Source:NCBI gene;Acc:100492505])

HSP 1 Score: 1032.71 bits (2669), Expect = 0.000e+0
Identity = 537/865 (62.08%), Postives = 655/865 (75.72%), Query Frame = 3
Query:  297 VPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXXXXXXXXXXXXXLNNR---ILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFNH 2882
            VPE FPNVP+IA+   P+FP+FVK+IEV + +L+ LLRR+++L  PY G+F+KKD +N S ++  L+++Y  GTF +I +  DM   +R I  GHRRI+I K++D   +E E    E K   KK     KR++V     +      +     +    +LMVE  N  HE + NT E+KA+T EIV TIR++I +NPLYRESVM     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ SL L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEKEDKDA+ EKFR RL+DLTVP+HV EVIDEEL KL  LD HSSEFNVTRNYLDWLT++PWG  S+E L L  A+++LEEDHYGM+DVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDE+DK+G+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN  ETIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQA    GL+    +   IT ++L +LIKQYCRESGVRNLQK +EK++RKSA+ IV+      + VTP NLQDFVGKP++T DR+Y  TP GVV GLAWT MGGS LFIET+ +R  D           D   GS+ +TGQLGDVMKES  IA+TFA  FL  M    D              FL  + IH+HVP+GA  KDGPSAG T+VTAL+SL+++ P+ QN+AMTGEVSLTGK+LPVGGIKEK IAAKR+G+  IILP+ENKKDY DL   ITEGL +HFV HY+E++ I  + 
Sbjct:   98 VPEVFPNVPVIAVSRNPVFPRFVKIIEVKNPNLMALLRRKVRLAQPYAGIFLKKDDSNESDVVNSLDEIYNTGTFVQIHEMHDMEDKLRMIVMGHRRIRINKELD---VEAEGEQSEEKGEGKK-----KRRNVVPKLTKEMEKLEQVLIDPSSPPGVLMVEVDNVAHEDFQNTEEVKALTAEIVKTIRDIIALNPLYRESVMQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNIPKRLYKSLSLLKKEYELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKEDKDAIEEKFRERLKDLTVPKHVMEVIDEELGKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSQENLDLRRAEEVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKLGRGYQGDPSSALLELLDPEQNSNFLDHYLDVPVDLSKVLFICTANVTETIPEPLRDRMEMINVSGYVAQEKLAIAEKYLVPQALTMCGLDEVKTR---ITSDALTVLIKQYCRESGVRNLQKQVEKVLRKSAYKIVNGEAQ-FVEVTPHNLQDFVGKPVFTVDRMYSVTPAGVVMGLAWTAMGGSTLFIETSLRRPLDK----------DSKDGSLEVTGQLGDVMKESAKIAYTFARAFL--MKKHPDN------------GFLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMDRPLRQNVAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIILPSENKKDYYDLAAFITEGLEVHFVEHYHEIYDIWLHQ 923          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Mouse
Match: Lonp1 (lon peptidase 1, mitochondrial [Source:MGI Symbol;Acc:MGI:1921392])

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 531/890 (59.66%), Postives = 673/890 (75.62%), Query Frame = 3
Query:  237 SAEKPVTSTESDG---KSLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXX---XXXXXXXXXXXLNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFNHSE 2888
             AE   T++  +G    +L    VP+ FP++PLIAI   P+FP+F+K++EV ++ LV LLRR+++L  PY+GVF+K+D  N S ++  L+++Y  GTFA+I +  D+   +R I  GHRRI I ++++   +E E   PE +    +    R +K V+++     + E V   +++ +  +LMVE  N  HE +  T E+KA+T EIV TIR++I +NPLYRESV+     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ +L L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEK+DKDA+ EKFR RL++L VP+HV +V+DEEL+KL+ LD HSSEFNVTRNYLDWLT++PWG  S+E L L+ A+ +LEEDHYGM+DVKKR+LEFIAVS L+GSTQGKILCFHGPPGVGKTSIA+SIARAL R+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPL+LIDE+DKIG+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN ++TIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQA    GL   ++    ++   L LLIKQYCRESGVRNLQK +EK++RK+A+ IVS      + VTPENLQDFVGKP++T +R+Y  TP GVV GLAWT MGGS LF+ET+ +R +    K  ++KD     GS+ +TGQLGDVMKES  IA+T+A  FL +     D              FL  + IH+HVP+GA  KDGPSAG T+VTAL+SL+L  PV QN+AMTGEVSLTGKVLPVGGIKEK IAAKR+G+  IILP EN+KDY DL   ITEGL +HFV HY ++FPIAF   E
Sbjct:   82 GAEDGATASTGEGPVVTALAPMTVPDVFPHLPLIAITRNPVFPRFIKIVEVKNKKLVELLRRKVRLAQPYVGVFLKRDDNNESDVVESLDEIYHTGTFAQIHEMQDLGDKLRMIVTGHRRIHISRQLE---VEPEGLEPEAEKQKSRRKLKRGKKEVEDELGPKPQLEMVTEAATDTSKEVLMVEVENVAHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNILKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLRELVVPKHVMDVVDEELSKLALLDNHSSEFNVTRNYLDWLTSIPWGRQSDENLDLARAQAVLEEDHYGMEDVKKRVLEFIAVSQLRGSTQGKILCFHGPPGVGKTSIARSIARALGREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLVLIDEVDKIGRGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVIDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARTLCGL---DESKAQLSAAVLTLLIKQYCRESGVRNLQKQVEKVLRKAAYKIVSGEAQ-TVQVTPENLQDFVGKPVFTVERMYEVTPPGVVMGLAWTAMGGSTLFVETSLRRPQPSGSK--EDKD-----GSLEVTGQLGDVMKESARIAYTYARAFLMEQDPEND--------------FLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLALGQPVLQNLAMTGEVSLTGKVLPVGGIKEKTIAAKRAGVTCIILPAENRKDYSDLAPFITEGLEVHFVEHYRDIFPIAFPRRE 940          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Mouse
Match: Lonp2 (lon peptidase 2, peroxisomal [Source:MGI Symbol;Acc:MGI:1914137])

HSP 1 Score: 451.825 bits (1161), Expect = 8.366e-144
Identity = 246/584 (42.12%), Postives = 350/584 (59.93%), Query Frame = 3
Query: 1245 TVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIV-----------SQTVDG-------IINVTPEN---------------------LQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFN 2879
            ++PE   +V  +E+ +L  +     E+ +TRNYL+ +  LPW  S+ + L +  A+ +L+ DHY M+ +K+R+LE++AV  LK + +G ILCF GPPGVGKTS+ +S+A+ L R++ R ++GG+ D S+I+GHRRTYVG+MPG+II  LK     NP+ L+DE+DK+GK  QGDP++ALLE+LDPEQNHNF DHYL+V  DLS+VLFI TAN   TIP  L DRME+I+V GY   EK+ IA   LIP+     GL     + + I   +   +I +Y RE+GVR+L +    I R  A  +            S   DG       + +  PE+                     L+D +G P++  +     +  GV  GLAWTP+GG I+F+E     SR D             +G + LTGQLGDVMKES   AH  A+++L   ++ K  HL   TN   +   L N  IH+H P GAV+KDGPSAG+T+VT L SL     V  ++AMTGE++L G VLPVGGIK+K++AA R+G+  II+P  N+KD +++P+ + + LS    +  +EV   AF+
Sbjct:  281 SMPEQAHKVCVKEIKRLKKMPQSMPEYALTRNYLELMVELPWNKSTTDRLDIRAARILLDNDHYAMEKLKRRVLEYLAVRQLKNNLKGPILCFVGPPGVGKTSVGRSVAKTLGREFHRIALGGVCDQSDIRGHRRTYVGSMPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHNFTDHYLNVAFDLSQVLFIATANTTATIPPALLDRMEIIQVPGYTQEEKIEIAHRHLIPKQLEQHGL---TPQQIQIPQHTTLAIITRYTREAGVRSLDRKFGAICRAVAVKVAEGQHKEAKLDRSDVADGEGCKEHVLEDAKPESISDTADLALPPEMPILIDSHALKDILGPPLYELEVSERLSQPGVAIGLAWTPLGGKIMFVEA----SRMD------------GEGQLTLTGQLGDVMKES---AH-LAISWLR--SNAKKYHL---TNAFGSFDLLDNTDIHLHFPAGAVTKDGPSAGVTIVTCLASLFSGRLVRSDVAMTGEITLRGLVLPVGGIKDKVLAAHRAGLKQIIIPQRNEKDLEEIPSNVRQDLSFVTASCLDEVLNAAFD 836          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Mouse
Match: Lonp2 (lon peptidase 2, peroxisomal [Source:MGI Symbol;Acc:MGI:1914137])

HSP 1 Score: 430.254 bits (1105), Expect = 2.058e-137
Identity = 236/548 (43.07%), Postives = 330/548 (60.22%), Query Frame = 3
Query: 1353 LTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIV-----------SQTVDG-------IINVTPEN---------------------LQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFN 2879
            L NLPW  S+ + L +  A+ +L+ DHY M+ +K+R+LE++AV  LK + +G ILCF GPPGVGKTS+ +S+A+ L R++ R ++GG+ D S+I+GHRRTYVG+MPG+II  LK     NP+ L+DE+DK+GK  QGDP++ALLE+LDPEQNHNF DHYL+V  DLS+VLFI TAN   TIP  L DRME+I+V GY   EK+ IA   LIP+     GL     + + I   +   +I +Y RE+GVR+L +    I R  A  +            S   DG       + +  PE+                     L+D +G P++  +     +  GV  GLAWTP+GG I+F+E +         +M  E       G + LTGQLGDVMKES   AH  A+++L   ++ K  HL   TN   +   L N  IH+H P GAV+KDGPSAG+T+VT L SL     V  ++AMTGE++L G VLPVGGIK+K++AA R+G+  II+P  N+KD +++P+ + + LS    +  +EV   AF+
Sbjct:  175 LDNLPWNKSTTDRLDIRAARILLDNDHYAMEKLKRRVLEYLAVRQLKNNLKGPILCFVGPPGVGKTSVGRSVAKTLGREFHRIALGGVCDQSDIRGHRRTYVGSMPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHNFTDHYLNVAFDLSQVLFIATANTTATIPPALLDRMEIIQVPGYTQEEKIEIAHRHLIPKQLEQHGL---TPQQIQIPQHTTLAIITRYTREAGVRSLDRKFGAICRAVAVKVAEGQHKEAKLDRSDVADGEGCKEHVLEDAKPESISDTADLALPPEMPILIDSHALKDILGPPLYELEVSERLSQPGVAIGLAWTPLGGKIMFVEAS---------RMDGE-------GQLTLTGQLGDVMKES---AH-LAISWLR--SNAKKYHL---TNAFGSFDLLDNTDIHLHFPAGAVTKDGPSAGVTIVTCLASLFSGRLVRSDVAMTGEITLRGLVLPVGGIKDKVLAAHRAGLKQIIIPQRNEKDLEEIPSNVRQDLSFVTASCLDEVLNAAFD 694          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Mouse
Match: Lonp2 (lon peptidase 2, peroxisomal [Source:MGI Symbol;Acc:MGI:1914137])

HSP 1 Score: 308.145 bits (788), Expect = 9.996e-95
Identity = 183/444 (41.22%), Postives = 251/444 (56.53%), Query Frame = 3
Query: 1665 MPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIV-----------SQTVDG-------IINVTPEN---------------------LQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFN 2879
            MPG+II  LK     NP+ L+DE+DK+GK  QGDP++ALLE+LDPEQNHNF DHYL+V  DLS+VLFI TAN   TIP  L DRME+I+V GY   EK+ IA   LIP+     GL     + + I   +   +I +Y RE+GVR+L +    I R  A  +            S   DG       + +  PE+                     L+D +G P++  +     +  GV  GLAWTP+GG I+F+E +         +M  E       G + LTGQLGDVMKES   AH  A+++L   ++ K  HL   TN   +   L N  IH+H P GAV+KDGPSAG+T+VT L SL     V  ++AMTGE++L G VLPVGGIK+K++AA R+G+  II+P  N+KD +++P+ + + LS    +  +EV   AF+
Sbjct:    1 MPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHNFTDHYLNVAFDLSQVLFIATANTTATIPPALLDRMEIIQVPGYTQEEKIEIAHRHLIPKQLEQHGL---TPQQIQIPQHTTLAIITRYTREAGVRSLDRKFGAICRAVAVKVAEGQHKEAKLDRSDVADGEGCKEHVLEDAKPESISDTADLALPPEMPILIDSHALKDILGPPLYELEVSERLSQPGVAIGLAWTPLGGKIMFVEAS---------RMDGE-------GQLTLTGQLGDVMKES---AH-LAISWLR--SNAKKYHL---TNAFGSFDLLDNTDIHLHFPAGAVTKDGPSAGVTIVTCLASLFSGRLVRSDVAMTGEITLRGLVLPVGGIKDKVLAAHRAGLKQIIIPQRNEKDLEEIPSNVRQDLSFVTASCLDEVLNAAFD 416          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Mouse
Match: Lonp2 (lon peptidase 2, peroxisomal [Source:MGI Symbol;Acc:MGI:1914137])

HSP 1 Score: 308.145 bits (788), Expect = 9.996e-95
Identity = 183/444 (41.22%), Postives = 251/444 (56.53%), Query Frame = 3
Query: 1665 MPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIV-----------SQTVDG-------IINVTPEN---------------------LQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFN 2879
            MPG+II  LK     NP+ L+DE+DK+GK  QGDP++ALLE+LDPEQNHNF DHYL+V  DLS+VLFI TAN   TIP  L DRME+I+V GY   EK+ IA   LIP+     GL     + + I   +   +I +Y RE+GVR+L +    I R  A  +            S   DG       + +  PE+                     L+D +G P++  +     +  GV  GLAWTP+GG I+F+E +         +M  E       G + LTGQLGDVMKES   AH  A+++L   ++ K  HL   TN   +   L N  IH+H P GAV+KDGPSAG+T+VT L SL     V  ++AMTGE++L G VLPVGGIK+K++AA R+G+  II+P  N+KD +++P+ + + LS    +  +EV   AF+
Sbjct:    1 MPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHNFTDHYLNVAFDLSQVLFIATANTTATIPPALLDRMEIIQVPGYTQEEKIEIAHRHLIPKQLEQHGL---TPQQIQIPQHTTLAIITRYTREAGVRSLDRKFGAICRAVAVKVAEGQHKEAKLDRSDVADGEGCKEHVLEDAKPESISDTADLALPPEMPILIDSHALKDILGPPLYELEVSERLSQPGVAIGLAWTPLGGKIMFVEAS---------RMDGE-------GQLTLTGQLGDVMKES---AH-LAISWLR--SNAKKYHL---TNAFGSFDLLDNTDIHLHFPAGAVTKDGPSAGVTIVTCLASLFSGRLVRSDVAMTGEITLRGLVLPVGGIKDKVLAAHRAGLKQIIIPQRNEKDLEEIPSNVRQDLSFVTASCLDEVLNAAFD 416          
BLAST of Lon protease homolog, mitochondrial vs. UniProt/SwissProt
Match: sp|Q8CGK3|LONM_MOUSE (Lon protease homolog, mitochondrial OS=Mus musculus OX=10090 GN=Lonp1 PE=1 SV=2)

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 531/890 (59.66%), Postives = 673/890 (75.62%), Query Frame = 3
Query:  237 SAEKPVTSTESDG---KSLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXX---XXXXXXXXXXXLNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFNHSE 2888
             AE   T++  +G    +L    VP+ FP++PLIAI   P+FP+F+K++EV ++ LV LLRR+++L  PY+GVF+K+D  N S ++  L+++Y  GTFA+I +  D+   +R I  GHRRI I ++++   +E E   PE +    +    R +K V+++     + E V   +++ +  +LMVE  N  HE +  T E+KA+T EIV TIR++I +NPLYRESV+     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ +L L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEK+DKDA+ EKFR RL++L VP+HV +V+DEEL+KL+ LD HSSEFNVTRNYLDWLT++PWG  S+E L L+ A+ +LEEDHYGM+DVKKR+LEFIAVS L+GSTQGKILCFHGPPGVGKTSIA+SIARAL R+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPL+LIDE+DKIG+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN ++TIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQA    GL   ++    ++   L LLIKQYCRESGVRNLQK +EK++RK+A+ IVS      + VTPENLQDFVGKP++T +R+Y  TP GVV GLAWT MGGS LF+ET+ +R +    K  ++KD     GS+ +TGQLGDVMKES  IA+T+A  FL +     D              FL  + IH+HVP+GA  KDGPSAG T+VTAL+SL+L  PV QN+AMTGEVSLTGKVLPVGGIKEK IAAKR+G+  IILP EN+KDY DL   ITEGL +HFV HY ++FPIAF   E
Sbjct:   82 GAEDGATASTGEGPVVTALAPMTVPDVFPHLPLIAITRNPVFPRFIKIVEVKNKKLVELLRRKVRLAQPYVGVFLKRDDNNESDVVESLDEIYHTGTFAQIHEMQDLGDKLRMIVTGHRRIHISRQLE---VEPEGLEPEAEKQKSRRKLKRGKKEVEDELGPKPQLEMVTEAATDTSKEVLMVEVENVAHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNILKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLRELVVPKHVMDVVDEELSKLALLDNHSSEFNVTRNYLDWLTSIPWGRQSDENLDLARAQAVLEEDHYGMEDVKKRVLEFIAVSQLRGSTQGKILCFHGPPGVGKTSIARSIARALGREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLVLIDEVDKIGRGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVIDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARTLCGL---DESKAQLSAAVLTLLIKQYCRESGVRNLQKQVEKVLRKAAYKIVSGEAQ-TVQVTPENLQDFVGKPVFTVERMYEVTPPGVVMGLAWTAMGGSTLFVETSLRRPQPSGSK--EDKD-----GSLEVTGQLGDVMKESARIAYTYARAFLMEQDPEND--------------FLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLALGQPVLQNLAMTGEVSLTGKVLPVGGIKEKTIAAKRAGVTCIILPAENRKDYSDLAPFITEGLEVHFVEHYRDIFPIAFPRRE 940          
BLAST of Lon protease homolog, mitochondrial vs. UniProt/SwissProt
Match: sp|Q924S5|LONM_RAT (Lon protease homolog, mitochondrial OS=Rattus norvegicus OX=10116 GN=Lonp1 PE=2 SV=1)

HSP 1 Score: 1030.01 bits (2662), Expect = 0.000e+0
Identity = 532/884 (60.18%), Postives = 669/884 (75.68%), Query Frame = 3
Query:  237 SAEKPVTSTESDGKSLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNK-KNGFFRKRKSVDNDXXXXXXXXXXXXXLNN---RILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAF 2876
            S E PV +      +L    VP+ FP++PLIAI   P+FP+F+K++EV ++ LV LLRR+++L  PY+GVF+K+D  N S ++  L+++Y  GTFA+I +  D+   +R I  GHRRI I ++++   +E E   PE +   K +    R +K V ++      +E  +   ++    +LMVE  N  HE +  T E+KA+T EIV TIR++I +NPLYRESV+     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ +L L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEK+DKDA+ EKFR RL++L VP+HV +V+DEEL+KL+ LD HSSEFNVTRNYLDWLT++PWG  S+E L L+ A+ +LEEDHYGM+DVKKR+LEFIAVS L+GSTQGKILCFHGPPGVGKTSIA+SIARAL R+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPL+LIDE+DKIG+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN  +TIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQA    GL+  +K  L+ T   L LLIKQYCRESGVRNLQK +EK++RK+A+ IVS      ++VTPENLQDFVGKP++T +R+Y  TP GVV GLAWT MGGS LF+ET+ +R +    K  ++KD     GS+ +TGQLGDVMKES  IA+TFA  FL +     D              FL  + IH+HVP+GA  KDGPSAG T+VTAL+SL+L  PV QN+AMTGEVSLTGKVLPVGGIKEK IAAKR+G+  IILP EN+KD+ DL   ITEGL +HFV HY ++F IAF
Sbjct:   91 SGEGPVVT------ALAPMTVPDVFPHLPLIAISRNPVFPRFIKIVEVKNKKLVELLRRKVRLAQPYVGVFLKRDDNNESDVVESLDEIYHTGTFAQIHEMQDLGDKLRMIVTGHRRIHISRQLE---VEPEGLEPEAENKQKSRRKLKRGKKEVGDELGAKPQLEMVTEATSDTSKEVLMVEVENVAHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNILKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLALLDNHSSEFNVTRNYLDWLTSIPWGRQSDENLDLARAQSVLEEDHYGMEDVKKRVLEFIAVSQLRGSTQGKILCFHGPPGVGKTSIARSIARALGREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLVLIDEVDKIGRGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARTLCGLD-ESKAQLSAT--VLTLLIKQYCRESGVRNLQKQVEKVLRKAAYKIVSGEAQ-TVHVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQPSGSK--EDKD-----GSLEVTGQLGDVMKESARIAYTFARAFLMEQDPEND--------------FLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLALGQPVLQNLAMTGEVSLTGKVLPVGGIKEKTIAAKRAGVTCIILPAENRKDFSDLAPFITEGLEVHFVEHYRDIFRIAF 937          
BLAST of Lon protease homolog, mitochondrial vs. UniProt/SwissProt
Match: sp|P36776|LONM_HUMAN (Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 PE=1 SV=2)

HSP 1 Score: 1022.69 bits (2643), Expect = 0.000e+0
Identity = 529/878 (60.25%), Postives = 663/878 (75.51%), Query Frame = 3
Query:  279 SLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXXX---XXXXXXXXXXLNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFNHSEKEMEA 2903
            +L    +P+ FP++PLIAI   P+FP+F+K+IEV ++ LV LLRR+++L  PY+GVF+K+D +N S ++  L+++Y  GTFA+I +  D+   +R I  GHRR+ I ++++ +  E E      KP  K     R +K  +++       E     + EL   +LMVE  N  HE +  T E+KA+T EIV TIR++I +NPLYRESV+     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ +L L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEK+DKDA+ EKFR RL++L VP+HV +V+DEEL+KL  LD HSSEFNVTRNYLDWLT++PWG  S E L L+ A+ +LEEDHYGM+DVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDE+DKIG+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN  +TIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQA A  GL+ +  K   ++ + L LLIKQYCRESGVRNLQK +EK++RKSA+ IVS   +  + VTPENLQDFVGKP++T +R+Y  TP GVV GLAWT MGGS LF+ET+ +R +D   K  K+       GS+ +TGQLG+VMKES  IA+TFA  FL       D              +L  + IH+HVP+GA  KDGPSAG T+VTAL+SL++  PV QN+AMTGEVSLTGK+LPVGGIKEK IAAKR+G+  I+LP ENKKD+ DL   ITEGL +HFV HY E+F IAF   + E  A
Sbjct:  111 ALTPMTIPDVFPHLPLIAITRNPVFPRFIKIIEVKNKKLVELLRRKVRLAQPYVGVFLKRDDSNESDVVESLDEIYHTGTFAQIHEMQDLGDKLRMIVMGHRRVHISRQLEVEPEEPEAENKH-KPRRKSK---RGKKEAEDELSARHPAELAMEPTPELPAEVLMVEVENVVHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIGRGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARALCGLDESKAK---LSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAES-VEVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKD-------GSLEVTGQLGEVMKESARIAYTFARAFLMQHAPAND--------------YLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDEQAEALA 956          
BLAST of Lon protease homolog, mitochondrial vs. UniProt/SwissProt
Match: sp|Q59HJ6|LONM_BOVIN (Lon protease homolog, mitochondrial OS=Bos taurus OX=9913 GN=LONP1 PE=1 SV=1)

HSP 1 Score: 1021.92 bits (2641), Expect = 0.000e+0
Identity = 530/884 (59.95%), Postives = 661/884 (74.77%), Query Frame = 3
Query:  279 SLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKID---------NKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXXXXXXXXXXXXXLNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFNHSEKEMEA 2903
            +L    +P+ FP++PLIA+   P+FP+F+K++EV ++ LV LLRR++ L  PY GVF+KKD  N S ++ +L+++Y  GTF +I +  D+   +R I  GHRR+ I ++++         NK  +  K P   K   +++G  ++   V         V          +LMVE  N  HE +  T E+KA+T EIV TIR++I +NPLYRESV+     Q+     DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ +L L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEK+DKDA+ EKFR RL++L VP+HV +V+DEEL+KL  LD HSSEFNVTRNYLDWLT++PWG  S+E L L+ A+ +LEEDHYGM+DVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPL+LIDE+DKIG+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN  ETIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQA A  GL+ +  K   ++ + L LLIKQYCRESGVRNLQK +EK++RKSA+ IVS   +  + VTPENLQDFVGKP++T +R+Y  TP GVV GLAWT MGGS LF+ET+ +R RD      ++ D  +  GS+ +TGQLG+VMKES  IA+TFA  FL    S              A KFL  + IH+HVP+GA  KDGPSAG T+VTAL+SL+L+ PV QN+AMTGEVSLTGKVLPVGGIKEK IAAKR+G+  I+LP ENKKD+ DL   ITEGL +HFV HY E+F IAF     E  A
Sbjct:  112 ALTPMMIPDVFPHLPLIAVTRNPVFPRFIKIVEVKNKKLVELLRRKVHLAQPYAGVFLKKDDNNESDVVENLDEIYHTGTFVQIHEMQDLGDKLRMIVMGHRRVHINRQLEVEPEEPEGENKQ-KLRKKPKRGKKEAEEDGATKRPLEV---------VVGPGPSPAGEVLMVEVENVAHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMM--QAGHRVVDNPIYLSDMGAALT-GAESHELQEVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKHSDENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLVLIDEVDKIGRGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANITETIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARALCGLDESKAK---LSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAE-FVEVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPRD------RDSDKGDKDGSLEVTGQLGEVMKESARIAYTFARAFLMQHDS--------------ANKFLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLALDRPVRQNLAMTGEVSLTGKVLPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPEERAEALA 958          
BLAST of Lon protease homolog, mitochondrial vs. UniProt/SwissProt
Match: sp|Q7KUT2|LONM_DROME (Lon protease homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Lon PE=1 SV=1)

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 462/706 (65.44%), Postives = 560/706 (79.32%), Query Frame = 3
Query:  759 ILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAF 2876
            +L+VE  N     Y  T E+KA+T EI+ T+R++I MNPLYRES+    H   N+   DNPIYLCDLGA+LS+G +  E Q ILEE+DI +RL L+L L+KKELELS LQ KIG+EVEEKVKQQHRKY+LQEQLKVIKKELG+EK+DKDA+GEK+R +L+D  VPE +  VIDEEL KL+FL++HSSEFNVTRNYLDWLT+LPWG+ S E L L  A + L +DHYGM+D+KKRILEFIAVS+LKGSTQGKILCFHGPPGVGKTSIAKSIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGK+IQCLKKTK ENPL+LIDE+DKIGKG+QGDPSSALLELLDPEQN NFLDHYLDV VDLS+VLFICTAN ++TIPEPLRDRME+IE+SGY++ EK+AIA+ +L+PQA  + GL     K++NI++++L +LI+ YCRESGVRNLQKHIEK++RK AF +V +  +    V  +NL  F+GK I++ DR+Y  TP GVV GLAWT MGGS L+IET+ +  R        + D + + GS+ +TG LGDVMKES  IA T A NFL           S E N L    FL    IH+HVP+GA  KDGPSAGIT++TALVSL+   PV Q+IAMTGEVSL GKVLPVGGIKEK IAA+RSG+N +ILP +NKKD+++LPT IT+GL +HF T Y +V+ IAF
Sbjct:  311 VLIVEVENVKQPIYKQTEEVKALTQEIIKTLRDIITMNPLYRESLQQMLHQ--NQRVVDNPIYLCDLGASLSAG-EPAELQKILEETDIPERLQLALTLLKKELELSRLQQKIGREVEEKVKQQHRKYILQEQLKVIKKELGIEKDDKDAIGEKYREKLKDKVVPEAIMTVIDEELTKLNFLESHSSEFNVTRNYLDWLTSLPWGVISTENLCLEKATETLNDDHYGMEDIKKRILEFIAVSSLKGSTQGKILCFHGPPGVGKTSIAKSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKLIQCLKKTKIENPLVLIDEVDKIGKGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSRVLFICTANVIDTIPEPLRDRMELIEMSGYVAEEKIAIARQYLMPQAMKDCGL---TDKHINISEDALNMLIRSYCRESGVRNLQKHIEKVIRKVAFRVVKKEGEH-FPVNADNLTTFLGKQIFSSDRMYATTPVGVVMGLAWTAMGGSSLYIETSRRHIRQG-----AKTDPNTVAGSLHITGNLGDVMKESAQIALTVARNFL----------YSLEPNNL----FLEQEHIHLHVPEGATPKDGPSAGITIITALVSLATGKPVRQDIAMTGEVSLKGKVLPVGGIKEKTIAARRSGVNCLILPVDNKKDFEELPTYITDGLEVHFATTYEDVYKIAF 990          

HSP 2 Score: 112.079 bits (279), Expect = 1.073e-23
Identity = 60/163 (36.81%), Postives = 96/163 (58.90%), Query Frame = 3
Query:  156 VRNSRKLTVNLSFKEFSSSKIPNDNNESAEKPVTSTESDGKSLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPP 644
            +R  R    NL  + F S K  + N +    P   ++ D     T  VP+ +P+VPL+A+   PLFP+F+K++EV++  +++LLRR++KL  PY+GVF+KK      ++IT+LN VY +GTFA+I +  D+   +R +   HRRI+I  ++       E  PP
Sbjct:   40 LRLQRLHGANLMVQRFYSRKRDDSNGDIIMGPDLMSDQDTHLPATVAVPDVWPHVPLLAMRKNPLFPRFMKIVEVSNPIIMDLLRRKVKLNQPYVGVFLKKT-DGEEELITNLNDVYNLGTFAQIQELQDLGDKLRMVVVAHRRIRITGQV------VEDVPP 195          
BLAST of Lon protease homolog, mitochondrial vs. TrEMBL
Match: A0A068Y1B0 (Lon protease homolog, mitochondrial OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000324100 PE=3 SV=1)

HSP 1 Score: 1085.86 bits (2807), Expect = 0.000e+0
Identity = 570/957 (59.56%), Postives = 709/957 (74.09%), Query Frame = 3
Query:  144 PILFVRNSRKLTVNLSFKEFSSS--KIPND--NNESAEKPVTSTESDGK-----SLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDN--KDLETEKFPPEIKPSNKKNGFFRK-RKS--------------------------------VDNDXXXXXXXXXXXXXLNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLY-PETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNF-LSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAF 2876
            P+L +R   +      ++  S+S  K P     ++S   P  S  SD       +L TQNVPE FP VP+I+I   PLFPKFVKM+E+TD+ L+ L+RR++K  LPY GVF+KK+P++TS ++  L+++Y+VGTF +I + DDM   IR +  GHRRI+IVK + +   D        E KP NK+NG FR+ RK+                                +  +  + +  + + S      LMVETIN Y+EPY NT EIKA++ EIV TIR++I +NP+YRE+V+     Q  +   DNP+YL DLGAA+++ A+  E QA+LEE+ I +RL L+L L+KKELEL  LQ +IG+EVEEKVK QHRKYML EQLKVIK+ELGLEK+DK+A+ EKFR+RL DLTVP+ V EVI+EELNKL  LD HSSEFNVTRNYLDWLT+LPWG++SEE L L+ A+ +L+EDHYG+DDVKKRILEFIAVS LKG+TQGKI+CFHGPPG GKTSIA+SIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKT+TENPLILIDEIDK+G+GWQGDP+SALLELLDPEQN NFLDHYLDVTVDLS+VLFI TAN++E IPEPLRDRME+IEV+GY++ EK+AIA+ +L+PQA  +SGL+    + + ITD +L+ LI+QYCRESGVRNLQKHIEK++RK+A+ IV+   +  + V  +NL  FVG+PIW  DRLY P TP GVV GLAWT MGGS+LFIE T K    +        + D IKGS+ LTG LGDVMKESV+IAHTFA NF +SD   R+    S  T F  A +FLR+A IH+HVP GA  KDGPSAGITMVTAL+SL+ N+PV  ++AMTGE+SLTGKVLPVGGIKEK+IAAKR G+ ++ILP  N+KDY+DL   I   L +HFV+HY+EVFPIAF
Sbjct:   43 PVLHLRKIPQAKAGFCYRFSSTSNEKPPESPSGSDSGASPTDSHSSDMPPQHPFALSTQNVPEIFPCVPVISITGPPLFPKFVKMLEITDQSLMELIRRKMKFNLPYAGVFLKKNPSDTSDVVKSLDELYQVGTFVQIPEWDDMGTKIRMLVIGHRRIQIVKAVPDVAADANVASISSEEKPRNKRNGLFRRVRKAAHMAGLATEEIPPMKEVEREETSTSASESASPLSEEESQNDGSDKQKSLSPENPLMVETINVYNEPYENTQEIKALSAEIVKTIRDIINLNPIYRENVLAML--QVGQRVVDNPVYLSDLGAAITAAAEPAELQAVLEETRIPERLRLALSLVKKELELGRLQQQIGQEVEEKVKAQHRKYMLNEQLKVIKRELGLEKDDKEAIAEKFRARLADLTVPQAVGEVIEEELNKLGVLDNHSSEFNVTRNYLDWLTSLPWGLTSEENLDLARARVVLDEDHYGLDDVKKRILEFIAVSQLKGTTQGKIICFHGPPGTGKTSIARSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTRTENPLILIDEIDKLGRGWQGDPASALLELLDPEQNANFLDHYLDVTVDLSRVLFITTANQVEAIPEPLRDRMELIEVAGYVAEEKMAIAQQYLLPQAAKSSGLST---EQVKITDGALQRLIRQYCRESGVRNLQKHIEKVLRKAAYKIVNGDAETPLKVDDDNLSSFVGQPIWITDRLYPPATPPGVVMGLAWTAMGGSVLFIECTNKEPLSNSSSSGDAAN-DGIKGSLQLTGHLGDVMKESVAIAHTFASNFVVSDEVIRQRLENSTTTTF-HAHRFLRDAKIHLHVPQGATPKDGPSAGITMVTALLSLACNLPVRPDLAMTGEISLTGKVLPVGGIKEKVIAAKRVGVKTVILPEMNRKDYEDLADFIKTDLGVHFVSHYSEVFPIAF 992          
BLAST of Lon protease homolog, mitochondrial vs. TrEMBL
Match: A0A0R3X7Y4 (Lon protease homolog, mitochondrial OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS9644 PE=3 SV=1)

HSP 1 Score: 1083.17 bits (2800), Expect = 0.000e+0
Identity = 576/988 (58.30%), Postives = 718/988 (72.67%), Query Frame = 3
Query:   60 KSNKFLQQAQKLSCISRIHTNIQRQYNSPILFVRNSRKLTVNLSFKEFSS---SKIPN--DNNESAEKPVTSTESDGKS-----LFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPP--EIKPSNKKNGFFRK-RKSV----------------------------------DNDXXXXXXXXXXXXXLNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPE-TPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNF-LSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAF 2876
            +S K    A  L+  SR   + +   N+ +L +  +R    N  F  F+S    K P     ++S   P  +  SD  S     L TQN+PE FP VP+I I   PLFPKFVKM+E+TD+ L+ L+RR++KL LPY GVF+KK+P +TS ++  L+++Y VGTF +I + DDM   IR +  GHRRI+IVK + +   + +      + K  NK+NG  R+ RK+                                   + +  +    +T SS     +LMVETIN Y+EP+ NT E+KA++ EIV TIR++I +NP+YRE+V+     Q  +   DNP+YL DLGAA+++ A+  E QA+LEE+ I +RL L+L L+KKELEL  LQ +IG+EVEEKVK QHRKYML EQL+VIK+ELGLEK+DK+A+ EKFRSRL  LTVP+ V EVI+EELNKLS LD HSSEFNVTRNYLDWLTNLPWG++SEE L L+ A+ +L+EDHYG+DDVKKRILEFIAVS LKGSTQGKI+CFHGPPG GKTSIA+SIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKT+TENPLILIDEIDK+G+GWQGDP+SALLELLDPEQN NFLDHYLDVTVDLS+VLFI TAN++E I EPLRDRME+IEV+GY++ EK+AIA+ +L+PQA   SGL+    + + ITD +L+ LIKQYCRESGVRNLQKHIEK++RK+A+ IV+      + V  +NL  FVG+PIW  DRLYP  TP GVV GLAWT MGGS+LFIE T K    + L     K  ++ KGS+ LTG LGDVMKESV+IAHTFA NF +SD T R+    +  T  L A +FLR+A IH+HVP GA  KDGPSAGITMVTAL+SL+ N+PV  ++AMTGE+SLTGKVLPVGGIKEK+IAAKR G+ ++ILP  N+KDY+DL   I   L++HFV+HY+EVFPIAF
Sbjct:   10 RSKKLFSAAYDLT-FSRTMFDNRYISNTRLLNLALTRGQVSNGCFCRFASVNSGKPPEAPPGSDSGASPTGNNPSDMPSQHPFALSTQNIPEIFPCVPIIPIAGHPLFPKFVKMLEITDQSLMELIRRKMKLNLPYAGVFLKKNPNDTSDVVKSLDELYRVGTFVQIAEWDDMGMKIRMLVIGHRRIQIVKAVPDIADDADADSTLNDEKSRNKRNGLLRRVRKAAHLAGLPTEEIPVLKELKEEAASADSTASPPSSPEEGNQDDGSQKQTSSSSSPENLLMVETINVYNEPFENTQEMKALSAEIVKTIRDIINLNPIYRENVLAML--QVGQRVVDNPVYLSDLGAAITAAAEPGELQAVLEETRIPERLRLALNLVKKELELGRLQQQIGQEVEEKVKAQHRKYMLMEQLRVIKRELGLEKDDKEAIAEKFRSRLSGLTVPQAVGEVIEEELNKLSVLDNHSSEFNVTRNYLDWLTNLPWGLTSEENLDLARARVVLDEDHYGLDDVKKRILEFIAVSQLKGSTQGKIICFHGPPGTGKTSIARSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTRTENPLILIDEIDKLGRGWQGDPASALLELLDPEQNVNFLDHYLDVTVDLSRVLFITTANQVEAIAEPLRDRMELIEVAGYVAEEKMAIAQQYLLPQAAKLSGLST---EQVEITDGALQRLIKQYCRESGVRNLQKHIEKVLRKAAYKIVNGETGLPLKVDEDNLHSFVGQPIWITDRLYPPVTPPGVVMGLAWTAMGGSVLFIECTNKEPLSNNLDNADSKKDNDAKGSLQLTGHLGDVMKESVAIAHTFAGNFVVSDETLRQRLQNATTTTSL-AHRFLRDAKIHLHVPQGATPKDGPSAGITMVTALLSLACNLPVRPDLAMTGEISLTGKVLPVGGIKEKVIAAKRVGVKTVILPEMNRKDYEDLADFIKADLAVHFVSHYSEVFPIAF 990          
BLAST of Lon protease homolog, mitochondrial vs. TrEMBL
Match: W6V1C4 (Lon protease homolog, mitochondrial OS=Echinococcus granulosus OX=6210 GN=EGR_05416 PE=3 SV=1)

HSP 1 Score: 1080.09 bits (2792), Expect = 0.000e+0
Identity = 568/983 (57.78%), Postives = 715/983 (72.74%), Query Frame = 3
Query:   87 QKLSCISRIHTNIQRQYNS--------PILFVRNSRKLTVNLSFKEFSSS-KIPNDNNESAEKPVTSTESDGK--------SLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDN--KDLETEKFPPEIKPSNKKNGFFRK----------------------RKSVDNDXXXXXXXXXXXXXLNN-----------RILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPE-TPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAF 2876
            ++L  I+R  T  Q  +N         P+L +R   +      ++  S+S + P D    ++   + T+S           +L TQNVPE FP VP+I+I   PLFPKFVKM+E+TD+ L+ L+RR++K  LPY GVF+KK+P++TS ++  L+++Y VGTF +I + DD    IR +  GHRRI+IVK + +   D        + KP NK+NG FR+                      R+     T E+ ++ +E    N+             LMVETIN Y+EPY NT EIKA++ EIV TIR++I +NP+YRE+V+     Q  +   DNP+YL DLGAA+++ A+  E QA+LEE+ I +RL L+L L+KKELEL  LQ +IG+EVEEKVK QHRKYML EQLKVIK+ELGLEK+DK+A+ EKFR+RL DLTVP+ V EVI+EELNKL  LD HSSEFNVTRNYLDWLT+LPWG++SEE L L+ A+ +L+EDHYG+DDVKKRILEFIAVS LKG+TQGKI+CFHGPPG GKTSIA+SIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKT+TENPLILIDEIDK+G+GWQGDP+SALLELLDPEQN NFLDHYLDVTVDLS+VLFI TAN++E IPEPLRDRME+IEV+GY++ EK+AIA+ +L+PQA  +SGL+    + + ITD +L+ LI+QYCRESGVRNLQKHIEK++RK+A+ IV+   +  + V  +NL  FVG+PIW  DRLYP  TP GVV GLAWT MGGS+LFIE T K    +        + D IKGS+ LTG LGDVMKESV+IAHTFA NF+      + +  ++ T    A +FLR+A IH+HVP GA  KDGPSAGITMVTAL+SL+ N+PV  ++AMTGE+SLTGKVLPVGGIKEK+IAAKR G+ ++ILP  N+KDY+DL   I   L +HFV HY+EVFPIAF
Sbjct:   12 ERLFLIARGPTLNQALFNGRYLSNVSFPVLHLRKIPQAKAGFCYRFSSTSNEKPPDAPSGSDSGASPTDSHSSGMPPQHPFALSTQNVPEIFPCVPIISITGPPLFPKFVKMLEITDQSLMELIRRKMKFNLPYAGVFLKKNPSDTSDVVKSLDELYRVGTFVQIPEWDDTGTKIRMLVIGHRRIQIVKAVPDVAADANVASMSSDEKPRNKRNGLFRRVRKAAHMAGLAAEEIPPVKEVEREETSASTPESASLLSEEESQNDGSDKQKSSSPGNPLMVETINVYNEPYENTQEIKALSAEIVKTIRDIINLNPIYRENVLAML--QVGQRVVDNPVYLSDLGAAITAAAEPAELQAVLEETRIPERLRLALSLVKKELELGRLQQQIGQEVEEKVKAQHRKYMLNEQLKVIKRELGLEKDDKEAIAEKFRARLADLTVPQAVGEVIEEELNKLGVLDNHSSEFNVTRNYLDWLTSLPWGLTSEENLDLARARVVLDEDHYGLDDVKKRILEFIAVSQLKGTTQGKIICFHGPPGTGKTSIARSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTRTENPLILIDEIDKLGRGWQGDPASALLELLDPEQNANFLDHYLDVTVDLSRVLFITTANQVEAIPEPLRDRMELIEVAGYVAEEKMAIAQQYLLPQAAKSSGLST---EQVKITDGALQRLIRQYCRESGVRNLQKHIEKVLRKAAYKIVNGDAETPLKVDDDNLSSFVGQPIWITDRLYPPVTPPGVVMGLAWTAMGGSVLFIECTNKEPLSNSSSSGDAAN-DSIKGSLQLTGHLGDVMKESVAIAHTFASNFVVSDEVIRQRLENSTTTTSHAHRFLRDAKIHLHVPQGATPKDGPSAGITMVTALLSLACNLPVRPDLAMTGEISLTGKVLPVGGIKEKVIAAKRVGVKTVILPEMNRKDYEDLADFIKTDLGVHFVRHYSEVFPIAF 988          
BLAST of Lon protease homolog, mitochondrial vs. TrEMBL
Match: A0A068X4I8 (Lon protease homolog, mitochondrial OS=Echinococcus granulosus OX=6210 GN=EgrG_000324100 PE=3 SV=1)

HSP 1 Score: 1079.32 bits (2790), Expect = 0.000e+0
Identity = 568/983 (57.78%), Postives = 715/983 (72.74%), Query Frame = 3
Query:   87 QKLSCISRIHTNIQRQYNS--------PILFVRNSRKLTVNLSFKEFSSS-KIPNDNNESAEKPVTSTESDGK--------SLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDN--KDLETEKFPPEIKPSNKKNGFFRK----------------------RKSVDNDXXXXXXXXXXXXXLNN-----------RILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPE-TPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAF 2876
            ++L  I+R  T  Q  +N         P+L +R   +      ++  S+S + P D    ++   + T+S           +L TQNVPE FP VP+I+I   PLFPKFVKM+E+TD+ L+ L+RR++K  LPY GVF+KK+P++TS ++  L+++Y VGTF +I + DD    IR +  GHRRI+IVK + +   D        + KP NK+NG FR+                      R+     T E+ ++ +E    N+             LMVETIN Y+EPY NT EIKA++ EIV TIR++I +NP+YRE+V+     Q  +   DNP+YL DLGAA+++ A+  E QA+LEE+ I +RL L+L L+KKELEL  LQ +IG+EVEEKVK QHRKYML EQLKVIK+ELGLEK+DK+A+ EKFR+RL DLTVP+ V EVI+EELNKL  LD HSSEFNVTRNYLDWLT+LPWG++SEE L L+ A+ +L+EDHYG+DDVKKRILEFIAVS LKG+TQGKI+CFHGPPG GKTSIA+SIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKT+TENPLILIDEIDK+G+GWQGDP+SALLELLDPEQN NFLDHYLDVTVDLS+VLFI TAN++E IPEPLRDRME+IEV+GY++ EK+AIA+ +L+PQA  +SGL+    + + ITD +L+ LI+QYCRESGVRNLQKHIEK++RK+A+ IV+   +  + V  +NL  FVG+PIW  DRLYP  TP GVV GLAWT MGGS+LFIE T K    +        + D IKGS+ LTG LGDVMKESV+IAHTFA NF+      + +  ++ T    A +FLR+A IH+HVP GA  KDGPSAGITMVTAL+SL+ N+PV  ++AMTGE+SLTGKVLPVGGIKEK+IAAKR G+ ++ILP  N+KDY+DL   I   L +HFV HY+EVFPIAF
Sbjct:   16 ERLFLIARGPTLNQALFNGRYLSNVSFPVLHLRKIPQAKAGFCYRFSSTSNEKPPDAPSGSDSGASPTDSHSSGMPPQHPFALSTQNVPEIFPCVPIISITGPPLFPKFVKMLEITDQSLMELIRRKMKFNLPYAGVFLKKNPSDTSDVVKSLDELYRVGTFVQIPEWDDTGTKIRMLVIGHRRIQIVKAVPDVAADANVASMSSDEKPRNKRNGLFRRVRKAAHMAGLAAEEIPPVKEVEREETSASTPESASLLSEEESQNDGSDKQKSSSPGNPLMVETINVYNEPYENTQEIKALSAEIVKTIRDIINLNPIYRENVLAML--QVGQRVVDNPVYLSDLGAAITAAAEPAELQAVLEETRIPERLRLALSLVKKELELGRLQQQIGQEVEEKVKAQHRKYMLNEQLKVIKRELGLEKDDKEAIAEKFRARLADLTVPQAVGEVIEEELNKLGVLDNHSSEFNVTRNYLDWLTSLPWGLTSEENLDLARARVVLDEDHYGLDDVKKRILEFIAVSQLKGTTQGKIICFHGPPGTGKTSIARSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTRTENPLILIDEIDKLGRGWQGDPASALLELLDPEQNANFLDHYLDVTVDLSRVLFITTANQVEAIPEPLRDRMELIEVAGYVAEEKMAIAQQYLLPQAAKSSGLST---EQVKITDGALQRLIRQYCRESGVRNLQKHIEKVLRKAAYKIVNGDAETPLKVDDDNLSSFVGQPIWITDRLYPPVTPPGVVMGLAWTAMGGSVLFIECTNKEPLSNSSSSGDAAN-DSIKGSLQLTGHLGDVMKESVAIAHTFASNFVVSDEVIRQRLENSTTTTSHAHRFLRDAKIHLHVPQGATPKDGPSAGITMVTALLSLACNLPVRPDLAMTGEISLTGKVLPVGGIKEKVIAAKRVGVKTVILPEMNRKDYEDLADFIKTDLGVHFVRHYSEVFPIAF 992          
BLAST of Lon protease homolog, mitochondrial vs. TrEMBL
Match: A0A564XXY3 (Lon protease homolog, mitochondrial OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS948 PE=3 SV=1)

HSP 1 Score: 1071.23 bits (2769), Expect = 0.000e+0
Identity = 548/899 (60.96%), Postives = 684/899 (76.08%), Query Frame = 3
Query:  279 SLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDN--KDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXXXXXXXXXXXXXLNNR--------------------------ILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPE-TPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEI---KGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFN 2879
            +L TQN+PENFP VP+I I   PLFPKFVKM+E+TD++L++L+RR++KL +PY GVF+KK+P +TS ++  L+ +Y VGTF +I + DD+   IR +  GHRRI+IVK + +  ++  +E    + K  NK+NG  R+ +   N    +        + ++                           +LMVETIN Y+EP+ NT E+KA++GEIV TIR++I +NP+YRE+V+     Q+ +   DNP+YL DLGAA+++ A+  E QA+LEE+ I +RL LSL L+KKE EL  LQ +IG+EVEEKVK QHRKYML EQLKVIK+ELGLEK+DK+ + EKFR+RL DL VP+ V EVI+EE+NKLS LD HSSEFNVTRNYLDWLTNLPWGI+SEE L LS A+ +L+EDHYG+DDVKKRILEFIAVS LKG+TQGKILCF+GPPG GKTSIA+SIAR LNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKT+TENPLILIDEIDK+G+GWQGDP+SALLELLDPEQN NFLDHYLDVTVDLS+VLFI TAN++E I EPLRDRME+IEV+GY++ EK+AIA+ +L+PQA+  SGL   +   + ITD +L+ LIKQYCRESGVRNLQKH+EK++RK+AF +V+   +  + V  +NL  FVG+PIWT DRLYP  TP GVV GLAWT MGGS+LFIE  C      + K + E + +E    KG++ LTG LGDVMKESV+IAHTFA NF+S   +   +  S      +A  FLR+A IH+HVP GA  KDGPSAGITMVTAL+SL+ N+PV  ++AMTGE+SLTGKVLPVGGIKEK+IAAKR G+ ++ILP  N+KDYDDL   I   L IHFV HY+EVFPIAF+
Sbjct:   87 ALSTQNIPENFPCVPVIPISGPPLFPKFVKMLEITDKNLMDLIRRKMKLNMPYAGVFLKKNPNDTSDVVKSLDDLYRVGTFVQIPEWDDLGTKIRMLVIGHRRIQIVKYVPDVIEETTSETALVDDKSRNKRNGLLRRVRKATNMGVSSTDGTEYVEKTDSEKTEPSSSDSSSSDEEGLSTPPPATEDVLMVETINIYNEPFENTQEVKALSGEIVKTIRDIINLNPIYRENVLAML--QAGQRVVDNPVYLSDLGAAITAAAEPAELQAVLEETRIPERLRLSLNLVKKEHELGRLQQQIGREVEEKVKAQHRKYMLMEQLKVIKRELGLEKDDKETINEKFRTRLSDLKVPQSVMEVIEEEINKLSVLDNHSSEFNVTRNYLDWLTNLPWGITSEENLDLSRARVVLDEDHYGLDDVKKRILEFIAVSQLKGTTQGKILCFYGPPGTGKTSIARSIARTLNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTRTENPLILIDEIDKLGRGWQGDPASALLELLDPEQNVNFLDHYLDVTVDLSRVLFITTANQVEAIAEPLRDRMELIEVAGYVAEEKMAIAQRYLLPQASKASGL---DDGQVEITDGALQRLIKQYCRESGVRNLQKHVEKVLRKAAFKLVNGEAEAPLRVNEDNLPSFVGQPIWTTDRLYPAVTPPGVVMGLAWTAMGGSVLFIE--CINKEPVLKKSVMEGNNEEKTSGKGNLQLTGHLGDVMKESVAIAHTFAGNFVSSDETIISRLESGPITSSQAHNFLRDAKIHLHVPQGATPKDGPSAGITMVTALLSLACNLPVRPDLAMTGEISLTGKVLPVGGIKEKVIAAKRVGVTTVILPEMNRKDYDDLADFIKSDLEIHFVNHYSEVFPIAFS 978          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Cavefish
Match: lonp1 (lon peptidase 1, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-030131-4006])

HSP 1 Score: 1035.79 bits (2677), Expect = 0.000e+0
Identity = 532/862 (61.72%), Postives = 654/862 (75.87%), Query Frame = 3
Query:  297 VPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXXXXXXXXXXXXXLNN--RILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAF 2876
            VPE FPNVPLIA+   P+FP+F+K+IEV ++ L++LLRR+++L  PY GVF+KKD  + S ++ +L+ VY  GTF +I +  D+   +R I  GHRRI+I K++D  D   +       P  K     R   S+ +   E         E      +LMVE  N  HE +  T E+KA+T EIV TIR++I +NPLYRESV+     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ +L L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEKEDKDA+ EKFR RL+D TVP+H+ EVI+EELNKLS LD HSSEFNVTRNYLDWLT++PWG +S E L L  A+++LEEDHYGMDDVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPL+LIDE+DKIG+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN L+TIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQ     GL   +++  +I+ E+L +LI+QYCRESGVRNLQK +EK+ RK+AF IV+   +  +NVT ENLQD+VGKP++T DR+Y  TP GVV GLAWT MGGS LFIET+ +R R       K KD    +GS+ +TGQLGDVMKES  IA+TFA +FL       D              FL  + +H+HVP+GA  KDGPSAG T+VTAL+SL+ N PV QN+AMTGEVSLTGK+LPVGGIKEK IAAKR+G++ IILP ENKKD+ DL   ITEGL +HFV HY E++ I F
Sbjct:  146 VPEVFPNVPLIAVTRNPVFPRFIKIIEVKNKQLMDLLRRKVRLAQPYAGVFLKKDDGDESDVVANLDAVYNTGTFVQIHEMQDLGDKLRMIVMGHRRIRITKQLDVDDESVDSEEESKTPRRKSKRTRRDSASLADSMAERVQDAEFVVEAVPLPEVLMVEVDNVVHEEFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNIPKRLYKALSLLKKEYELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKEDKDAIEEKFRERLKDRTVPQHIMEVINEELNKLSLLDNHSSEFNVTRNYLDWLTSMPWGTNSVENLELVRAQEVLEEDHYGMDDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLVLIDEVDKIGRGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVLDTIPEPLRDRMEMINVSGYVAQEKLAIAEKYLVPQLRVLCGL---DEQKTSISSEALNVLIRQYCRESGVRNLQKQVEKVFRKAAFRIVNGE-ETNVNVTAENLQDYVGKPLFTVDRMYDVTPPGVVMGLAWTAMGGSTLFIETSLRRPRTS-----KGKD-GPSEGSLEVTGQLGDVMKESAKIAYTFARSFLMKHQPEND--------------FLVGSHVHLHVPEGATPKDGPSAGCTIVTALLSLATNTPVRQNVAMTGEVSLTGKILPVGGIKEKTIAAKRAGVDCIILPAENKKDFSDLAEYITEGLEVHFVEHYQEIYKIVF 980          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Cavefish
Match: lonp2 (lon peptidase 2, peroxisomal [Source:NCBI gene;Acc:103035542])

HSP 1 Score: 450.284 bits (1157), Expect = 1.529e-143
Identity = 246/579 (42.49%), Postives = 345/579 (59.59%), Query Frame = 3
Query: 1230 RLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNI-----VSQT----------------VDGIINVTPE--------NLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFN 2879
            ++++  +PE    V  +EL +L  +     E+ +TRNYL+ +  LPW  S+ + L +  A+ +L+ DHY ++ +K+R+LE++AV  LK + +G ILCF GPPGVGKTS+ +SIAR L R++ R ++GG+ D S+I+GHRRTYVG+MPG+II  LK     NP+ L+DE+DK+GK  QGDP++ALLE+LDPEQNH+F DHYL+V  DLS+VLFI TAN   TIP  L DRME+++V GY   EK+ IA   LIP      GL     + L I  ++ + +I +Y RE+GVR+L++ I  I R  A  +     +S+T                VD  I   PE         L+D +G  I+  +     T  GV  GLAWTP+GG I+F+E +         +M       E +G + LTGQLGDVMKES  +A T+          R +      TN    A  L    IH+H P GAV+KDGPSAG+T+VT L SL     V  ++AMTGE++L G VLPVGGIK+K++AA R+G+  IILP  N+KD +++P  I   L        ++V   AF+
Sbjct:  276 KVKEAGMPEPALRVCLKELKRLKKMPQSMPEYALTRNYLELMVELPWSKSTTDCLDIRAARVLLDNDHYALEKLKRRVLEYLAVRQLKSALKGPILCFVGPPGVGKTSVGRSIARTLGREFHRIALGGVCDQSDIRGHRRTYVGSMPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHSFTDHYLNVAFDLSQVLFIATANTTATIPPALLDRMEVLQVPGYTQEEKVEIAHRHLIPHQLEQHGL---TPQQLQIPQDTTQEIISKYTREAGVRSLERKIGAICRAVAVKVAEGHKLSKTESSSESETGQEREGKGVDSDIAAPPEMPIVIDQIALKDILGPQIFEMEVSERLTLPGVAIGLAWTPLGGEIMFVEAS---------RM-------EGEGQLTLTGQLGDVMKESAHLAITWL---------RSNAKTYQLTNIAGCADPLEGNDIHLHFPAGAVTKDGPSAGVTIVTCLASLFSGRLVRSDVAMTGEITLRGLVLPVGGIKDKVLAAHRAGLKRIILPKRNEKDLEEIPGHIRAELDFVTAGTLDDVLNAAFD 826          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Sea Lamprey
Match: lonp1 (lon peptidase 1, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-030131-4006])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 287/385 (74.55%), Postives = 340/385 (88.31%), Query Frame = 3
Query:  819 KAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAK 1973
            +A+T EIV TIR++I +NPLYRESV+     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ +L L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEK+DKDA+ E+ R RL  L VP HV  VI+EEL+KL+ LD HSSEFNVTRNYLDWLT++PWG  SEETL +  A+++LE+DHYGMDD+K RILEFIAVS+L+G+TQGKILCFHGPPGVGKTSIA+SIARALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDE+DKIG+G+QGDPSSALLELLDPEQN NFLDHYLDVT+DLSKVLFICTAN L+TIPEPLRDRMEMI VSGY++ EKLAIA+
Sbjct:    1 QALTAEIVKTIRDIIALNPLYRESVVQMM--QAGQRVIDNPIYLSDMGAALT-GAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIAERMRERLSHLVVPPHVVTVIEEELSKLALLDNHSSEFNVTRNYLDWLTSVPWGRVSEETLKIGRAREVLEQDHYGMDDIKARILEFIAVSHLRGTTQGKILCFHGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIGRGYQGDPSSALLELLDPEQNANFLDHYLDVTIDLSKVLFICTANVLDTIPEPLRDRMEMIAVSGYVAQEKLAIAE 382          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001872.1 (pep scaffold:Pmarinus_7.0:GL476330:398419:420915:-1 gene:ENSPMAG00000001687.1 transcript:ENSPMAT00000001872.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 405.986 bits (1042), Expect = 4.947e-127
Identity = 228/584 (39.04%), Postives = 327/584 (55.99%), Query Frame = 3
Query: 1269 VIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIV----------RKSAFNIVSQTVDGIINVTPENLQDFVG----------KPIWTRDRLYPETP---------------------------EGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFN 2879
            V  +E+ +L  +     EF +TRNYL+ +  LPW   + + L L+ A+ +L+ DHYG++ +K+R+LE++AV  L+   +G ILCF GPPGVGKTS+ +SIAR L R++ R S+GG+ D S+I+GHRRTYVG+MPG++I  +K     NP+ L+DE+DK+GKG QGDP++ALLE+LDPEQN  F DHYL+V  DL +VLFI TAN   TIP  L DRME+I+V GY   EK+ IA   L+P+     GL  A    L+I   S+ L++ +Y RE+GVR+L++ +  +           R            G  +    +LQD +G          +PI   D   PE P                            GV  GLAWTP+GG I+F+E T                  E +G + LTGQLG+VMKES  +A ++  +      +R    +SA       A  L    +H+H P GAV+KDGPSAG  +   L SL        + A+TGE++L G VLPVGGIKEK++AA R+G+  ++LP  N+KD +++  ++ + L +       +V    F+
Sbjct:  313 VCTKEIKRLRKMPQTMPEFALTRNYLELMVELPWSKCTTDRLDLAAARVLLDNDHYGLERLKQRVLEYLAVRQLRPGLRGPILCFVGPPGVGKTSVGRSIARTLGREFHRISLGGICDQSDIRGHRRTYVGSMPGRVISGMKAVGVRNPVFLLDEVDKLGKGLQGDPAAALLEVLDPEQNSTFTDHYLNVPFDLCQVLFIATANATATIPPALLDRMEIIQVPGYTQEEKVEIACRHLVPKQLEQHGLTEA---ELSIPSVSVALIVSRYTREAGVRSLERKVAAVCRAVAVKVAESRGPKSGDAGSHGPGQDHCIEADLQDDLGSAESQEKVQHRPIDPCD--PPEMPIVIDAQALKDILGPPAYEMEVSERLSQPGVAIGLAWTPVGGEIMFVEATRA----------------EGEGQLTLTGQLGEVMKESARLAISWLRS-----NARTYGLVSASGG----ADPLDGWDVHLHFPAGAVTKDGPSAGAAIAVCLASLLSGRTARSDTAITGEITLRGLVLPVGGIKEKVLAAHRAGLKRVVLPRRNEKDLEEVSRVVRDQLDVVLARTLEDVLNATFS 866          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Yeast
Match: PIM1 (ATP-dependent Lon protease; involved in degradation of misfolded proteins in mitochondria; required for biogenesis and maintenance of mitochondria [Source:SGD;Acc:S000000118])

HSP 1 Score: 667.537 bits (1721), Expect = 0.000e+0
Identity = 356/766 (46.48%), Postives = 496/766 (64.75%), Query Frame = 3
Query:  750 NNRILMVETINHYHEPYTNTTE-IKAITGEIVNTIRELIQMNPLYRESVMVHFHS--QSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGW-QGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIV-------------------------------------------SQTVDGI----------INVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAF 2876
            N  + +V  +N   EP+   +  I A+T EI+   +E+ Q+N ++RE +     S   +  N  + P  L D  AA+S+G + +E Q IL   +I+ RL  SL ++KKEL  + LQ+KI K+VE K++++ R+Y L EQLK IK+ELG++      + + ++ R++ L +P+ VQ++ D+E+ KLS L+   SEF V RNYLDWLT++PWG  S+E   +  AK IL+EDHYGM DVK RILEFIAV  L G   GKI+CF GPPGVGKTSI KSIARALNRK+FRFSVGGM+DV+EIKGHRRTY+GA+PG+++Q LKK +T+NPLILIDEIDKIG G   GDPS+ALLE+LDPEQN++FLD+YLD+ +DLSKVLF+CTAN LETIP PL DRME+IE++GY++ +K+ IA+ +L+P A  ++GL      ++++T++++  L+K YCRESGVRNL+KHIEKI RK+A  +V                                            +T D I          ++++ +NL+D+VG P++T DRLY  TP GVV GLAWT MGG  L++E+  ++   +      E+           TGQLGDVMKES  +A++FA  +L+               F E  +F   A IH+H P+GA  KDGPSAG+TM T+ +SL+LN  +   +AMTGE++LTGKVL +GG++EK +AAKRSG  +II P +N  D+++LP  + EGL       YN++F   F
Sbjct:  372 NYNVSLVNVLNLEDEPFDRKSPVINALTSEILKVFKEISQLNTMFREQIATFSASIQSATTNIFEEPARLADFAAAVSAGEE-DELQDILSSLNIEHRLEKSLLVLKKELMNAELQNKISKDVETKIQKRQREYYLMEQLKGIKRELGIDDGRDKLI-DTYKERIKSLKLPDSVQKIFDDEITKLSTLETSMSEFGVIRNYLDWLTSIPWGKHSKEQYSIPRAKKILDEDHYGMVDVKDRILEFIAVGKLLGKVDGKIICFVGPPGVGKTSIGKSIARALNRKFFRFSVGGMTDVAEIKGHRRTYIGALPGRVVQALKKCQTQNPLILIDEIDKIGHGGIHGDPSAALLEVLDPEQNNSFLDNYLDIPIDLSKVLFVCTANSLETIPRPLLDRMEVIELTGYVAEDKVKIAEQYLVPSAKKSAGL---ENSHVDMTEDAITALMKYYCRESGVRNLKKHIEKIYRKAALQVVKKLSIEDSPTSSADSKPKESVSSEEKAENNAKSSSEKTKDNNSEKTSDDIEALKTSEKINVSISQKNLKDYVGPPVYTTDRLYETTPPGVVMGLAWTNMGGCSLYVESVLEQPLHNCKHPTFER-----------TGQLGDVMKESSRLAYSFAKMYLA-------------QKFPE-NRFFEKASIHLHCPEGATPKDGPSAGVTMATSFLSLALNKSIDPTVAMTGELTLTGKVLRIGGLREKAVAAKRSGAKTIIFPKDNLNDWEELPDNVKEGLEPLAADWYNDIFQKLF 1107          

HSP 2 Score: 74.3294 bits (181), Expect = 7.340e-14
Identity = 41/124 (33.06%), Postives = 64/124 (51.61%), Query Frame = 3
Query:  291 QNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKII------DPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPP 644
            ++VPE +P +  + I   PLFP F K + ++DE ++  ++  +    PYIG F+ K+    + +ITD N VY+VG  A+I       D     +++  + Y HRRIKI           E FPP
Sbjct:  173 KDVPEVYPQMLALPIARRPLFPGFYKAVVISDERVMKAIKEMLDRQQPYIGAFMLKNSEEDTDVITDKNDVYDVGVLAQITSAFPSKDEKTGTETMTALLYPHRRIKI----------DELFPP 286          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Yeast
Match: PEX6 (AAA-peroxin; heterodimerizes with AAA-peroxin Pex1p and participates in the recycling of peroxisomal signal receptor Pex5p from the peroxisomal membrane to the cystosol; mutations in human PEX6 can lead to severe peroxisomal disorders and early death [Source:SGD;Acc:S000005273])

HSP 1 Score: 48.9062 bits (115), Expect = 4.135e-6
Identity = 45/172 (26.16%), Postives = 72/172 (41.86%), Query Frame = 3
Query: 1425 EDHYGMDDVKKRILEFIAVS------NLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHR--RTYVGAMPGKIIQCLKKTKTENP-LILIDEIDKIG--KGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPL 1907
            +D  G+D VK  IL+ I +          G  +   + F+GPPG GKT +AK+IA   +  +F            +KG      Y+G     + +  +K +   P +I  DEID +   +G QGD    +  ++        L     ++ D   V  I   NR + + E L
Sbjct:  732 DDIGGIDFVKGEILDTIDMPLKHPELFTSGMKKRSGILFYGPPGTGKTLMAKAIATNFSLNFF-----------SVKGPELLNMYIGESEANVRRVFQKAREAKPCVIFFDEIDSVAPKRGNQGDSGGVMDRIVS-----QLLAELDGMSTDADGVFVIGATNRPDLLDEAL 887          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Nematostella
Match: EDO31613 (Lon protease homolog [Source:UniProtKB/TrEMBL;Acc:A7SXE9])

HSP 1 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 469/872 (53.78%), Postives = 612/872 (70.18%), Query Frame = 3
Query:  324 LIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKI---------VKKIDNKDLETEKFPPEIKPS-----NKKNGFFR-KRKSVDNDXXXXXXXXXXXXXLNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQ---SNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFL--IPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFN 2879
            LI +H  P+FP+FVKM+E+ D+ L++L+R + +L  PY G F+KK+ +N +++++ L+ VY+VG F +I +  DM   +R +  GHRRI+I         V+  +  D +T   PP+ +P+     N+ +G    KR  +                  N ILMV   N  H+P+  T E+KA+  E + TIR++I +NPLY+E     F SQ     +   DNP +L D GAAL+S A+ N+ Q ILEE++I  RL ++L L+KKEL +  LQ ++GKEVEEKV +Q +KY+LQEQLK+IK+ELGLEK+DKDAVGEKFR RL+ L VP H  EVI+EEL KLSFLDAHSSEFNVTRNYLDWLT++PWG+ SEE L +  A+ +L+EDHYG+ D+K RILEFIAVS L  STQGKILCF GPPGVGKTSIAKSIARALNR+YFRFSVGGM+DV+EIKGHRRTY+GAMPGKIIQCLKKTKTENPLILIDE+DKIG+G QGDP+SALLELLDPEQN  FLDHYLDV VD+SKVLFICTAN  +TIP PL+DRMEM+ VSGY+  EK AIAK  +  +  A    G  +  +++++     + + + +   E G    Q+HI+KI RK+A  I   T    I VTP+ L+DFVG P++  DR+Y +TP GVV GLAWT MGGS L+IET+   + D           D+  GS+ +TGQLGDVMKES  IA+TF+  FL+                    KF    PIH+HVP+GA  KDGPSAG T+VTAL+SL+++ PV QN+AMTGE+SLTGKVLPVGGIKEKIIAA+R+G+N +++P  ++++++DLP  + EG+ IHFV+HY ++F I F+
Sbjct:   12 LIPVHRNPVFPRFVKMLEINDKSLMDLVRLKCRLAQPYAGAFLKKEDSNEAEVVSSLDDVYKVGAFVQITEMHDMGNKMRMVILGHRRIQITGVAEDPQHVEAAEKPDKDTPNTPPD-EPTLDVNGNEGDGLVEPKRFDL------------------NPILMVRVENVLHQPFKRTQEVKALAAEAIKTIRDIISLNPLYKE-----FLSQLIEGGKKVVDNPSHLADFGAALTS-AESNQLQEILEETNIPIRLRMTLELLKKELAVCLLQQQLGKEVEEKVSKQQKKYLLQEQLKIIKRELGLEKDDKDAVGEKFRERLKGLHVPAHAMEVIEEELGKLSFLDAHSSEFNVTRNYLDWLTSVPWGMYSEENLDIERARTVLDEDHYGLQDIKDRILEFIAVSQLNRSTQGKILCFTGPPGVGKTSIAKSIARALNREYFRFSVGGMTDVAEIKGHRRTYIGAMPGKIIQCLKKTKTENPLILIDEVDKIGRGVQGDPASALLELLDPEQNAGFLDHYLDVPVDMSKVLFICTANVTDTIPGPLKDRMEMMNVSGYVEDEKKAIAKEHIDKVNIAVHKGGEEMGGQEHID----KVNIAVHKGGEEMGG---QEHIDKIFRKAALKIFQGT--EAIAVTPDALKDFVGNPVFNTDRIYDQTPPGVVMGLAWTSMGGSTLYIETSISEAPD-----------DKKSGSLSMTGQLGDVMKESAQIAYTFSKGFLAKRNPEN--------------KFFNTTPIHLHVPEGATPKDGPSAGSTIVTALLSLAMDKPVRQNVAMTGELSLTGKVLPVGGIKEKIIAARRAGVNCVVVPEGSRREFNDLPDFVKEGIDIHFVSHYEDIFNIVFD 824          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Medaka
Match: lonp1 (lon peptidase 1, mitochondrial [Source:NCBI gene;Acc:101175387])

HSP 1 Score: 1021.92 bits (2641), Expect = 0.000e+0
Identity = 524/901 (58.16%), Postives = 668/901 (74.14%), Query Frame = 3
Query:  225 DNNESAEKPVTSTESDGKSLFT---------QNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEI-------KPSNKKNGFFRKRKSVDNDXXXXXXXXXXXXXLNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFN 2879
            D  + A      +  DG S ++           VPE FPNVPLIA+   P+FP+F+K+IEV ++ L+ LLRR+++L  PY GVF+K+D +N S ++  L+ +Y  GTF +I +  D+   +R I  GHRRI+I +++D    + E+ PPE        +P         +R  +++     +        L++ ILMVE  N  HE +T T E+KA+T EIV TIR++I +NPLYRESV+     Q+ +   DNPIYL D+GAAL+ GA+ +E Q +LEE++I KRL+ +L L+KKE ELS LQ ++G+EVEEK+KQ HRKY+LQEQLK+IKKELGLEK+DK+A+ EKFR RL+D +VP+++ EVI+EEL KL+ LD HSSEFNVTRNYLDWLT++PWG +SEE L L  A+++LEEDHYGM+DVKKRILEFIAVS L+GSTQGKILCF+GPPGVGKTSIA+SIA+ALNR+YFRFSVGGM+DV+EIKGHRRTYVGAMPGKIIQCLKKTKTENPL+LIDE+DKIG+G+QGDPSSALLELLDPEQN NFLDHYLDV VDLSKVLFICTAN  +TIPEPLRDRMEMI VSGY++ EKLAIA+ +L+PQ  +  GL    ++  +I+ ++L LLI+QYCRESGVRNLQK +EK+ RK AF+IVS      + VTP+NLQ+FVGKP++T DR+Y  TP GVV GLAWT MGGS LFIET  +R           KD    +GS+ +TGQLGDVMKES  IA TF+ +FL  M    D +            FL N+ +H+HVP+GA  KDGPSAG T+VTAL+SL+ N  V QN+AMTGEVSLTGK+LPVGGIKEK IAA+R+G+  +ILP EN+KD+ DLP  I+EGL +HFV HY++++PI F 
Sbjct:   86 DGGDEAGSGAEESGGDGGSAYSGPQMTALTPMMVPEVFPNVPLIAVSRNPVFPRFIKIIEVKNKDLMELLRRKVRLAQPYAGVFMKRDDSNESDVVESLDAIYSTGTFVQIHEMQDLGDKLRMIVMGHRRIRINRQLDA---DPEEVPPEWSESEQEPRPKPTIRPKSSRRHQLEDKISVADLSPELQPLLSSNILMVEVDNVQHEQFTVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMM--QAGQRVVDNPIYLSDMGAALT-GAESHELQDVLEETNIPKRLYKALSLLKKEYELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKEAIEEKFRERLKDRSVPQNILEVINEELTKLALLDNHSSEFNVTRNYLDWLTSMPWGTNSEENLALDRAREVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIAKALNRQYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLVLIDEVDKIGRGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQLRSLCGL---TQEKASISPDALSLLIRQYCRESGVRNLQKQVEKVFRKVAFSIVSGH-QSAVTVTPDNLQEFVGKPLFTVDRMYDVTPPGVVMGLAWTAMGGSTLFIETCLRRPAGG----GGAKD----EGSLEITGQLGDVMKESAKIAWTFSRSFL--MKEEPDNN------------FLLNSHLHLHVPEGATPKDGPSAGCTIVTALLSLATNRSVRQNVAMTGEVSLTGKILPVGGIKEKTIAARRAGVTCMILPAENRKDFSDLPDYISEGLEVHFVDHYSQIYPIVFT 954          
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Medaka
Match: lonp2 (lon peptidase 2, peroxisomal [Source:NCBI gene;Acc:101155510])

HSP 1 Score: 457.218 bits (1175), Expect = 3.388e-146
Identity = 247/566 (43.64%), Postives = 348/566 (61.48%), Query Frame = 3
Query: 1248 VPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNI-----VSQTVDGIINVTPEN-----------------LQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFN 2879
            +PE   +V  +EL +L  +     E+ +TRNYLD +  LPW  S+++ L +  A+ +L+ DHY M+ +K+R+LE++AV  LK S +G ILCF GPPGVGKTS+ +SIA+ L R++ R ++GG+ D S+I+GHRRTYVG+MPG+II  LK     NP+ L+DE+DK+GK  QGDP++ALLE+LDPEQNH+F DHYL+V  DLS+VLFI TAN   TIP  L DRME+++V GY   EK+ IA   LIP      GL     + L+I  ES + +I +Y RE+GVR+L++ I  I R  A  +     + +T    +  +P+                  L+D +G P++  +     T  GV  GLAWTP+GG I+F+E +         +M       E +G + LTGQLGDVMKES   AH  A+++L     R +      TN + A   L    IH+H P GAV+KDGPSAG+T+VT L SL     V  +IAMTGE++L G VLPVGGIK+K++AA R+G+  +ILP  N+KD ++LP  +   L      + +EV   +F+
Sbjct:  290 MPEAALKVSLKELKRLKKMPQSMPEYALTRNYLDLMVELPWSRSTKDCLDIRAARVLLDNDHYAMEKLKRRVLEYLAVRQLKTSLKGPILCFVGPPGVGKTSVGRSIAKTLGREFHRIALGGVCDQSDIRGHRRTYVGSMPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHSFTDHYLNVAFDLSQVLFIATANTTATIPPALLDRMEVLQVPGYTQEEKVEIAHRHLIPNQLEQHGL---TPQQLHIPQESTQDIICRYTREAGVRSLERKIGAICRAVAVKVAEGHRLPETDASSLETSPQQEDKAAPPEMPIVIDQMALKDILGPPLFELEVSERLTLPGVALGLAWTPLGGEIMFVEAS---------RM-------EGEGQLTLTGQLGDVMKES---AH-LAISWL-----RANAKTYQLTNMVGAPDPLEGTDIHLHFPAGAVTKDGPSAGVTIVTCLASLFSGRLVRSDIAMTGEITLRGLVLPVGGIKDKVLAAHRAGVKRVILPKRNEKDLEELPANVRAQLDFVTAGNLDEVLNASFD 827          
BLAST of Lon protease homolog, mitochondrial vs. Planmine SMEST
Match: SMESG000079071.1 (SMESG000079071.1)

HSP 1 Score: 1904.03 bits (4931), Expect = 0.000e+0
Identity = 953/954 (99.90%), Postives = 954/954 (100.00%), Query Frame = 3
Query:   42 MYKVFTKSNKFLQQAQKLSCISRIHTNIQRQYNSPILFVRNSRKLTVNLSFKEFSSSKIPNDNNESAEKPVTSTESDGKSLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDXXXXXXXXXXXXXLNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIXXXXXXXXXXXXAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFNHSEKEMEA 2903
            MYKVFT+SNKFLQQAQKLSCISRIHTNIQRQYNSPILFVRNSRKLTVNLSFKEFSSSKIPNDNNESAEKPVTSTESDGKSLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDTKETETVETESSELNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIKKELGLEKEDKDAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFNHSEKEMEA
Sbjct:    1 MYKVFTRSNKFLQQAQKLSCISRIHTNIQRQYNSPILFVRNSRKLTVNLSFKEFSSSKIPNDNNESAEKPVTSTESDGKSLFTQNVPENFPNVPLIAIHSTPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITDLNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFPPEIKPSNKKNGFFRKRKSVDNDTKETETVETESSELNNRILMVETINHYHEPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNPIYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQHKIGKEVEEKVKQQHRKYMLQEQLKVIKKELGLEKEDKDAVGEKFRSRLQDLTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEETLVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGVGKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVTVDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSAFNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPMGGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSIAHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKDGPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAAKRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFNHSEKEMEA 954          
The following BLAST results are available for this feature:
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LONP10.000e+060.25lon peptidase 1, mitochondrial [Source:HGNC Symbol... [more]
LONP10.000e+060.48lon peptidase 1, mitochondrial [Source:HGNC Symbol... [more]
LONP10.000e+060.25lon peptidase 1, mitochondrial [Source:HGNC Symbol... [more]
LONP10.000e+059.79lon peptidase 1, mitochondrial [Source:HGNC Symbol... [more]
LONP10.000e+061.90lon peptidase 1, mitochondrial [Source:HGNC Symbol... [more]
back to top
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lonp-10.000e+049.84Lon protease homolog, mitochondrial [Source:UniPr... [more]
lonp-25.055e-12739.67Lon protease homolog 2, peroxisomal [Source:UniPr... [more]
back to top
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Lon9.749e-2565.44gene:FBgn0036892 transcript:FBtr0074967[more]
Lon1.070e-2465.44gene:FBgn0036892 transcript:FBtr0273410[more]
back to top
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lonp10.000e+066.48lon peptidase 1, mitochondrial [Source:ZFIN;Acc:ZD... [more]
lonp21.091e-14342.06lon peptidase 2, peroxisomal [Source:NCBI gene;Acc... [more]
lonp15.820e-10182.39lon peptidase 1, mitochondrial [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LONP10.000e+062.27lon peptidase 1, mitochondrial [Source:NCBI gene;A... [more]
LONP10.000e+062.27lon peptidase 1, mitochondrial [Source:NCBI gene;A... [more]
LONP10.000e+062.22lon peptidase 1, mitochondrial [Source:NCBI gene;A... [more]
LONP10.000e+062.08lon peptidase 1, mitochondrial [Source:NCBI gene;A... [more]
LONP10.000e+062.08lon peptidase 1, mitochondrial [Source:NCBI gene;A... [more]
back to top
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lonp10.000e+059.66lon peptidase 1, mitochondrial [Source:MGI Symbol;... [more]
Lonp28.366e-14442.12lon peptidase 2, peroxisomal [Source:MGI Symbol;Ac... [more]
Lonp22.058e-13743.07lon peptidase 2, peroxisomal [Source:MGI Symbol;Ac... [more]
Lonp29.996e-9541.22lon peptidase 2, peroxisomal [Source:MGI Symbol;Ac... [more]
Lonp29.996e-9541.22lon peptidase 2, peroxisomal [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Lon protease homolog, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CGK3|LONM_MOUSE0.000e+059.66Lon protease homolog, mitochondrial OS=Mus musculu... [more]
sp|Q924S5|LONM_RAT0.000e+060.18Lon protease homolog, mitochondrial OS=Rattus norv... [more]
sp|P36776|LONM_HUMAN0.000e+060.25Lon protease homolog, mitochondrial OS=Homo sapien... [more]
sp|Q59HJ6|LONM_BOVIN0.000e+059.95Lon protease homolog, mitochondrial OS=Bos taurus ... [more]
sp|Q7KUT2|LONM_DROME1.073e-2365.44Lon protease homolog, mitochondrial OS=Drosophila ... [more]
back to top
BLAST of Lon protease homolog, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068Y1B00.000e+059.56Lon protease homolog, mitochondrial OS=Echinococcu... [more]
A0A0R3X7Y40.000e+058.30Lon protease homolog, mitochondrial OS=Hydatigena ... [more]
W6V1C40.000e+057.78Lon protease homolog, mitochondrial OS=Echinococcu... [more]
A0A068X4I80.000e+057.78Lon protease homolog, mitochondrial OS=Echinococcu... [more]
A0A564XXY30.000e+060.96Lon protease homolog, mitochondrial OS=Hymenolepis... [more]
back to top
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lonp10.000e+061.72lon peptidase 1, mitochondrial [Source:ZFIN;Acc:ZD... [more]
lonp21.529e-14342.49lon peptidase 2, peroxisomal [Source:NCBI gene;Acc... [more]
back to top
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lonp10.000e+074.55lon peptidase 1, mitochondrial [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000001872.14.947e-12739.04pep scaffold:Pmarinus_7.0:GL476330:398419:420915:-... [more]
back to top
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PIM17.340e-1446.48ATP-dependent Lon protease; involved in degradatio... [more]
PEX64.135e-626.16AAA-peroxin; heterodimerizes with AAA-peroxin Pex1... [more]
back to top
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO316130.000e+053.78Lon protease homolog [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Lon protease homolog, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lonp10.000e+058.16lon peptidase 1, mitochondrial [Source:NCBI gene;A... [more]
lonp23.388e-14643.64lon peptidase 2, peroxisomal [Source:NCBI gene;Acc... [more]
back to top
BLAST of Lon protease homolog, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000079071.10.000e+099.90SMESG000079071.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025331 ID=SMED30025331|Name=Lon protease homolog, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=3005bp
TTTAAAATAACGAGACTTACCATCAGGTTACATTAACATTAATGTATAAA
GTATTCACAAAGTCCAACAAATTTCTTCAACAAGCTCAAAAATTATCATG
TATTTCGAGAATCCATACAAATATCCAGAGACAGTATAATTCACCCATTT
TGTTTGTTAGAAATAGCAGAAAATTGACCGTTAATTTGTCATTTAAAGAG
TTTTCCTCATCAAAGATTCCGAATGACAATAATGAATCTGCTGAGAAACC
TGTTACGTCAACTGAGTCTGATGGAAAATCACTTTTTACTCAAAATGTGC
CAGAAAATTTTCCCAATGTCCCATTAATTGCAATTCATTCGACACCATTG
TTTCCAAAATTTGTAAAAATGATTGAAGTGACGGATGAACATTTGGTTAA
TTTATTGAGGAGACGAATCAAATTAGGACTACCATATATAGGTGTTTTTG
TGAAAAAAGATCCAACTAATACTTCTCAAATAATTACTGACTTGAATCAA
GTTTATGAAGTTGGGACATTTGCTAAAATAATAGATCCAGATGATATGCT
ACAAAGCATTCGTTTTATTAGTTATGGCCATAGAAGGATTAAAATAGTAA
AAAAAATTGATAACAAAGACTTGGAAACGGAAAAGTTCCCACCTGAAATA
AAACCATCGAATAAAAAAAACGGATTTTTTAGAAAGCGTAAATCGGTTGA
TAATGATACTAAAGAAACCGAGACAGTAGAAACGGAAAGTTCTGAATTAA
ACAACCGAATTTTAATGGTAGAAACTATTAATCATTACCATGAACCGTAT
ACAAACACAACTGAAATCAAGGCTATTACTGGTGAAATCGTAAATACTAT
TCGAGAATTAATTCAAATGAATCCTTTGTACAGAGAAAGTGTAATGGTAC
ATTTTCACAGCCAAAGTAACAGAAATGAAGCCGATAATCCAATTTATCTC
TGTGACTTAGGCGCGGCTTTAAGTAGTGGTGCAGACATTAATGAATGTCA
AGCAATTTTGGAAGAATCAGATATTAAAAAAAGATTATTCTTATCTCTTG
GGCTTATTAAGAAAGAATTAGAGTTAAGTCATTTACAACATAAAATAGGA
AAAGAAGTTGAAGAAAAAGTTAAGCAACAACATAGGAAATATATGCTGCA
AGAACAGCTTAAAGTAATTAAAAAAGAATTAGGATTGGAGAAAGAAGATA
AAGATGCTGTGGGTGAAAAGTTTAGATCGAGATTGCAGGATTTAACGGTT
CCTGAACATGTTCAAGAAGTAATTGATGAGGAGTTGAATAAATTGAGCTT
CTTGGATGCACATTCTTCGGAATTCAACGTTACCAGGAATTACTTAGATT
GGTTGACAAATTTGCCATGGGGTATTTCCAGCGAGGAAACCTTAGTCTTA
TCGCCAGCTAAAGATATTCTGGAAGAAGATCATTATGGCATGGATGATGT
TAAAAAGAGGATTCTTGAGTTTATTGCTGTTAGCAATCTGAAAGGGTCCA
CACAAGGGAAAATTCTTTGTTTCCATGGACCTCCTGGAGTTGGTAAGACT
AGTATAGCAAAGTCTATCGCAAGAGCACTTAATCGTAAATATTTTAGATT
CTCAGTTGGAGGAATGTCAGATGTATCAGAGATTAAAGGACACCGTAGAA
CGTATGTTGGTGCCATGCCTGGCAAGATAATACAATGTCTAAAGAAAACA
AAGACAGAAAATCCATTAATACTTATCGATGAGATTGATAAAATTGGTAA
AGGATGGCAAGGGGATCCTTCTAGCGCACTTCTTGAATTATTAGATCCTG
AGCAAAATCACAATTTCCTCGATCATTATCTTGATGTTACAGTAGATTTA
AGCAAAGTATTATTTATATGCACCGCAAACCGTCTTGAAACAATTCCTGA
GCCTCTAAGAGATCGAATGGAAATGATTGAAGTTTCAGGTTATATAAGCT
ACGAAAAACTAGCTATTGCTAAGAGTTTTTTAATTCCTCAAGCTACTGCA
AATTCAGGTTTGAATATTGCCAATAAGAAAAATCTAAATATCACCGACGA
ATCTTTGGAACTACTCATTAAACAATATTGCCGTGAAAGTGGGGTCAGAA
ATCTTCAGAAACATATCGAAAAGATTGTGCGCAAATCCGCTTTTAACATC
GTCAGTCAAACTGTAGATGGAATCATTAATGTCACACCTGAAAATTTACA
AGATTTTGTTGGTAAACCTATTTGGACCAGAGACAGGTTATATCCAGAAA
CCCCTGAGGGTGTAGTGACTGGTCTTGCCTGGACTCCAATGGGAGGCTCA
ATTCTTTTTATTGAAACTACATGCAAACGAAGTCGTGATGACATTCTCAA
AATGATTAAGGAGAAAGACCTAGATGAAATTAAAGGTTCCATTGTTCTCA
CTGGCCAGTTGGGAGACGTCATGAAAGAGTCTGTATCGATTGCTCACACA
TTCGCTATGAACTTCTTATCGGATATGACATCGAGAAAAGATAAACATTT
ATCGGCGGAAACTAATTTTCTCGAGGCAGCAAAATTTCTCAGAAATGCTC
CAATTCATATTCACGTTCCTGATGGAGCTGTTTCTAAAGACGGGCCTTCG
GCTGGTATCACGATGGTTACAGCATTGGTTAGTTTATCCCTGAATATTCC
TGTTACTCAAAACATTGCTATGACTGGAGAAGTTTCTCTTACTGGTAAAG
TTCTTCCTGTTGGGGGAATTAAAGAAAAAATAATTGCTGCTAAAAGATCT
GGAATCAATTCGATTATTTTACCGAATGAAAACAAAAAAGATTACGATGA
TTTACCGACTATGATTACTGAAGGGTTGTCTATTCATTTTGTGACTCACT
ACAACGAAGTATTTCCAATTGCATTTAATCATTCGGAAAAAGAAATGGAG
GCATAGTTATTCATAATAAATATTGTCTTTGTTATTTATTTCTATTTGCT
TTTTTGTACGTGTTGATGGGTTTTTACATTTAGAATACAAAGTGCAAAAT
CTAAA
back to top

protein sequence of SMED30025331-orf-1

>SMED30025331-orf-1 ID=SMED30025331-orf-1|Name=SMED30025331-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=955bp
MYKVFTKSNKFLQQAQKLSCISRIHTNIQRQYNSPILFVRNSRKLTVNLS
FKEFSSSKIPNDNNESAEKPVTSTESDGKSLFTQNVPENFPNVPLIAIHS
TPLFPKFVKMIEVTDEHLVNLLRRRIKLGLPYIGVFVKKDPTNTSQIITD
LNQVYEVGTFAKIIDPDDMLQSIRFISYGHRRIKIVKKIDNKDLETEKFP
PEIKPSNKKNGFFRKRKSVDNDTKETETVETESSELNNRILMVETINHYH
EPYTNTTEIKAITGEIVNTIRELIQMNPLYRESVMVHFHSQSNRNEADNP
IYLCDLGAALSSGADINECQAILEESDIKKRLFLSLGLIKKELELSHLQH
KIGKEVEEKVKQQHRKYMLQEQLKVIKKELGLEKEDKDAVGEKFRSRLQD
LTVPEHVQEVIDEELNKLSFLDAHSSEFNVTRNYLDWLTNLPWGISSEET
LVLSPAKDILEEDHYGMDDVKKRILEFIAVSNLKGSTQGKILCFHGPPGV
GKTSIAKSIARALNRKYFRFSVGGMSDVSEIKGHRRTYVGAMPGKIIQCL
KKTKTENPLILIDEIDKIGKGWQGDPSSALLELLDPEQNHNFLDHYLDVT
VDLSKVLFICTANRLETIPEPLRDRMEMIEVSGYISYEKLAIAKSFLIPQ
ATANSGLNIANKKNLNITDESLELLIKQYCRESGVRNLQKHIEKIVRKSA
FNIVSQTVDGIINVTPENLQDFVGKPIWTRDRLYPETPEGVVTGLAWTPM
GGSILFIETTCKRSRDDILKMIKEKDLDEIKGSIVLTGQLGDVMKESVSI
AHTFAMNFLSDMTSRKDKHLSAETNFLEAAKFLRNAPIHIHVPDGAVSKD
GPSAGITMVTALVSLSLNIPVTQNIAMTGEVSLTGKVLPVGGIKEKIIAA
KRSGINSIILPNENKKDYDDLPTMITEGLSIHFVTHYNEVFPIAFNHSEK
EMEA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0051131chaperone-mediated protein complex assembly
GO:0006508proteolysis
GO:0006515misfolded or incompletely synthesized protein catabolic process
GO:0007005mitochondrion organization
GO:0007568aging
GO:0009725response to hormone
GO:0010044response to aluminum ion
GO:0030163protein catabolic process
GO:0034599cellular response to oxidative stress
GO:0043623cellular protein complex assembly
GO:0051260protein homooligomerization
GO:0051603proteolysis involved in cellular protein catabolic process
GO:0070407oxidation-dependent protein catabolic process
GO:0001666response to hypoxia
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR004815Lon_bac/euk-typ
IPR027065Lon_Prtase
IPR003593AAA+_ATPase
IPR003111Lon_substr-bd
IPR008269Lon_proteolytic
IPR027417P-loop_NTPase
IPR014721Ribosomal_S5_D2-typ_fold_subgr
IPR003959ATPase_AAA_core
IPR008268Peptidase_S16_AS
IPR015947PUA-like_sf
IPR020568Ribosomal_S5_D2-typ_fold
Vocabulary: molecular function
TermDefinition
GO:0004176ATP-dependent peptidase activity
GO:0004252serine-type endopeptidase activity
GO:0005524ATP binding
GO:0003677DNA binding
GO:0003697single-stranded DNA binding
GO:0003727single-stranded RNA binding
GO:0008233peptidase activity
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
GO:0016887ATPase activity
GO:0043531ADP binding
GO:0043565sequence-specific DNA binding
GO:0051880G-quadruplex DNA binding
GO:0070182DNA polymerase binding
GO:0070361mitochondrial light strand promoter anti-sense binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005739mitochondrion
GO:0005759mitochondrial matrix
GO:0005829cytosol
GO:0016020membrane
GO:0042645mitochondrial nucleoid
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00830ENDOLAPTASEcoord: 900..918
score: 44.8
coord: 877..896
score: 70.9
coord: 496..515
score: 73.85
coord: 847..866
score: 62.44
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 454..631
e-value: 5.5E-70
score: 236.6
NoneNo IPR availableGENE3DG3DSA:1.20.58.1480coord: 252..383
e-value: 4.8E-28
score: 99.9
NoneNo IPR availableGENE3DG3DSA:1.10.8.60coord: 632..728
e-value: 4.6E-27
score: 95.8
NoneNo IPR availableGENE3DG3DSA:2.30.130.40coord: 88..197
e-value: 1.1E-12
score: 49.6
NoneNo IPR availablePANTHERPTHR43718:SF2LON PROTEASE HOMOLOG, MITOCHONDRIALcoord: 78..949
NoneNo IPR availableCDDcd00009AAAcoord: 465..629
e-value: 3.07633E-15
score: 71.7935
IPR003111Lon, substrate-binding domainSMARTSM00464lon_5coord: 92..341
e-value: 3.4E-27
score: 106.4
IPR003111Lon, substrate-binding domainPFAMPF02190LON_substr_bdgcoord: 92..340
e-value: 5.1E-27
score: 95.1
IPR003111Lon, substrate-binding domainPROSITEPS51787LON_Ncoord: 93..341
score: 28.821
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 488..633
e-value: 7.0E-15
score: 65.4
IPR004815Lon protease, bacterial/eukaryotic-typeTIGRFAMTIGR00763TIGR00763coord: 94..945
e-value: 0.0
score: 1042.0
IPR004815Lon protease, bacterial/eukaryotic-typePIRSFPIRSF001174Lon_proteascoord: 79..249
e-value: 1.5E-5
score: 21.1
coord: 217..949
e-value: 3.3E-252
score: 836.7
IPR003959ATPase, AAA-type, corePFAMPF00004AAAcoord: 492..629
e-value: 2.2E-24
score: 86.4
IPR008269Peptidase S16, Lon proteolytic domainPFAMPF05362Lon_Ccoord: 714..945
e-value: 1.2E-64
score: 217.7
IPR008269Peptidase S16, Lon proteolytic domainPROSITEPS51786LON_PROTEOLYTICcoord: 736..947
score: 68.497
IPR014721Ribosomal protein S5 domain 2-type fold, subgroupGENE3DG3DSA:3.30.230.10coord: 730..954
e-value: 2.1E-82
score: 277.6
IPR027065Lon proteasePANTHERPTHR43718FAMILY NOT NAMEDcoord: 78..949
IPR008268Peptidase S16, active sitePROSITEPS01046LON_SERcoord: 850..858
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 455..733
IPR015947PUA-like superfamilySUPERFAMILYSSF88697PUA domain-likecoord: 92..193
IPR020568Ribosomal protein S5 domain 2-type foldSUPERFAMILYSSF54211Ribosomal protein S5 domain 2-likecoord: 740..945