Neurogenic locus notch protein

Overview
NameNeurogenic locus notch protein
Smed IDSMED30025325
Length (bp)7560
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neurogenic locus notch protein (SMED30025325) t-SNE clustered cells

Violin plots show distribution of expression levels for Neurogenic locus notch protein (SMED30025325) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neurogenic locus notch protein (SMED30025325) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neurogenic locus notch protein (SMED30025325) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025325

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30025325SMESG000063217.1 dd_Smed_v4_7067_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025325SMESG000063217.1 dd_Smed_v4_7067_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025325SMESG000063217.1 dd_Smed_v4_7067_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025325SMESG000063217.1 dd_Smed_v4_7067_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025325SMESG000063217.1 dd_Smed_v4_7067_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025325SMESG000063217.1 dd_Smed_v4_7067_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025325SMESG000063217.1 dd_Smed_v4_7067_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025325SMESG000063217.1 Contig41892newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025325SMESG000063217.1 Contig41892uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30025325SMESG000063217.1 dd_Smed_v4_7067_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30025325SMESG000063217.1 SMED30025325smed_20140614PMID:28807895
Sasidharan et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neurogenic locus notch protein vs. Ensembl Human
Match: NOTCH2 (notch receptor 2 [Source:HGNC Symbol;Acc:HGNC:7882])

HSP 1 Score: 991.875 bits (2563), Expect = 0.000e+0
Identity = 699/2117 (33.02%), Postives = 1032/2117 (48.75%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKK-MECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAI--CHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTA-ALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRK-AEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKF---------ADLFNKNELSNNSLITILT----------SRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKE------NQQHRPLMWGXXXXXXXXXXXXXHPVDLKTVLYSSPHSLQPMSCCVYPNSLPQDSIEFKSKNMGFYNPAMSIQNQSNPSCFRSNQIGSFMNQPHESVKKRLTTH--TSPNLLSS 6656
            ++ C NH+C+NG  C   +N  Y C C   + G +C E    C + P  CQNGGTC    G   C C+N W G+ C E   +CA + C  G  C    +  + C CP+   G+ C L ++C S NPC     C     +G+  C C +GY G  C+ D+DECA   +  CE+ G C+NT G++ C+C  G+ G RCE DI +C +D C+N  TCLDKIG + C+C   + G +CE +   C+  PC N G C D    +QC+C   +TG  C  D+ +             +  N   Y+C C  GF G +CE +IDNC    C +G  C + I+   C C PG+ G  C   ++EC + PC N+ +CIDL N Y C+C  G +G NCEIN D+C  NPC++G  C D +  ++C C  GF G RC    D C    PC+    C+N  N   G++CICP+G  +  C  ++++C +  CI+G C    +  KC+C  G+ G  CE++ NEC +NPCQ+G  C +L N Y C C  GFKG  C++NI+ECA NPC   G C D++ G+ C C+LPY+G  C   L PC+PN C N A+C     ++SY C C+     ++G +C  D+DEC                       PC+N   C NT GS++C+C   + G  CE+ +++C  NPC+NG +C +  + F C C+ GFTG++C+ ++NEC   PC N   C D++N Y C CQ+GF G +CE N N+CTESSC   G CVD +N F C C   + G+ C H    C S+PCLN+G+C++         Y C+C  G+TG  C+  ++ C  +PC + G C       +C C S + G  C++       S  +   +   L+  +C+H G C N   T    C C  GY GS+CE  +D+CAS PC +G  C D  G Y C+C PG+QGVNC+   +EC +  C N G CID +N+F C CP G  G  CE  +D C +   C NGG C + IG + C C  GFAG+ CE DINEC  N              PCS  G+L+C+     + C C+  FTG++CET +D C +      +PC N G C        G    F C CP G+ G RC+     C    C+    C    +      +C CP          D  + C S+ C + GSC          C C     G +CE+  +  +              + C    CA KA + +CD  CN +AC +DGG+C            +++ +PW+NC    S  +PC ++ NN+ CD  CNT  CLFD ++C      C    +C  H+ D  C   CN+ EC +DG DC   +   +  G ++++ +   E + +     L++L  LLH+ +RI R+S G+ M++    + E S +   +   +RSL    +Q   G+KV+LE+DN  C   S  CF N+++AA  + + A+      P V ++S      P R +                L+ L  +  V+  F+        K+ RK   +W PEG   L +  S  NHKR         Q+ +   N S ++     +     ++   VDD G                          +E+  LLS  D  ++  P    + H++  + R   +                     T  + +Q +   +L + V   D              +DL +++E + +S   I+T          ++   +GE  LHLAA+Y+R +AA+ LL+AG+D N  +  GR  L  A+ A A  V    +  +  V DL  +  +G+T LI A + A   ++  L+        D+N  D++G++ALHWAA         LLL  G NRD QDN+E TPL+LA +EG  E  KIL+ + AN D++DH+DRLPRDVA+      IV LL++Y N+T             P++ G    +          + LK        S +P +    P SLP  + E K         ++S + Q + S    + + S +  PH  V    ++   TSP +L +
Sbjct:  261 IDDCPNHRCQNGGVCVDGVN-TYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCID-RVASFSCMCPEGKAGLLCHLDDACIS-NPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPN--GYECQCATGFTGVLCEENIDNCDPDPCHHG-QCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGI-CMDGINRYSCVCSPGFTGQRCNIDIDECAS-NPCRKGATCINGVN---GFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPG---WQGQRCTIDIDECISK--------------------PCMNHGLCHNTQGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVD-----GLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAGAYCDVPNV----SCDIAASRRGVLVEHLCQHSGVCINAGNT--HYCQCPLGYTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGERCEGDINECLSN--------------PCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQ------MPCLNGGTCAVASNMPDG----FICRCPPGFSGARCQ---SSCGQVKCRKGEQC----VHTASGPRCFCPS-------PRDCESGCASSPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPP-----------ATCLSQYCADKARDGVCDEACNSHACQWDGGDC-----------SLTMENPWANC----SSPLPCWDYINNQ-CDELCNTVECLFDNFECQGNSKTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTNLRIKRDSQGELMVYPY--YGEKSAAMKKQRMTRRSLPGEQEQEVAGSKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLT--PERTQ----------------LLYLLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFT-LRRDAS--NHKR----REPVGQDAVGLKNLSVQVSEANLIGTG--TSEHWVDDEGPQP-------------------KKVKAEDEALLSEEDDPIDRRP--WTQQHLEAADIRRTPSLAL------------------TPPQAEQEV--DVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIITDLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQILIRNR--VTDLDARMNDGTTPLILAARLAVEGMVAELINCQA----DVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEY-NVTPSPPGTVLTSALSPVICGPNRSF----------LSLKHTPMGK-KSRRPSAKSTMPTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSPVDS-LESPHTYVSDTTSSPMITSPGILQA 2178          

HSP 2 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 443/1305 (33.95%), Postives = 647/1305 (49.58%), Query Frame = 3
Query:  453 CKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTC--KLIAGNNVCQCLNEWVGEFCEFSSN---CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETP-LCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIG-SYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCI--DLNNDYTCDCPEGLTGKNCEINIDECT---PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCE--TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQL----------NVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACG---FDGGECLHRV 4271
            C N   C +  NG   C+C  G+ G YC+ +  C    CQNGGTC  + + G   C+C + + GE C++S++     S PC NGG C  L    YEC C   + G  C+  ++C S +PC  NG        +  C C  G+TG  C  D++EC   + P  C++GGTC+N  GSYQC+C  GF G+ C++  V C    C NGGTC      ++ C C   + G+ CE     C    C+NGG+C D    Y C C  QWTG+ C +DV           NG   +     Y C+C  G+ G  C  +ID+C   SC  G +CI+ +    C C P  +        + C + PC   A C    LN  Y C CP+G  G +C  ++DEC     NPC +  +C +  G F C+CL+G+ G RCE   + C    PC+ +  CL   +   G+ C+C  G +  +C+ E+++C++  C+ NGQCVD  N  +C+C PGF G  C+I+I++C + PC +G++C D  N Y C C  GF G  CE NI+ C  +PC  +GQC D +  + C C   Y G  C++++D C  + C ND  CI  +  + Y CNC        G  CE + D+C  +                    PC++   C++    + C CS  + G++C   ++ C +NPCR GATC N  +GFRC C  G     C  ++NEC  NPC +   C   ++ Y+C+C +G+ G NCE++ N+C  + C   G C + VNG+ C C + + G NC+     C SNPCLN+G+C +     +  GY C+C   +TG  C+  +  C  NPC +  VC+   + +S+ C C   + G+RC I   E               I+K C +HG C N    G + C C  G+ G  CE +IDDC + PC NGG C DG   + C C PGF G  CQ + NEC S  C N G C D +N+++C C  G  G  CE  ++ C +  C NGG C + I  F C CP GF G  C  +INEC  +              PC   GT  C+D  GT+ CSC   +TGK C+T ++ C +       PC N G C+ K            C+CP+G+ G  C + +  C +          ++C+++G+C    I+   +  C+CP G  G +CE + ++EC S  C +  +C +  G   C C  G  G  CE     C      N  T  D ++  + + C       +C+   +  A G    +GG+C+ R+
Sbjct:   35 CVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLS-HPC-ANGSTCTTVANQFSCKCLTGFTGQKCETDVNEC---DIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMC-PEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHS-DPCQNDATCL---DKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCH-HGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCI--DLVNGYQCNCQPGT---SGVNCEINFDDCASN--------------------PCIH-GICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQVNECLSNPCIH-GNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFD-----DISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDE--------------CISKPCMNHGLCHN--TQGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSH--------------PCLNEGT--CVDGLGTYRCSCPLGYTGKNCQTLVNLCSRS------PCKNKGTCVQKKAES-------QCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVC----INAGNTHYCQCPLGYTGSYCE-EQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCS-CPPGTRGLLCEENIDDCARGPHCLNGGQCMDRI 1245          

HSP 3 Score: 595.504 bits (1534), Expect = 3.174e-173
Identity = 420/1232 (34.09%), Postives = 604/1232 (49.03%), Query Frame = 3
Query:  444 NHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSP--CRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDC--TNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCES--VNYQDYKCICQRGFEGKMCETSIDNCQKIS---CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVN--GFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCE 4097
            +  C NG TC       Y C C  G+ G  C+    C   PC NG TC  +A    C+CL  + G+ CE   N    P  C++GG C +L    Y+CQCP+ + G  C+      + +PC   G C    D   +C+C  G+ G+TC  +ID+C ++    C+NGG C++ V +Y C+C   + G+ C  D+ +C    + C+NGGTC ++ G Y CVC N + G +C      C    C  G  C D    + C+C     G  C  + + C  NPC     C++  +N Q Y C C +G++G  C   +D C   +   C + G C+N      C CL G+ G  CE+++NEC + PCQN+A C+D    +TC C  G  G +CE+ I+EC  NPC+N  +C D+V  F C C  GF G  C+   D C   TPC     C++  N   GY+C C  G     C++ +  C    C +GQC D  +   CIC PG+ G  C  +I+EC+++PC +  +C DL N Y C C PG  G  CEIN ++CA NPC ++G C+D +  + C C   ++G  C   +D C  N C   A CI  N  + + C C    G +  S C   V+EC                +SN    PC++ N C      + C C + + G  CE   N C +NPC+NG TCDNL +G+RC C  GF G  C++ I+EC  NPC N   C D I+ Y C C   ++GKNC+     C+ + C     C +  N   + C C   + G  C      C S PC+N G C N + +     Y+C C  GF+G  CE  +D C  NPC + G C   +++F C C   + G++C+    E               +++ CK+ G C +      + C CQ+G+ G  CE NI++C    C NGG C DG   + C C  GF G  C    NEC S+ C N G C+D +  + C CP G +G+ C+T+V+ C +  C+N G C     + +C CP G+AG  C  D+     +IA +   ++      C  +G   C++   T +C C   +TG YCE ++D C       + PC +   C     + +G    + C C  GY G  C+    +CQ   C+N G C    ID    FKC CPPG  GL CE +  +      C N G C++  G   C C  G  GE+CE
Sbjct:  112 SRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLP-GSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHR---CQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLC-HLDDACISNPCHKGALCDTNPLNGQ-YICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSS-TPCLNGAKCIDHPN---GYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPC-IHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCI--NGVNGFRCICPE--GPHHPS-CYSQVNEC----------------LSN----PCIHGN-CTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGS-----YMCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNE--------------CLSEPCKNGGTCSD--YVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAGAYC--DVPNVSCDIAASRRGVLV--EHLCQHSGV--CINAGNTHYCQCPLGYTGSYCEEQLDEC------ASNPCQHGATC----SDFIG---GYRCECVPGYQGVNCEYEVDECQNQPCQNGGTC----IDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGERCE 1262          

HSP 4 Score: 550.821 bits (1418), Expect = 1.520e-158
Identity = 395/1177 (33.56%), Postives = 559/1177 (47.49%), Query Frame = 3
Query:  408 FCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIH-KYECQCPKNYLGMNC-ELPNSC--GSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQ-------------------------------------GFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDL--FNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCD----------SNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQP-CINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTG---KCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGIC---KNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPH---------------GPCSPTGTLECLDRPGTFHCSCKKYFTGKYCE 3701
            FC   +     + + C+NG TC ++ NG Y C C  G+ G  C E   +C    C  G TC     +  C C     G  C     C S+PC  G +C +  ++ +Y C CP+ Y G +C E  + C   + NPC   GKC+   DG   C C KGY G  C  DI+EC S     C+N  TC++ +G + C C  GF G  CE +I +C ++ C N G C+DK+  ++C+CP  + G  C+     C   PC NG  C D    Y+C C   +TG  C++           ++G C+      Y CIC  G+ G +C   ID C    C N G CI+++ G +CNC PG  G NCEIN ++C + PC +   C+D  N Y+C C  G TG+ C I+IDEC  NPC  GA C + V GF C C +                                     G+VG+ CE   + C    PC+    C N+ N   GY+C C  G +  NC+  + +C +  C+N G C D  +   C C+  + G+ C+  +  C  NPC++ + C++   F  Y C+C PG++G++C I+I+EC   PC  +G C +    + C+C   +SG  C   +D C  N C N   C+ G   +++ C C   L  + G KC+ D++EC  +                    PC N   C +   S+ CKC + ++G  CE  +N C  + C NG TC +  + F C C  GFTG  C  EINEC  +PC N+  C+D +  Y+C C  G++GKNC+   N C+ S C   G CV K    +C C   + G  C+     CD           + C + G CIN     NT  + C C  G+TG  CE ++D C  NPC     C   +  ++C+C   Y G  CE         Y V++ +N+      C++ G C +      FKCSC  G  G  CE NIDDCA  P C+NGG+C D  G Y C+C PGF G  C+ + NEC SN C++     CI   N++ CVC    +GR CET VD C +M C NGG C    N+   F C CP GF+G  C++   + K        +  S P                 PC   G+     +P  + C C   F+G  CE
Sbjct:  294 FCTEDVDECLLQPNACQNGGTC-ANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCV-NTDGAFHCECLKGYAGPRCEMDINECHSDP---CQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGVLCEE-NIDNCDPDPCHHGQCQD-GIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGI-CMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLS-NPCQNGGTCDNLVN---GYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDG--VNTFSCLC---LPGFTGDKCQTDMNECLSE--------------------PCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAG---NT--HYCQCPLGYTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCE---------YEVDECQNQP-----CQNGGTCID--LVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGERCEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCASSPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCE 1412          

HSP 5 Score: 459.529 bits (1181), Expect = 1.035e-129
Identity = 354/1054 (33.59%), Postives = 503/1054 (47.72%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDR--VGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQ-IGP-----------------------------CLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESS-CLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGS--CINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETD---LDSFKCKCNSEYIGERCEI-------KKTETCKSYA--------VEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNI-------DDCASQPCIN---GGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINN 3380
            + +N C +  C+N ATC   I G + C C  G+KG +CE + N C   PC N G C        C C   + G  C+    +C+S+PC NG  C     + YECQC   + G+ CE        +PC  +G+C    D    C CN GY G  CS+ IDEC  Y +P C N G CI+ V  YQC C+ G +G  CE +  DC ++ C + G C+D I  Y CVC   + G  C      C   PC+ G  C +    ++CIC       +C   +    ++    +G C       YKC+C  G+ G  CE   + C    C NGG+C N++ G +C C  GF+G NC++N++EC + PC N   C D  + YTC C    TGKNC+  +  C+PNPC N A C++      +TC C  G+ G RC    D C    PC    +C   +NT+  Y C CP G    +C++++  C    C N G C+D  N   C+C+PGF G  C+ ++NEC + PC++G  C D  N Y C C  GF G  CE NINEC  + C   G C+D +  F C C + ++G  C ++++ C+ + C N+  C+ G    +Y C+C      Y G  C+  V+ C+  R+     G  V   + SQ + P                             C +   CIN   +  C+C   Y G  CE+ L+ C +NPC++GATC +   G+RC CV G+ G  CE E++ECQ+ PC N   CID +N ++C C  G  G  CE N +DC     CL  GQC+D++ G+ C+C   + G  CE     C SNPC ++GS  CI     Q T  YLC CR  FTG  CE  +D C   PC + G C       D F C+C   + G RC+        +K E C   A          +       +  C+H G+C    +   + C C   + GS CE+           C SQ C +    G C +    + C+    + G +C +     ++N  +   C D INN
Sbjct:  455 MDINECHSDPCQNDATCLDKIGG-FTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCID-HPNGYECQCATGFTGVLCEENIDNCDPDPCH-HGQCQDGID-SYTCICNPGYMGAICSDQIDEC--YSSP-CLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIH-GICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYS-QVNECLSNPCIHGNCTG-GLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECIS-KPCMNHGLC---HNTQGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVDG--LGTYRCSCPLG---YTGKNCQTLVNLCS--RSPCKNKGTCVQKKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLGYTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGERCEGDINECLSNPCSSEGSLDCI-----QLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCASSPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPPATCLSQYCADKARDGVCDEACNSHACQ----WDGGDCSLTMENPWANCSSPLPCWDYINN 1478          

HSP 6 Score: 181.415 bits (459), Expect = 1.417e-44
Identity = 140/442 (31.67%), Postives = 199/442 (45.02%), Query Frame = 3
Query: 2823 PCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVC--ETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNEC-YSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGD--FECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSC-VNGF-GKAICHCNKGSCGEKCEITGSACNLA 4124
            PC+N+G C+      N  GY C C  GF G  C+ + D C  N C + G C  +  L    C+C S + GE C+   +  C             +++ C + G C        ++C+CQ G+ G  C+   D C S PC NG  C      + CKC  GF G  C+ + NEC     C + G C++   ++ C CP+G +G++C+++   C    C NGG C+   GD  FECNC  GF G  CE +I++C              P+  C   G   C+D   T++C C   +TG++C   +D C     +    C N G C N       RN  + C+C NG+ G+ C  N   C    C     C    ID   SF C CP G  GL C +D  + C+S  C+    C  N   G+ IC C +G  G  C      C +A
Sbjct:   34 PCVNEGMCVTY---HNGTGY-CKCPEGFLGEYCQHR-DPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPC------------FVSRPCLNGGTCHML-SRDTYECTCQVGFTGKECQW-TDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQT-GDFTFECNCLPGFEGSTCERNIDDC--------------PNHRCQNGGV--CVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNA----CQNGGTCAN-------RNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTC----IDRVASFSCMCPEGKAGLLCHLD--DACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMA 422          
BLAST of Neurogenic locus notch protein vs. Ensembl Human
Match: NOTCH1 (notch receptor 1 [Source:HGNC Symbol;Acc:HGNC:7881])

HSP 1 Score: 982.63 bits (2539), Expect = 0.000e+0
Identity = 688/2031 (33.87%), Postives = 987/2031 (48.60%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYC--------KKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECL-STKCYNNGSCVNGFGKAI--CHCNKGSCGEKCEITG-SACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIF------------SIRVFAEN-SNSDSSKSRQKRSLSNSVQQGKP-----------GTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNAS------SELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNF----PPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQHRPLMWG 6350
            ++ C  + CKNG  C   +N  Y C C   + G YC E    C + P  CQNGGTC    G   C C+N W GE C E   +CAS+ C +G  C    +  + C+CP    G+ C L ++C S NPC     C     +G+  C C  GYTG  CS D+DEC+    P CE+ G CINT+GS++C+C  G+ G RCE D+ +C ++ C+N  TCLD+IG ++C+C   Y G +CE     C   PC + G C D   ++QC C   +TG  C  DV               +  N   Y C+C  G+ G  CE  ID C    C  G SC + +    C C PG+ G++CE N+NEC ++PC++   C D +N Y C C +G TG NCEIN+D+C  +PC +G  C D++ G+ C C  G+ G  C    D C    PC     C +  N   G+ C CP+G  +  C  E+++C +  C++G C D  N  KC C PG+ G  C+I  NEC +NPC +G  C+D+ + Y+C C  GF G  C+ NINECA NPC   G CID+V G++C C+LPY+G TC   L PC P+ C N   C     Y+S+ C C T    ++G  CE D++EC             VLS       PC +   C NT+G + C C + Y GR CE  +++CR NPC NG +C +  +   C C+ GF G  CE +INEC  +PC N A C D ++ Y C C +GFSG +CE N  DCTESSC   G CVD +N F C C   + G+ C+H    CDS PCL+ G+C           Y C C +G+TGP C+  + WC  +PC + G C      ++C+C S + G  C++       S  V   +    + ++C+H G C +   T    C CQ+GY GS+CE  +D+C+  PC NG  C D  G Y CKC  G+ GVNC    +EC S+ C N G C+D  N + C CPRG  G  CE  VD C        +  +C N G C + +G + C CP GF G+ CE D+NEC  N              PC   GT  C+ R   FHC C+   TG+ CE+ I+ C+        PC N G C        G    F C CP G+ G  C+ +++ C    C N G C    I    S  C C     G  C+    + CL    CYN G+C          C C     G  C I   S    A  D      +E   CEL +C   A NK+C L+CN +ACG+DGG+C            ++   PW NC    ++++ C  +F++  CD QCN+  CLFDG+DC  A GQC PL   +C  H++DG C   CN+ EC +DG DC E     +  G ++++ +   E +       L+ L+ +LH+ V   R+++GQQMIF             I+  AE  +  D+   + K SL     +G             G+ VYLE+DN  C   S  CF ++   A F+ A     S   P  I +VQ+      +  EPP       + +     + +        +  K     ++ +  ++W+PEG K    + S+   +  +  +    + L N  + +      +E G+    TK K    + V     +  T  R  + +                   L   D+ M+     PP+  +      +  R  + +    IA+   SG GL   +  E  D   ++   +    +  ++T++                         +GET LHLAA+Y+R +AA+ LLEA +D N  +  GR+ L  A+ A A  V    +  +    DL  +  +G+T LI A + A   +++ L+        D+N  D+ G++ALHWAA         +LL  G N+D Q+N E TPL+LA +EG  E  K+L+ + AN D++DH+DRLPRD+A+      IV LL++Y N+ +  Q H   + G
Sbjct:  258 IDDCPGNNCKNGGACVDGVN-TYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHD-RVASFYCECPHGRTGLLCHLNDACIS-NPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANP-CEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNT--YTCVCTEGYTGTHCEVDIDECDPDPCHYG-SCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGT-CLDKIDGYECACEPGYTGSMCNINIDECAG-NPCHNGGTCEDGIN---GFTCRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTG---WQGQTCEVDINEC-------------VLS-------PCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTC-----QDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSV----SCEVAAQRQGVDVARLCQHGGLCVDAGNT--HHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSN--------------PCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCK------GKPCKNGGTCAVASNTARG----FICKCPAGFEGATCENDARTCGSLRCLNGGTC----ISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDIPPPLIEEA--CELPECQEDAGNKVCSLQCNNHACGWDGGDC-----------SLNFNDPWKNC----TQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRELDPMDVRGSIVYLEIDNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQS------ETVEPPPPAQLHFMYVAAAAFVLLFFVGCGVLLSRK-----RRRQHGQLWFPEGFKV--SEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQNEWGDEDLETK-KFRFEEPVVLPDLDDQTDHRQWTQQH------------------LDAADLRMSAMAPTPPQGEVDADCMDVNVRGPDGFTPLMIAS--CSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDR-------------------------TGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNR--ATDLDARMHDGTTPLILAARLAVEGMLEDLINSHA----DVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEY-NLVRSPQLHGAPLGG 2131          

HSP 2 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 425/1242 (34.22%), Postives = 615/1242 (49.52%), Query Frame = 3
Query:  453 CKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLI----AGNNVCQCLNEWVGEFC--EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIG-SYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCI--DLNNDYTCDCPEGLTGKNCEINIDECT--PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCET--DLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQL----------NVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKC 4094
            C NG  C++  NG   C C   + G  C+  + C  TPC+N GTC ++      +  C C   + G  C     + C ++PCRNGG C  L + +Y+C+CP  + G +C+  + C S NPC   G+C L  +    CHC   + G TC  D++EC   +  LC +GGTC N VGSY+C C+A   G  CE   V C+   C+NGGTC      ++ C C   + G NCE     C    CKNGG C D    Y C C  +WTG+ C +DV     +     NG      +  Y C+C  G+ G+ C  +ID+C   +CF+G +C + +    C C P           + C + PC   + C    +N    C CP G TG  C  ++DEC+   NPC +  +C + +G F CQCLQG+ G RCE   + C    PC+ +  CL+       ++CIC  G +  +C+    +C +  C+ NG+C+D  NE +C C  GF G  C+ +++EC + PC++G++C D  N Y C+C  G+ G  CE++I+EC  +PC   G C D V  F C C   Y+G  C   ++ C+   C +   C   ++ ++Y C C   L    G  CE ++D+C                       PC +   C++    + C C   Y G  C   ++ C  NPC NG TC++  +GF CRC  G+    C  E+NEC  NPC + A C D +N Y+C C  G+SG NC+IN+N+C  + C+  G C D  +G+ C C E + G NC+     C SNPCLN+G+CI+     +  GY CNC   +TG  CE+ +  C  +PC + G C    D +SF C C + + G+ CE+   E               +   C+H  +C N    GG++C CQ+GY G  CE +IDDC   PC NGG C DG    FC C PGF+G  C+ + NEC S+ C  G  C D +++++C CP G SG  CE     C +  C NGG C + I  F C CP GF G  C+ D+NEC                 PC   GT  C D  G++ C+C + +TG  C+  + +C+      + PC N G C   +         + C CP+G+ G  C + S  C++           +C++ G+C    +D   +  C C  G  G +CE D V+EC  + C N  +C +  G   C C  G  G  C
Sbjct:   31 CLNGGKCEA-ANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCAS-NPCANGGQC-LPFEASYICHCPPSFHGPTCRQDVNECGQ-KPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCEC-PHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVS-NPCQNDATCLDQIGE---FQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHY-GSCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQ--DRDNAYLCFC---LKGTTGPNCEINLDDC--------------------ASSPC-DSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGA-CRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCID-----DVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINE--------------CVLSPCRHGASCQN--THGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQ--------------PCLHGGT--CQDGCGSYRCTCPQGYTGPNCQNLVHWCD------SSPCKNGGKCWQTHT-------QYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLC----VDAGNTHHCRCQAGYTGSYCE-DLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNC 1180          

HSP 3 Score: 474.167 bits (1219), Expect = 3.315e-134
Identity = 373/1098 (33.97%), Postives = 514/1098 (46.81%), Query Frame = 3
Query: 1029 DTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDE----DYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKP--CQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFT--CQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNI--VCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLP--YSGPTCANKLDPCN--PNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTE----------TCKS-------YAVEKFKNESLINKICK------HHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNV--IGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGIC-----------------------LNKYQNEVGRNY--------NFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCE 4097
            +TC NGG C    G+  CVC   + G  C++    C   PCKN G C   D     DY C C   ++G  C   + N C  NPC+N G C+ +   +YKC C  G+ GK C+ + D C    C NGG C+       C+C P F G  C  +VNEC  KP  C++   C +    Y C C    TG NCE     C+P+PC NG  C    G  T  C CL GF G  CE   D C     CK    C++  NT   Y C CP     Q C +++ +C+ +   C N G C + +    C+C+ G+ G  C   I++C +  C HG+ C D    + C C  G  G  C +N + C  NPC     C       +  C  P  Y+GP C+  +D C+   N C +   CI  N   S+ C C   L  Y G +CE DV+EC                +SN    PC ND  C++  G F C C   YEG  CE   + C ++PC +   C +  + F+C C  GFTG  C+ +++EC   PC N AKC+D  N Y C+C  G++G +CE++ ++C    C  +G C D V  F C C   Y G +CE     C S PC + G+C +R        YLC C +G TGP CEI +D C  +PC D G C   +D ++C C   Y G  C I   E          TC+           E + + + ++++ +       HG C +     G+KC C  G+ G+ C++N ++C S PC+NGG C D T  Y C C+ GF G NCQ N NEC SN C N G CID +  + C C    +G  CE ++  C    C+NGG C+       F C CP G+ G+ CE DINEC  +              PC    +  C +  G + C C+  ++G+ CET ID C         PC N G C                       +N+  ++  RN         +++C CP G+ G  C+ N+  C  + C N G C    +D   SF C CPPG  G +C+ D VNEC S  C + G+C +G G   C C +G  G  C+
Sbjct:   29 ETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNP-CLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQA-DPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRP-TGDVTHECACLPGFTGQNCEENIDDCPGNN-CKNGGACVDGVNT---YNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGRTGLLCHLN-DACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCI--NTLGSFECQC---LQGYTGPRCEIDVNEC----------------VSN----PCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCH-YGSCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDN-----AYLCFCLKGTTGPNCEINLDDCASSPC-DSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGACRD--SLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLS--------------PCRHGAS--CQNTHGGYRCHCQAGYSGRNCETDIDDCRPN------PCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTC----VDGINSFTCLCPPGFTGSYCQHD-VNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQ 1057          

HSP 4 Score: 443.351 bits (1139), Expect = 1.311e-124
Identity = 339/1030 (32.91%), Postives = 487/1030 (47.28%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCEL------PNSCG-------------------------------SQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCT--------ESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGS--CINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDS---FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGEC-GDGT-------GMYFCKCQPGFQGVNCQV 3317
            I +N C ++ C+N ATC   I G++ C C  GY+G +CE  ++ C  +PC + G C        C+C   + G  C++  + CAS+PC+NG  C     + Y C C + Y G +CE+      P+ C                                S  PC   G C    D    C C KG TG  C  ++D+CAS       + GTC++ +  Y+C C+ G+ G  C  +I +C  + C NGGTC D I  + C CP  Y    C ++   C   PC +G  CRD    Y+C C   W+G NCD   N C+ NPC N G C+ +    Y C C+ GF G  C+T+I+ C    C N G+CI+ + G KCNCL  + G  CE+ +  C   PC+N  +C    +   ++C CP G  G+ CE++I+EC  +PC +GA C++  GG+ C C  G+ G  CET  D C+   PC     C +  NT     C C  G +   C++++++C +  C NG  C D  +   C C  GF G  CE    +C  + C +G  C D  N + C+C PGF G  C+ ++NEC   PC   G C D    +RC C   Y+GP C N +  C+ + C N   C     +  Y C C +    + G  C+     C +   +    G+ V  +       C +   C++   +  C+C + Y G  CE  ++ C  +PC+NGATC +   G+ C+CVAG+ G  C  EI+EC  +PC N   C+D  N Y+C C  G  G +CEIN +DC            C  +G CVD+V G+ C C   ++G  CE     C SNPC  +G+  C+ R VN     + C CR G TG RCE  ++ C+G PC + G C    ++   F CKC + + G  CE     TC S               C + G C + P +    C C   + G  C+      AS PC+ G  C   GT         Y C C   F G+ C +
Sbjct:  451 IDVNECVSNPCQNDATCLDQI-GEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLD-GPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTC-QDRDNAYLCFCLKGTTGPNCEINLDDCASSPC----DSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGA-CRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMT-SGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRP-NPCHNGGSCTDGINTAF---CDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCW--QTHTQYRCECPSG---WTGLYCDVPSVSCEVAAQR---QGVDVARL-------CQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQR-VND----FHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCE-NDARTCGSLR-------------CLNGGTCISGPRSP--TCLCLGPFTGPECQFP----ASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHI 1427          

HSP 5 Score: 202.216 bits (513), Expect = 5.649e-51
Identity = 173/587 (29.47%), Postives = 241/587 (41.06%), Query Frame = 3
Query:  411 CPIAISLNFCENHKCKNGATCQSDIN-----------------GKYVCECAYGYKGTYCEQKS-NCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCE-LPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYE-------TPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNC--------QKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPC--QNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC---EDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINE-CF-NNPCQHGSQCQDLFND--YLCICLPGFKGKKCEI 2039
            C   I+  FC+      G  C+ DIN                   Y C C  G+ G +CE  + +C  + C NGGTC     +  C C   + G +C+   N C S PC +GG C+      Y C CP+ Y G NC+ L + C S +PC   GKC   +  + +C C  G+TG  C      C             LC++GG C++   ++ C+C+AG+ G  CE+ + +C+   C+NG TC D +G Y C C   Y G NC  +   C   PC+NGG C D    Y+C                                        C RG +G  CE ++D+C        +   CFN G+C++ + G  C C PGF G  CE +VNEC + PC  +    C+   ND+ C+C  G TG+ CE  I+ C   PC NG  C    +   GF C+C  GF G  CE  +  C  L        CLN                                 G C+       C+C+  F G  C+   +  C   NPC +   C+       Y C+C   F G  C I
Sbjct:  922 CTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQD-GCGSYRCTCPQGYTGPNCQNLVHWCDS-SPCKNGGKCWQTHT-QYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKC---------------------------------------SCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCGSLR-------CLN--------------------------------GGTCISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHI 1427          
BLAST of Neurogenic locus notch protein vs. Ensembl Human
Match: NOTCH3 (notch receptor 3 [Source:HGNC Symbol;Acc:HGNC:7883])

HSP 1 Score: 870.152 bits (2247), Expect = 0.000e+0
Identity = 653/2076 (31.45%), Postives = 937/2076 (45.13%), Query Frame = 3
Query:  438 CENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPI-TPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSS-NCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDG--EVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFG---------------------TNCENKRTLCELKPCKNGGIC-RDFDE-------------------DYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKL--DPCNPNACYNDAICIPGNKYDSYHCNCSTAL-------------------GR----------------YEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKK-------MECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGT-FHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVN-------ECLSTKCYNNGSCVNGFGKAI--CHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC---PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISK--LCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKP-EPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKR-LVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQH 6332
            C +  C +GA C    +G+++C C  GY+G  C    + C +  PC++GGTC    G+  CQC   + G  CE  +  CA SPCRNGG C+      Y+C C   + G NCE+       + C   G C+   DG     C C   +TG  C+ D+DEC   +   C NGGTC NT+G + C C  G+ GE C  +I DC    C +G TC D++ S+ C CP    G                     TN  N R +C   P   GG C +D DE                    + C CG  +TG  C+   N C   PC+N   C     Q + CIC  GF G  CE  ID CQ   C NGG C + + G  C C  GF G+ C+++V+EC + PC+N AKC+D  + Y C C EG  G  C+ N+D+C+P+PC +G RC D +  F+C C  G+ G RCE++ D C+   PC+    CL++ +    Y C CP G    NC+  +  C +  C  G C D  N   C+C PGF G  C +EINEC ++PC  G  C D  N + C+C PG     C    + CAH PC  +G C D   GFRC C   +SGP C+  L  D C    C     C   +    +HC C   +                   GR                ++G +C++DVDEC                   +   PC     C N  GSF C C   Y G  C++ +N+C  NPC NG +C +    F C C+ GF G RC  +++EC  NPC     C DH+  + C C  G+ G +CE +  DC+ SSC   G CVD VN F C C   Y G +C+H   PC S PCL+ G C     +   PG+ C C   FTGP+C+  +DWC   PC + G C        C C   + G  C+I+    C+  A +       + ++C+  G C +  E     C C  G  GS CE  +D C +QPC +GG C    G Y C+C PG+ G NC+ + +EC S  C + G CID +  + C CP G  G  CE   D C           C + G C +++G F C CP G+ G  CE DINEC+               G C    T +CL  PG  F C C   F+G  C+T +  CE      + PC + G C  +     G    F+C C   + G RC+  ++ C+   C     C+      R    C CPPG+ G  C     +        C +  C + GSC          C C +G  G +CE   +A  ++          E   C    C +K  ++ CD ECN   CG+DGG+C            +S+  PW  CE ++     C   FNN RCDP C++ ACL+D +DC     +    P+ + +C  H+ADG+C   CNT EC +DG DC     + +  G+++L  +   E + R     LQ L+ +L + +R   +++GQ M+F       +  S  S+ R +R L+  V     G+ V LE+DN  C    +   CF ++ SAA+++ A    +    P P+  V       R +P EPP         +  L +L     +L   +        +K   + +W+PEG        S    +R  V  +    +N+    +   E+      T+   +    V++ G  +  +     +                          H     + R+   M L  P+            + V+  G   F+P             L+   T +DE +  +     + +   + +   T R   +GET LHLAA+Y R +AA+ LL+AG+D N  + +GR+ L TA+ A A  V    +  ++   DL  +  +GST LI A + A   +++ L+        D+N  DE G++ALHWAA          LL  G N+D QD++E TPL+LA +EG  E  K+L+ + AN +++DHLDRLPRDVA+      IV LL+           H
Sbjct:  123 CLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGEPCRHGGTCLNTPGSFRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCV---DGVNTYNCQCPPEWTGQFCTEDVDEC-QLQPNACHNGGTCFNTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQ-FTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGTLCDRNVDDCSPDPCHHG-RCVDGIASFSCACAPGYTGTRCESQVDECRS-QPCRHGGKCLDLVDK---YLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCS-HGICYDAPGGFRCVCEPGWSGPRCSQSLARDACESQPCRAGGTC--SSDGMGFHCTCPPGVQGRQCELLSPCTPNPCEHGGRCESAPGQLPVCSCPQGWQGPRCQQDVDEC-------------------AGPAPCGPHGICTNLAGSFSCTCHGGYTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSNPC-GPGTCTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQHEADPCLSRPCLHGGVC-----SAAHPGFRCTCLESFTGPQCQTLVDWCSRQPCQNGGRCVQT--GAYCLCPPGWSGRLCDIRSL-PCREAAAQIGVR---LEQLCQAGGQCVD--EDSSHYCVCPEGRTGSHCEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGGSCIDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGLRCEADINECR--------------SGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPCE------SQPCQHGGQC--RPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPVGVPCQQTPRGPR----CACPPGLSGPSCRSFPGSPPGASNASCAAAPCLHGGSCRPAPLAPFFRCACAQGWTGPRCEAPAAAPEVS----------EEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDC-----------SLSVGDPWRQCEALQ-----CWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPY-----HRPSPGSEPRARRELAPEVI----GSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDV-------RGEPLEPPE------PSVPLLPLLVAGAVLLLVILVLGVMVARRKREHSTLWFPEGFSLHKDVASGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMGAEEAVDCRQWT------------------------QHHLVAADIRVAPAMALTPPQGDA-----DADGMDVNVRGPDGFTPLM---LASFCGGALEPMPTEEDEADDTSASIISDLICQGAQLGARTDR---TGETALHLAARYARADAAKRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRS--TDLDARMADGSTALILAARLAVEGMVEELIASHA----DVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAAREGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPH 2037          

HSP 2 Score: 561.222 bits (1445), Expect = 2.188e-162
Identity = 399/1244 (32.07%), Postives = 586/1244 (47.11%), Query Frame = 3
Query:  561 TPCQNGGTC-KLIAGNNVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEI---HKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIG-SYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCI--DLNNDYTCDCPEGLTGKNCEINIDECT--PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSG-YKCICPDGVQN--CKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNC--EINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYL--CNCRRGFTGPRCEIKMDWCRG-NPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTE----------TCKSYAVEKFKNESLIN----KICKHHGNCFNDP--------ETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNEC-------LSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQT 4145
            +PC NGG C +L +    C C   WVGE C+    C S PC   G+C+S  +    ++ C+CP+ + G +C LP+ C S +PC    +C +  DG   C C  GY G +C +D+DEC   E   C +GGTC+NT GS++C+C AG+ G  CEN  V C    C+NGGTC      +Y C C   + G NCE     C    C NGG C D    Y C C  +WTG+ C +DV          +NG         + C+C  G+ G+ C  +ID+C    CF+G +C + +    C C P  +        + C + PC  +A C    +N    C CP G TG  C+ ++DEC+   NPC +  RC +  G F CQC +G+ G RCET  + C    PC+ +  CL+    R G + CIC  G     C+ ++ +C++  C+NG  C D  N   C C  GF G TC+++++EC + PC++G++C D  + Y C C  GF+G  C+ N+++C+ +PC  +G+C+D +  F C C   Y+G  C +++D C    C +   C+  +  D Y C C +      G  CE ++D+C  +     +                     C +    + C C   + G  C   +N C ++PC  G +C +  +GFRC C  G     C    + C H PCS+   C D    ++C+C+ G+SG  C   +  + C    C   G C     GF C C     G  CE L  PC  NPC + G C      ++ PG L  C+C +G+ GPRC+  +D C G  PCG  G+C     SF C C+  Y G  C+    +          +C+   V  F    L      +  +    C ++P            F C+C  GYGG  CE ++ DC+   C NGG C DG   + C C+PG+ G +CQ   + C S  C + G C      F C C    +G  C+T+VD+C +  CQNGG C  V     C CP G++G+LC+     C+   A     L       C   G  +C+D   + +C C +  TG +CE  +D C         PC + G C        G    + C C  GY G+ C+ +  +C    C++ G C    ID    + C CPPG  G+ CEI+  ++C          +C +NG+CV+  G   C C  G  G +CE   + C   +   + T
Sbjct:   47 SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLS-SPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGEP--CRHGGTCLNTPGSFRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCAC-PMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLS-GPCRNQATCLD----RIGQFTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGTLCDRNVDDCSPDPC-HHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCL--DLVDKYLCRCPSGT---TGVNCEVNIDDCASNPCTFGV---------------------CRDGINRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCSH-GICYDAPGGFRCVCEPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGRQCELLS-PCTPNPCEHGGRC------ESAPGQLPVCSCPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGGYTGPSCDQDINDCDPNPCLNGGSCQD-GVGSFSCSCLPGFAGPRCARDVDECLSNPCGPGTCTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQHEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQTLVDWCSRQPCQNGGRC--VQTGAYCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQL----CQAGG--QCVDEDSSHYCVCPEGRTGSHCEQEVDPCLA------QPCQHGGTCR-------GYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGGSC----IDLVARYLCSCPPGTLGVLCEINE-DDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGLRCEADINECRSGACHAAHT 1219          
BLAST of Neurogenic locus notch protein vs. Ensembl Human
Match: NOTCH4 (notch receptor 4 [Source:HGNC Symbol;Acc:HGNC:7884])

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 550/1970 (27.92%), Postives = 793/1970 (40.25%), Query Frame = 3
Query:  777 CGS-QNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGS--------------YQCKCKAGFNGERCENDIVD-CTNDTCKNGGTC-LDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGK----CNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECT---PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSK-CKNIVCI-NGQCV--DVNNEEKCICIPGFEGRTCEIEINECF-----NNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEI---NECQHNPCSNDAK------CID-----------------HINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCI------------------------------------------------NGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNEC--LSTKCYNNGSC--VNGFGKA--ICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCPL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSI--RVFAENSNSDSSKSRQKRSLSNSVQQGK------PGTKVYLEVDNNNCKT--ISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNI----EAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLE 6296
            CGS   PC   G C+  + G+  C C  G+ G TC    D C + +  LC+NGG+C   + +              + C C  GF GERC+  + D C    C   G C +   G  +C C   + G  C+  R  C   PC NGG+C       QC C   + G  C+ DV    +       G         ++C+C  G EG  CE     C    C NGG+C  M E       C C PGF G +CE+N + C +  CQN   C D  + YTC CPE  TG +C  ++DEC    P  C NG  C++  G F C C+ G+ G  CE   D C   T C     C++   +   + C+CP G       L   C +  C  + QC    +     C+C PG+ G TC  +++EC       +PC+HG  C +    + C+C PG+ G +CE + NEC   PC     C+D +  F C C     G  C  + + C    C N A C   +  + + C C   L  + G++CE+D+DEC                    +  PC N  QC +  G+F CKC   +EG +C+  ++ C ++PC  GA+C +L   F C C +GFTG+ CE+ +   N CQ      D K      C D                 H     C+C  G++G  CE     C  + C   G C  + +G+ C C   Y G  C      C S PCLN GSC     N +  GY C C    TGP+C+   D+C   PC + G C     +F C C   + G RCE K   +C              +  C++   C + P+  G +C C +GY G  C+  +D CA +PC                                                 NGG C D    YFC C PGFQG  CQ + N C S  C  G  C+ Q + + C C  G  G+ C   +D C+   C N G C    G F C CP GF G  CE D++EC                 PC PTGT  C      F+C C    TG++CE  ID C       + PCF+ G C    +   G    F C CP G+ G  C   +  C  + C + G+C P         +C C  G GG  C      +     + C  NGSC    G G     C C   S G +C+  G+                        C  ++ +  CD  C+     +DGG+C            + +  PW  C         C   F + +C PQC++E CLFDG+DC       P    +C  H+ +G C+  CNT EC +DGGDC         G  + LL V +   + +    L + L+  L   + + ++ +G+ M++        E        + Q+R+   +   GK       G  V + VD + C     +  C  +      F+ A     +  P +P   +  + H G   P         L        +  ++ +  G +        ++     +W P G  R  +  S  + +R            L       E G +      +       +++G  S       S             A+ +  ML    +  M  P        +D   P  +     A C   + +    G  LG   P          E LL      Q  T                           +GET LHLAA+++R  AAR LLEAG++PN+ +  GR+ L  A+ A A EV    L  +   +D   +  +G+T L+ A + A  ++++ L+        D+   D++G+TALHWAA    A     LL  G ++DAQDN E TPL+LA +EG +EV ++L+  GA  ++ D     P DVA   N   ++ LLE
Sbjct:   30 CGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGETCQFP-DPCQNAQ--LCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAQLEDPCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQ-LRDFCSANPCVNGGVCLATYPQIQCHCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPCPPRGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTCLCPETWTGWDCSEDVDECEAQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIAAT-CAPGSTCIDRVGS---FSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCH--DLLNGFQCIC---LPGFSGTRCEEDIDEC--------------------RSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAPPEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTGYTGPTCSEEMTACHSGPCLNGGSC-----NPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGGTCVNRPGTFSCLCAMGFQGPRCEGKLRPSCA-------------DSPCRNRATCQDSPQ--GPRCLCPTGYTGGSCQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGYDGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQ--------------PCHPTGTAACHSLANAFYCQCLPGHTGQWCEVEIDPCH------SQPCFHGGTC----EATAGSPLGFICHCPKGFEGPTCSHRAPSCGFHHCHHGGLCLP-SPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPCLYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGA----------------------KGCEGRSGDGACDAGCSGPGGNWDGGDC-----------SLGVPDPWKGCPSHSR----CWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCHDHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLSLTLRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLSAGFVVVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAPP------ANQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRRRPPLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCG---------ALPQAAMLTPPQESEMEAP-------DLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWLGCPEP---------WEPLLDGGACPQAHTVG-------------------------TGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAREVCQLLLRSRQTAVDARTE--DGTTPLMLAARLAVEDLVEELIAAQA----DVGARDKWGKTALHWAAAVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAGLAPADVAHQRNHWDLLTLLE 1822          

HSP 2 Score: 484.952 bits (1247), Expect = 9.449e-139
Identity = 402/1343 (29.93%), Postives = 574/1343 (42.74%), Query Frame = 3
Query:  450 KCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCP-ITPCQNGGTCKLIAGNNV--------------CQCLNEWVGEFCE--FSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTC---LDKIGSYR-CVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD---DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCI--DLNNDYTCDCPEGLTGKNCEINIDECT-----PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHC--------------NCSTALGRYEGSKCEKDV----DECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEIN-DNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCR----------GNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCN---TGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGD---FECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPG-TFHCSCKKYFTGKYCETRIDYCEKFRKSGNI-PCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERC-KINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPG-VGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGEC 4259
             C NG TC S   G+  C+CA G+ G  C+    C     CQNGG+C+ +    +              C CL  + GE C+      C  S C   G C      + +C C   + G  C+L + C S NPC VNG   LA   +++CHC  G+ G+ C  D++EC     P C  G +C NT+GS+QC C  G  G RCE     C    C NGGTC    +K  ++  C+CP  + G +CE     C    C+NGG C+D  + Y C+C   WTG +C    D         C+N G C++ +   + C+C  G+ G  CE ++D+C   +C  G +CI+ +    C C PG          + C ++PC  +A+C    L     C C  G +G  C  ++DEC      P+PC +G  C +  G F C C  G+ G RCE   + C    PC     CL++  T   + C+CP G+  Q C+ E ++C +  C+N   C D+ N  +CIC+PGF G  CE +I+EC ++PC +G QCQD    + C CLPGF+G +C+  ++EC  +PC +   C+D    F C C   ++G  C   L  C PN C    IC   ++ D  +C              NC+   G  + S C  DV     EC  +             +      PC +   C      + C C + Y G  C + +  C + PC NG +C+    G+ C C    TG +C+   + C   PC N   C++    + C+C  GF G  CE      C +S C     C D   G  C C   Y G +C+ L   C   PC     C+     Q  P + C C +G+TGP C + +  C+           + C + G+C     S+ C C   + G  C+      C+S             + C++   C   P   G+ C C  GY G  C   +D C SQPC N G C    G + C C PGF G+ C+ + +EC    C+   T  C    N F C C  G +G++CE  +D C    C +GG C+   G    F C+CPKGF G  C      C ++   +    + +P              +PG    C+C   + G  C T        +  G   PC  NG C       +G    F C CP+   G RC K  +K C+      +G C            C  P G   G  C +   +      C ++  C   F    CH    S  E+C   G  C           Q          C     N  C+  CN   CG+DGG+C
Sbjct:   36 PCANGGTCLSLSLGQGTCQCAPGFLGETCQFPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAQLEDPCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFC-SANPC-VNGGVCLATYPQIQCHCPPGFEGHACERDVNECFQDPGP-CPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPCPPRGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTCLCPETWTGWDCSEDVDECEAQGPPHCRNGGTCQN-SAGSFHCVCVSGWGGTSCEENLDDCIAATCAPGSTCIDRVGSFSCLCPPG-RTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLS-QPCHPGSTCLDLLAT---FHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICLPGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGAFFCLCPSGFTGQLCEVPL--CAPNLCQPKQICK--DQKDKANCLCPDGSPGCAPPEDNCTCHHGHCQRSSCVCDVGWTGPECEAE-------------LGGCISAPCAHGGTCYPQPSGYNCTCPTGYTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGGTCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGSCQTLMDLCAQKPCPRNSHCL-----QTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLCVDSGPSYFCHCPPGFQGSLCQ-DHVNPCES-------------RPCQNGATCMAQPS--GYLCQCAPGYDGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFEGPTCSHRAPSCGFHHCHHGGLCLPSP--------------KPGFPPRCACLSGYGGPDCLTP----PAPKGCGPPSPCLYNGSC--SETTGLG-GPGFRCSCPHSSPGPRCQKPGAKGCEGR--SGDGAC---------DAGCSGPGGNWDGGDCSLGVPDP--WKGCPSHSRCWLLFRDGQCHPQCDS--EECLFDGYDCETPPACTPAYDQ---------YCHDHFHNGHCEKGCNTAECGWDGGDC 1286          

HSP 3 Score: 371.703 bits (953), Expect = 6.740e-103
Identity = 298/975 (30.56%), Postives = 424/975 (43.49%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQ-----KSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDEC--ASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQ----------------------------GFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININ-ECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSC--LGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTP-GYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVC-ETDLDSF--KCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETG--GFKCSCQSGYGGSFCE 3200
            ++ + C +H+C+NG TCQ  ++  Y C C   + G  C +     ++  P   C+NGGTC+  AG+  C C++ W G  CE +  +C ++ C  G  C    +  + C CP    G+ C L + C SQ PC  + +C      G   C C  GY+G TC  D+DEC  A      CE+GG+C+NT GS+ C C  G+ G RCE D  +C +  C  G TCLD + ++ C+CP    G  CE +   C   PC N   C D    +QCIC                                         GF G  CE  ID C+   C NGG C +      C CLPGFEG  C+  V+EC + PC   A C+DL   + C CP G TG+ CE+ +  C PN C     C+D+     C C                              G+ G  CE +   C    PC     C       SGY C CP G     C +E++ C +  C+N G C        C C P   G  C+   + C + PC +G  C +    + C+C  GF+G +CE  +   CA +PC     C D   G RC C   Y+G +C   +D C    C  ++ C+      S+HC C   L  + G  C   +  C   +  L+  G+ V S+       C N   C+++  S+ C C   ++G  C+  +N C + PC+NGATC     G+ C+C  G+ G+ C  E++ CQ  PC N   C      + C C  GF G  CE + ++C +  C   G   C    N F C+C   + G  CE    PC S PC + G+C   +    +P G++C+C +GF GP C  +   C  + C   G+C  +    F  +C C S Y G  C                         C ++G+C      G  GF+CSC     G  C+
Sbjct:  277 VNPDNCVSHQCQNGGTCQDGLD-TYTCLCPETWTGWDCSEDVDECEAQGPPH-CRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIAATCAPGSTCID-RVGSFSCLCPPGRTGLLCHLEDMCLSQ-PCHGDAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCIC---------------------------------------LPGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGAFFCLCPSGFTGQLCEVPL--CAPNLCQPKQICKDQKDKANCLCPDGSPGCAPPEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCIS-APCAHGGTCY---PQPSGYNCTCPTGYTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGGTCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGSCQTLMDLCAQKPCPRNSHCL--QTGPSFHCLC---LQGWTGPLCNLPLSSCQ--KAALS-QGIDVSSL-------CHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGYDGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTC---EATAGSPLGFICHCPKGFEGPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPA-----------PKGCGPPSPCLYNGSCSETTGLGGPGFRCSCPHSSPGPRCQ 1173          
BLAST of Neurogenic locus notch protein vs. Ensembl Human
Match: NOTCH4 (notch receptor 4 [Source:HGNC Symbol;Acc:HGNC:7884])

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 550/1970 (27.92%), Postives = 793/1970 (40.25%), Query Frame = 3
Query:  777 CGS-QNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGS--------------YQCKCKAGFNGERCENDIVD-CTNDTCKNGGTC-LDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGK----CNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECT---PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSK-CKNIVCI-NGQCV--DVNNEEKCICIPGFEGRTCEIEINECF-----NNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEI---NECQHNPCSNDAK------CID-----------------HINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCI------------------------------------------------NGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNEC--LSTKCYNNGSC--VNGFGKA--ICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCPL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSI--RVFAENSNSDSSKSRQKRSLSNSVQQGK------PGTKVYLEVDNNNCKT--ISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNI----EAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLE 6296
            CGS   PC   G C+  + G+  C C  G+ G TC    D C + +  LC+NGG+C   + +              + C C  GF GERC+  + D C    C   G C +   G  +C C   + G  C+  R  C   PC NGG+C       QC C   + G  C+ DV    +       G         ++C+C  G EG  CE     C    C NGG+C  M E       C C PGF G +CE+N + C +  CQN   C D  + YTC CPE  TG +C  ++DEC    P  C NG  C++  G F C C+ G+ G  CE   D C   T C     C++   +   + C+CP G       L   C +  C  + QC    +     C+C PG+ G TC  +++EC       +PC+HG  C +    + C+C PG+ G +CE + NEC   PC     C+D +  F C C     G  C  + + C    C N A C   +  + + C C   L  + G++CE+D+DEC                    +  PC N  QC +  G+F CKC   +EG +C+  ++ C ++PC  GA+C +L   F C C +GFTG+ CE+ +   N CQ      D K      C D                 H     C+C  G++G  CE     C  + C   G C  + +G+ C C   Y G  C      C S PCLN GSC     N +  GY C C    TGP+C+   D+C   PC + G C     +F C C   + G RCE K   +C              +  C++   C + P+  G +C C +GY G  C+  +D CA +PC                                                 NGG C D    YFC C PGFQG  CQ + N C S  C  G  C+ Q + + C C  G  G+ C   +D C+   C N G C    G F C CP GF G  CE D++EC                 PC PTGT  C      F+C C    TG++CE  ID C       + PCF+ G C    +   G    F C CP G+ G  C   +  C  + C + G+C P         +C C  G GG  C      +     + C  NGSC    G G     C C   S G +C+  G+                        C  ++ +  CD  C+     +DGG+C            + +  PW  C         C   F + +C PQC++E CLFDG+DC       P    +C  H+ +G C+  CNT EC +DGGDC         G  + LL V +   + +    L + L+  L   + + ++ +G+ M++        E        + Q+R+   +   GK       G  V + VD + C     +  C  +      F+ A     +  P +P   +  + H G   P         L        +  ++ +  G +        ++     +W P G  R  +  S  + +R            L       E G +      +       +++G  S       S             A+ +  ML    +  M  P        +D   P  +     A C   + +    G  LG   P          E LL      Q  T                           +GET LHLAA+++R  AAR LLEAG++PN+ +  GR+ L  A+ A A EV    L  +   +D   +  +G+T L+ A + A  ++++ L+        D+   D++G+TALHWAA    A     LL  G ++DAQDN E TPL+LA +EG +EV ++L+  GA  ++ D     P DVA   N   ++ LLE
Sbjct:   28 CGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGETCQFP-DPCQNAQ--LCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAQLEDPCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQ-LRDFCSANPCVNGGVCLATYPQIQCHCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPCPPRGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTCLCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIAAT-CAPGSTCIDRVGS---FSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCH--DLLNGFQCIC---LPGFSGTRCEEDIDEC--------------------RSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAPPEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTGYTGPTCSEEMTACHSGPCLNGGSC-----NPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGGTCVNRPGTFSCLCAMGFQGPRCEGKLRPSCA-------------DSPCRNRATCQDSPQ--GPRCLCPTGYTGGSCQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGYDGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQ--------------PCHPTGTAACHSLANAFYCQCLPGHTGQWCEVEIDPCH------SQPCFHGGTC----EATAGSPLGFICHCPKGFEGPTCSHRAPSCGFHHCHHGGLCLP-SPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPCLYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGA----------------------KGCEGRSGDGACDAGCSGPGGNWDGGDC-----------SLGVPDPWKGCPSHSR----CWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCHDHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLSLTLRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLSAGFVVVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAPP------ANQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRRRPPLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCG---------ALPQAAMLTPPQESEMEAP-------DLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWLGCPEP---------WEPLLDGGACPQAHTVG-------------------------TGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAREVCQLLLRSRQTAVDARTE--DGTTPLMLAARLAVEDLVEELIAAQA----DVGARDKWGKTALHWAAAVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAGLAPADVAHQRNHWDLLTLLE 1820          

HSP 2 Score: 484.952 bits (1247), Expect = 1.082e-138
Identity = 402/1343 (29.93%), Postives = 574/1343 (42.74%), Query Frame = 3
Query:  450 KCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCP-ITPCQNGGTCKLIAGNNV--------------CQCLNEWVGEFCE--FSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTC---LDKIGSYR-CVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD---DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCI--DLNNDYTCDCPEGLTGKNCEINIDECT-----PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHC--------------NCSTALGRYEGSKCEKDV----DECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEIN-DNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCR----------GNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCN---TGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGD---FECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPG-TFHCSCKKYFTGKYCETRIDYCEKFRKSGNI-PCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERC-KINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPG-VGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGEC 4259
             C NG TC S   G+  C+CA G+ G  C+    C     CQNGG+C+ +    +              C CL  + GE C+      C  S C   G C      + +C C   + G  C+L + C S NPC VNG   LA   +++CHC  G+ G+ C  D++EC     P C  G +C NT+GS+QC C  G  G RCE     C    C NGGTC    +K  ++  C+CP  + G +CE     C    C+NGG C+D  + Y C+C   WTG +C    D         C+N G C++ +   + C+C  G+ G  CE ++D+C   +C  G +CI+ +    C C PG          + C ++PC  +A+C    L     C C  G +G  C  ++DEC      P+PC +G  C +  G F C C  G+ G RCE   + C    PC     CL++  T   + C+CP G+  Q C+ E ++C +  C+N   C D+ N  +CIC+PGF G  CE +I+EC ++PC +G QCQD    + C CLPGF+G +C+  ++EC  +PC +   C+D    F C C   ++G  C   L  C PN C    IC   ++ D  +C              NC+   G  + S C  DV     EC  +             +      PC +   C      + C C + Y G  C + +  C + PC NG +C+    G+ C C    TG +C+   + C   PC N   C++    + C+C  GF G  CE      C +S C     C D   G  C C   Y G +C+ L   C   PC     C+     Q  P + C C +G+TGP C + +  C+           + C + G+C     S+ C C   + G  C+      C+S             + C++   C   P   G+ C C  GY G  C   +D C SQPC N G C    G + C C PGF G+ C+ + +EC    C+   T  C    N F C C  G +G++CE  +D C    C +GG C+   G    F C+CPKGF G  C      C ++   +    + +P              +PG    C+C   + G  C T        +  G   PC  NG C       +G    F C CP+   G RC K  +K C+      +G C            C  P G   G  C +   +      C ++  C   F    CH    S  E+C   G  C           Q          C     N  C+  CN   CG+DGG+C
Sbjct:   34 PCANGGTCLSLSLGQGTCQCAPGFLGETCQFPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAQLEDPCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFC-SANPC-VNGGVCLATYPQIQCHCPPGFEGHACERDVNECFQDPGP-CPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPCPPRGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTCLCPETWTGWDCSEDVDECETQGPPHCRNGGTCQN-SAGSFHCVCVSGWGGTSCEENLDDCIAATCAPGSTCIDRVGSFSCLCPPG-RTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLS-QPCHPGSTCLDLLAT---FHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICLPGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGAFFCLCPSGFTGQLCEVPL--CAPNLCQPKQICK--DQKDKANCLCPDGSPGCAPPEDNCTCHHGHCQRSSCVCDVGWTGPECEAE-------------LGGCISAPCAHGGTCYPQPSGYNCTCPTGYTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGGTCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGSCQTLMDLCAQKPCPRNSHCL-----QTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLCVDSGPSYFCHCPPGFQGSLCQ-DHVNPCES-------------RPCQNGATCMAQPS--GYLCQCAPGYDGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFEGPTCSHRAPSCGFHHCHHGGLCLPSP--------------KPGFPPRCACLSGYGGPDCLTP----PAPKGCGPPSPCLYNGSC--SETTGLG-GPGFRCSCPHSSPGPRCQKPGAKGCEGR--SGDGAC---------DAGCSGPGGNWDGGDCSLGVPDP--WKGCPSHSRCWLLFRDGQCHPQCDS--EECLFDGYDCETPPACTPAYDQ---------YCHDHFHNGHCEKGCNTAECGWDGGDC 1284          

HSP 3 Score: 371.318 bits (952), Expect = 7.892e-103
Identity = 298/975 (30.56%), Postives = 424/975 (43.49%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQ-----KSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDEC--ASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQ----------------------------GFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININ-ECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSC--LGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTP-GYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVC-ETDLDSF--KCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETG--GFKCSCQSGYGGSFCE 3200
            ++ + C +H+C+NG TCQ  ++  Y C C   + G  C +     ++  P   C+NGGTC+  AG+  C C++ W G  CE +  +C ++ C  G  C    +  + C CP    G+ C L + C SQ PC  + +C      G   C C  GY+G TC  D+DEC  A      CE+GG+C+NT GS+ C C  G+ G RCE D  +C +  C  G TCLD + ++ C+CP    G  CE +   C   PC N   C D    +QCIC                                         GF G  CE  ID C+   C NGG C +      C CLPGFEG  C+  V+EC + PC   A C+DL   + C CP G TG+ CE+ +  C PN C     C+D+     C C                              G+ G  CE +   C    PC     C       SGY C CP G     C +E++ C +  C+N G C        C C P   G  C+   + C + PC +G  C +    + C+C  GF+G +CE  +   CA +PC     C D   G RC C   Y+G +C   +D C    C  ++ C+      S+HC C   L  + G  C   +  C   +  L+  G+ V S+       C N   C+++  S+ C C   ++G  C+  +N C + PC+NGATC     G+ C+C  G+ G+ C  E++ CQ  PC N   C      + C C  GF G  CE + ++C +  C   G   C    N F C+C   + G  CE    PC S PC + G+C   +    +P G++C+C +GF GP C  +   C  + C   G+C  +    F  +C C S Y G  C                         C ++G+C      G  GF+CSC     G  C+
Sbjct:  275 VNPDNCVSHQCQNGGTCQDGLD-TYTCLCPETWTGWDCSEDVDECETQGPPH-CRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIAATCAPGSTCID-RVGSFSCLCPPGRTGLLCHLEDMCLSQ-PCHGDAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCIC---------------------------------------LPGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGAFFCLCPSGFTGQLCEVPL--CAPNLCQPKQICKDQKDKANCLCPDGSPGCAPPEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCIS-APCAHGGTCY---PQPSGYNCTCPTGYTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGGTCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGSCQTLMDLCAQKPCPRNSHCL--QTGPSFHCLC---LQGWTGPLCNLPLSSCQ--KAALS-QGIDVSSL-------CHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGYDGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTC---EATAGSPLGFICHCPKGFEGPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPA-----------PKGCGPPSPCLYNGSCSETTGLGGPGFRCSCPHSSPGPRCQ 1171          
BLAST of Neurogenic locus notch protein vs. Ensembl Celegans
Match: lin-12 (pep chromosome:WBcel235:III:9060096:9071760:-1 gene:WBGene00003001.1 transcript:R107.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-12)

HSP 1 Score: 297.745 bits (761), Expect = 3.282e-81
Identity = 277/914 (30.31%), Postives = 395/914 (43.22%), Query Frame = 3
Query: 2523 FRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQ---CICQ---------------SGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRC---------EIKMDWC-----------RGNPCGDFGVCETDLDSFKCKCNSEYIGERCEI-KKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYF----------------------------------------CKCQPGFQGVNCQVNTNECYS-NSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFE-CNCPKGFAGKLCETDINECKYNIAGNATNLI------SNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSG----------NIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAI-CHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCP--LQSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNG------------QQMIFSIRVFAENSNSDSSKSRQ-KRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYK 4919
            + CRC  GF GE CE    +C  + C  D KC+    DY+   C+C+               SG+ G +C+     C  S C+  GQC+   N  +C C + + G  CE     C+ N    K +C NR    NT G Y+C C +GF  P C         E K   C           R   C + G C  D  S KC+C   Y G  CE+ +K ++C S                  HG C +   +GGF+C C  GY GS+C+   D+C +  C  G +C +G   YF                                        C+C+PG++G+ C+ + NEC S N C N G C++   +F C C RG  G++C+  ++ C+   C+N G C +       C C  GF GK CE    EC     G   +L       S   G C   G  +CL    +  C C   FTG  CE         RK+G          + PC NN  C+     +V  +  ++CIC  G+ G+ C+ +   C  N C N G+C       R SF C+CPPG  G  CE + +  CL + C N G C+N   K   C C+ G  G +CE      NL       +    +  CE  KC+ +A++  CD +CN  AC FDGG+C  +              P+S C   +  N+ C ++F N  C+  CN E CL+DG DC+ A+ +CP  ++  C   +A+G C  ECNT  C FDGGDC    N+TI   I + + +   EF       L++ ++  L   VRI R+  G             ++  + R   E     +S SR+ KRS +N       G  VYLEV   NC T  K  + ++ S  + ++A L  K
Sbjct:   47 YWCRCDEGFGGEYCE---QQCDVSKCGADEKCV-FDKDYRMETCVCKDCDINGNSLLKPSCPSGYGGDDCKTQ-GWCYPSVCMNGGQCIGAGNRAKCACPDGFKGERCELDVNECEEN----KNACGNRSTCMNTLGTYICVCPQGFLPPDCLKPGNTSTVEFKQPVCFLEISADHPDGRSMYCQNGGFC--DKASSKCQCPPGYHGSTCELLEKEDSCASNPCS--------------HGVCIS--FSGGFQCICDDGYSGSYCQEGKDNCVNNKCEAGSKCINGVNSYFCDCPPERTGPYCEKMDCSAIPDICNHGTCIDSPLSEKAFECQCEPGYEGILCEQDKNECLSENMCLNNGTCVNLPGSFRCDCARGFGGKWCDEPLNMCQDFHCENDGTCMHTSDHSPVCQCKNGFIGKRCE---KECPIGFGGVRCDLRLEIGICSRQGGKCFNGG--KCL----SGFCVCPPDFTGNQCEVN-------RKNGKSSLSENLCLSDPCMNNATCI-----DVDAHIGYACICKQGFEGDICERHKDLCLENPCSNGGVCH----QHRESFSCDCPPGFYGNGCEQEKMFRCLKSTCQNGGVCINEEEKGRKCECSYGFSGARCE---EKINLTGFTEKDSLLRSV--CEKRKCSERANDGNCDADCNYAACKFDGGDCSGK------------REPFSKC---RYGNM-CADFFANGVCNQACNNEECLYDGMDCLPAVVRCPVKIREHCASRFANGICDPECNTNGCGFDGGDCDNETNATIITNIRITVQMDPKEFQVTGGQSLME-ISSALRVTVRIQRDEEGPLVFQWNGESEMDRVKMNERQLTEQHVLSTSISRKIKRSATNI------GVVVYLEV-QENCDT-GKCLYKDAQSVVDSISARLAKK 878          

HSP 2 Score: 166.392 bits (420), Expect = 1.312e-40
Identity = 193/659 (29.29%), Postives = 274/659 (41.58%), Query Frame = 3
Query:  369 MKLSIGAAILILLFCPIAISLNFCENHKC-KNGATCQSDING---KYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIHK---YECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERC--------------------ENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCE--NKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCF-NGGSCINMIEGGK---CNCLPGFXXXX-XXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC-EDRVGGFTCQCLQGFVGLRCE---------TKSDICKQLTPCKTE-EICLNVNNTRSGYKCICPDGV---------QNCKKELSK--CKNIVCI-NGQCVDVNNE--EKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEI-NINECAHNPCGLNGQCI-DEVYGFRCQCMLPYSGPTCANKLD 2162
            M++     + +L+    ++ +  C    C +NG      +NG    Y C C  G+ G YCEQ+  C ++ C                       E C F  +     C    +CK  +I+     +  CP  Y G +C+    C   + C   G+CI A +   KC C  G+ G  C  D++EC   +   C N  TC+NT+G+Y C C  GF    C                      D  D  +  C+NGG C DK  S +C CP  Y G+ CE   K   C   PC + G+C  F   +QCIC + ++G  C + K+ C  N C+    C +     Y C C     G  CE    +C  I    N G+CI+     K   C C PG+EG    +          C NN  C++L   + CDC  G  GK C+  ++ C    C N   C         CQC  GF+G RCE          + D+  ++  C  +   C N     SG+ C+CP            +N K  LS+  C +  C+ N  C+DV+      CIC  GFEG  CE   + C  NPC +G  C      + C C PGF G  CE   +  C  + C   G CI +E  G +C+C   +SG  C  K++
Sbjct:    1 MRIPTICFLFLLISLSKSLHIGSCLGLICGRNGHCHAGPVNGTQTSYWCRCDEGFGGEYCEQQ--CDVSKC--------------------GADEKCVFDKDYRMETC----VCKDCDINGNSLLKPSCPSGYGGDDCKTQGWC-YPSVCMNGGQCIGAGN-RAKCACPDGFKGERCELDVNECEENKN-ACGNRSTCMNTLGTYICVCPQGFLPPDCLKPGNTSTVEFKQPVCFLEISADHPDGRSMYCQNGGFC-DKASS-KCQCPPGYHGSTCELLEKEDSCASNPCSH-GVCISFSGGFQCICDDGYSGSYCQEGKDNCVNNKCEAGSKCIN-GVNSYFCDCPPERTGPYCEKM--DCSAIPDICNHGTCIDSPLSEKAFECQCEPGYEGILCEQDKNECLSENMCLNNGTCVNLPGSFRCDCARGFGGKWCDEPLNMCQDFHCENDGTCMHTSDHSPVCQCKNGFIGKRCEKECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCLSGF-CVCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATCIDVDAHIGYACICKQGFEGDICERHKDLCLENPCSNGGVCHQHRESFSCDCPPGFYGNGCEQEKMFRCLKSTCQNGGVCINEEEKGRKCECSYGFSGARCEEKIN 623          

HSP 3 Score: 153.68 bits (387), Expect = 8.846e-37
Identity = 184/596 (30.87%), Postives = 244/596 (40.94%), Query Frame = 3
Query:  435 FCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CP--ITPCQNGGTCKLIAGNNVCQCLNEWVGE------------------FCEFSSNCA---SSPCRNGGICKSLEIHKYECQCPKNYLGMNCEL---PNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGS---YRCVCPNNYFGTNCENKRTLC-ELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCE-----------------TSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXX---------XXXXXXXXXXKPCQNNAKCIDLNND--YTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCK----------KELSKCKNIVCINGQCVDVNNEEKC-----ICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLC 2000
            +C    C NG  C    N +  C C  G+KG  CE   N C      C N  TC    G  +C C   ++                    F E S++     S  C+NGG C        +CQCP  Y G  CEL    +SC S NPC  +G CI +  G  +C C+ GY+G+ C    D C + +   CE G  CIN V SY C C     G  CE        D C N GTC+D   S   + C C   Y G  CE  +  C     C N G C +    ++C C   + GK CD+  N C+   C+N+G C   +     C C+ GF GK CE                   I + Q   CFNGG C++    G C C P F GN            ++ N C + PC NNA CID++    Y C C +G  G  CE + D C  NPC NG  C      F+C C  GF G  CE +       + C+   +C  +N    G KC C  G    +           E       VC   +C +  N+  C          F+G  C  +  E F+  C++G+ C D F + +C
Sbjct:  117 WCYPSVCMNGGQCIGAGN-RAKCACPDGFKGERCELDVNECEENKNACGNRSTCMNTLGTYICVCPQGFLPPDCLKPGNTSTVEFKQPVCFLEISADHPDGRSMYCQNGGFCDKA---SSKCQCPPGYHGSTCELLEKEDSCAS-NPCS-HGVCI-SFSGGFQCICDDGYSGSYCQEGKDNCVNNK---CEAGSKCINGVNSYFCDCPPERTGPYCEKMDCSAIPDIC-NHGTCIDSPLSEKAFECQCEPGYEGILCEQDKNECLSENMCLNNGTCVNLPGSFRCDCARGFGGKWCDEPLNMCQDFHCENDGTCMHTSDHSPVCQCKNGFIGKRCEKECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCLS----GFCVCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATCIDVDAHIGYACICKQGFEGDICERHKDLCLENPCSNGGVCHQHRESFSCDCPPGFYGNGCEQEKMFRCLKSTCQNGGVC--INEEEKGRKCECSYGFSGARCEEKINLTGFTEKDSLLRSVCEKRKCSERANDGNCDADCNYAACKFDGGDCSGK-REPFSK-CRYGNMCADFFANGVC 693          

HSP 4 Score: 152.525 bits (384), Expect = 1.831e-36
Identity = 144/508 (28.35%), Postives = 210/508 (41.34%), Query Frame = 3
Query: 1494 CQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDEC--TPNPCLNGARCEDRVGGFTCQCLQGFVGLRC--ETKSDICKQLTPCKTEEICLNVNNTRSGY------------KCICPDGVQNCKKEL----SKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLC----------------------------------------ICLPGFKGKKCEININEC-AHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXX---------XXGATCDNLAD--GFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDN-DCTESSCLGHGQCV-DKVNGFECKCNENYIGTNCE 2795
            C N  +CI   N   C CP+G  G+ CE++++EC    N C N + C + +G + C C QGF+   C     +   +   P    EI  +  + RS Y            KC CP G      EL      C +  C +G C+  +   +CIC  G+ G  C+   + C NN C+ GS+C +  N Y C                                         C PG++G  CE + NEC + N C  NG C++    FRC C   + G  C   L+ C    C ND  C+  + + S  C C      + G +CEK   EC +    +       + + + Q G C N  +C+    S  C C   + G QCE    N +++            N ATC ++    G+ C C  GF G+ CE   + C  NPCSN   C  H   + C C  GF G  CE      C +S+C   G C+ ++  G +C+C+  + G  CE
Sbjct:  123 CMNGGQCIGAGNRAKCACPDGFKGERCELDVNECEENKNACGNRSTCMNTLGTYICVCPQGFLPPDCLKPGNTSTVEFKQPVCFLEISADHPDGRSMYCQNGGFCDKASSKCQCPPGYHGSTCELLEKEDSCASNPCSHGVCISFSGGFQCICDDGYSGSYCQEGKDNCVNNKCEAGSKCINGVNSYFCDCPPERTGPYCEKMDCSAIPDICNHGTCIDSPLSEKAFECQCEPGYEGILCEQDKNECLSENMCLNNGTCVNLPGSFRCDCARGFGGKWCDEPLNMCQDFHCENDGTCMHTSDH-SPVCQCKNG---FIGKRCEK---ECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCL----SGFCVCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATCIDVDAHIGYACICKQGFEGDICERHKDLCLENPCSNGGVCHQHRESFSCDCPPGFYGNGCEQEKMFRCLKSTCQNGGVCINEEEKGRKCECSYGFSGARCE 619          

HSP 5 Score: 115.161 bits (287), Expect = 5.267e-25
Identity = 159/617 (25.77%), Postives = 228/617 (36.95%), Query Frame = 3
Query:  927 NGGTCINTVGSYQCKCKAGFNGERCEN--DIVDCTND-------------------------------------------------TCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCE--LKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCE-SVNYQD----------------YKCICQRGFEGKMCET--SIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVG--GFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEK-CICIPGFEGRTCE---------------IEINECFNN--PCQHGSQCQDLFNDYLCICLPGFKGKKCEINI---------NECAHNPCGLNGQCI--DEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCIN-TNGSFICKCSSQYEGRQCEK 2456
            + G    T  SY C+C  GF GE CE   D+  C  D                                                  C NGG C+      +C CP+ + G  CE     CE     C N   C +    Y C+C   +   +C    N   +   +   F E S ++ D                 KC C  G+ G  CE     D+C    C + G CI+   G +C C  G+ G+ C+   + C N  C+  +KCI+  N Y CDCP   TG  CE       P+ C +G   +  +    F CQC  G+ G+ CE   + C     C     C+N+  +   ++C C  G   + C + L+ C++  C N G C+  ++    C C  GF G+ CE               +EI  C      C +G +C   F    C+C P F G +CE+N          N C  +PC  N  CI  D   G+ C C   + G  C    D C  N C N  +C      +S+ C+C      + G+ CE++                    M       C N   CIN       C+CS  + G +CE+
Sbjct:   36 HAGPVNGTQTSYWCRCDEGFGGEYCEQQCDVSKCGADEKCVFDKDYRMETCVCKDCDINGNSLLKPSCPSGYGGDDCKTQGWCYPSVCMNGGQCIGAGNRAKCACPDGFKGERCELDVNECEENKNACGNRSTCMNTLGTYICVCPQGFLPPDCLKPGNTSTVEFKQPVCFLEISADHPDGRSMYCQNGGFCDKASSKCQCPPGYHGSTCELLEKEDSCASNPCSH-GVCISFSGGFQCICDDGYSGSYCQEGKDNCVNNKCEAGSKCINGVNSYFCDCPPERTGPYCEKMDCSAIPDICNHGTCIDSPLSEKAFECQCEPGYEGILCEQDKNECLSENMCLNNGTCVNLPGS---FRCDCARGFGGKWCDEPLNMCQDFHCENDGTCMHTSDHSPVCQCKNGFIGKRCEKECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCLSGF----CVCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATCIDVDAHIGYACICKQGFEGDICERHKDLCLENPCSNGGVC--HQHRESFSCDCPPG---FYGNGCEQE-------------------KMFRCLKSTCQNGGVCINEEEKGRKCECSYGFSGARCEE 620          

HSP 6 Score: 90.5077 bits (223), Expect = 1.625e-17
Identity = 62/199 (31.16%), Postives = 97/199 (48.74%), Query Frame = 3
Query: 5724 TLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCL-IQAVKEAXXXXXXXXXXXXXXXXCDLNV-----TDEY-GRTALHWAA-ITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLE 6296
            T L LA    R+    +L++AG+DP     + RS L  A       ++ + L       D+ +   NG T L I A  E   ++    L   +  + D +      +++Y GRTALH+AA ++    V +L+   G N+D QD +  TP+ LA +EG IEV   LI  GA+ +  D  D   R +A+ NN  +IV + +
Sbjct: 1096 TPLMLAVLARRRRLVAYLMKAGADPTIYNKSERSALHQAAANRDFGMMVYMLNSTKLKGDIEELDRNGMTALMIVAHNEGRDQVASAKLLVEKGAKVDYDGAARKDSEKYKGRTALHYAAQVSNMPIVKYLVGEKGSNKDKQDEDGKTPIMLAAQEGRIEVVMYLIQQGASVEAVDATDHTARQLAQANNHHNIVDIFD 1294          

HSP 7 Score: 80.8777 bits (198), Expect = 1.319e-14
Identity = 80/267 (29.96%), Postives = 109/267 (40.82%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGS---------QNPCGVNGKCILANDGEV--KCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCEND-IVDCTNDTCKNGGTCLDKIGSYR-CVCPNNYFGTNCENK-------------RTLCELKPC 1151
            LN C++  C+N  TC    +   VC+C  G+ G  CE++  CPI     G  C L     +C               +     C NGG C S       C CP ++ G  CE+    G           +PC  N  CI   D  +   C C +G+ G+ C    D C   E P C NGG C     S+ C C  GF G  CE + +  C   TC+NGG C+++    R C C   + G  CE K             R++CE + C
Sbjct:  405 LNMCQDFHCENDGTCMHTSDHSPVCQCKNGFIGKRCEKE--CPIG--FGGVRCDLRLEIGIC---------------SRQGGKCFNGGKCLS-----GFCVCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATCIDV-DAHIGYACICKQGFEGDICERHKDLC--LENP-CSNGGVCHQHRESFSCDCPPGFYGNGCEQEKMFRCLKSTCQNGGVCINEEEKGRKCECSYGFSGARCEEKINLTGFTEKDSLLRSVCEKRKC 643          
BLAST of Neurogenic locus notch protein vs. Ensembl Celegans
Match: clec-78 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531])

HSP 1 Score: 269.24 bits (687), Expect = 1.380e-71
Identity = 200/618 (32.36%), Postives = 295/618 (47.73%), Query Frame = 3
Query: 1935 ECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAIC--IPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTN-GSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGV--CETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPE----TGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFE-CNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRID------YCEKFRKS 3737
            +C    C++ ++C    +   C C PG+ G +CE+  + C+  PC   G+C      ++C C   ++G  C  + D CN   C N  +C  +PG K  S  C C T    + G +CE+  D C+ +                    PC N  +CI    G F C+C   +EG  C+K +++C ++PC   ATC +L + ++C C  GF+G+RC I+ N C  +PC +   CID +   QC+CQ G++G+NC+ N ++C  S C    +C+D++NG+ C+C + Y G +C+HL   C   PC N  +C N         Y C+C  GF G  CE+ +D C  N C   G   C   ++ FKC C   Y G RC++K+ +   S                     C ND +     G +KC C+SG+ G  CE +   CA++PC N G C      YFC C PG  G NC+   N C    C N G+C D  ++  C CP   +G+ CE     CK   C+NGG C    G  + C C  GF G+ CET+I+EC            S  H P   T    C+D+  T  C C    TG +C+  I+      + + FR +
Sbjct: 2016 DCSAKMCENNAECSVFMHRAQCHCKPGYVGDRCEMLEDVCSTQPCYNGGKCEQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVCHDLPGVK--STTCLCRTG---FAGPQCEEITDICSTNN-------------------PCRNGARCIGEKLGRFKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSPCVH-GLCIDKLYSRQCLCQPGWTGENCDQNIDECAASPCQNDAKCIDEINGYMCECADGYEGVHCQHLVDHCAKQPCHNNATCTNMGAT-----YHCDCTLGFDGVHCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADS--------------------PCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCPPGVSGKNCESAPNRCIGQPCHNGGECGDFGSHLECACPASFTGKGCEFKNTGCKT--CENGGKCAEAAGGLQKCECSPGFTGERCETNIDEC------------STAHCPSGAT----CVDQVNTHICVCPFNLTGVHCDKMINTNYDLQFLDPFRPT 2565          

HSP 2 Score: 258.84 bits (660), Expect = 1.594e-68
Identity = 192/591 (32.49%), Postives = 282/591 (47.72%), Query Frame = 3
Query: 1590 ECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCING-QCVDVN--NEEKCICIPGFEGRTCEIEINEC-FNNPCQHGSQC-QDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSN--DAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGF-KCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNC--QVNTN 3326
            +C+   C N A C   +    C C  G+VG RCE   D+C    PC     C  V  T   YKC CP       C+ E  +C  + C NG  C D+       C+C  GF G  CE   + C  NNPC++G++C  +    + C C+PG++G  C+ NI++CA +PC LN  C+D +  ++C+C   +SG  C  K + C  + C +  +CI  +K  S  C C      + G  C++++DEC                       PC ND +CI+    ++C+C+  YEG  C+  +++C   PC N ATC N+   + C C  GF G  CE+ I+EC  N C       C D +ND++C+C+ G++G  C++  + C +S CL   QCVD    ++C C   + G  CE     C + PC N G C++   +     Y C C  G +G  CE   + C G PC + G C       +C C + + G+ CE K T  CK+               C++ G C      GG  KC C  G+ G  CE NID+C++  C +G  C D    + C C     GV+C   +NTN
Sbjct: 2016 DCSAKMCENNAECSVFMHRAQCHCKPGYVGDRCEMLEDVCS-TQPCYNGGKCEQVGTT---YKCTCPKMFNGARCQFESDECNGVKCPNGGVCHDLPGVKSTTCLCRTGFAGPQCEEITDICSTNNPCRNGARCIGEKLGRFKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSPCVH-GLCI--DKLYSRQCLCQPG---WTGENCDQNIDEC--------------------AASPCQNDAKCIDEINGYMCECADGYEGVHCQHLVDHCAKQPCHNNATCTNMGATYHCDCTLGFDGVHCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVAD-----YFCVCPPGVSGKNCESAPNRCIGQPCHNGGECGDFGSHLECACPASFTGKGCEFKNT-GCKT---------------CENGGKCAE--AAGGLQKCECSPGFTGERCETNIDECSTAHCPSGATCVDQVNTHICVCPFNLTGVHCDKMINTN 2553          

HSP 3 Score: 257.684 bits (657), Expect = 3.698e-68
Identity = 190/564 (33.69%), Postives = 269/564 (47.70%), Query Frame = 3
Query: 1362 NCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVG--GFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVC-INGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCE 3038
            +C    C N   C   +   +C+C PG+ G+ CE+  + C  +PC N  KC  +   Y C CP+   G  C+   DEC    C NG  C D  G    TC C  GF G +CE  +DIC    PC+    C+     R  +KC C  G +  NC K +  C +  C +N  CVD+ N+ KC C  GF G+ C I+ N C ++PC HG  C D      C+C PG+ G+ C+ NI+ECA +PC  + +CIDE+ G+ C+C   Y G  C + +D C    C+N+A C   N   +YHC+C+  LG ++G  CE ++DEC  ++                     L    C +    F C C   Y G +C+   + C ++PC N A C ++   ++C C +G+TG +CE +   C   PC N+  C+  + DY C+C  G SGKNCE   N C    C   G+C D  +  EC C  ++ G  CE     C +  C N G C             C C  GFTG RCE  +D C    C     C   +++  C C     G  C+
Sbjct: 2016 DCSAKMCENNAECSVFMHRAQCHCKPGYVGDRCEMLEDVCSTQPCYNGGKCEQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVCHDLPGVKSTTCLCRTGFAGPQCEEITDICSTNNPCRNGARCIGEKLGR--FKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSPCVHG-LCIDKLYSRQCLCQPGWTGENCDQNIDECAASPCQNDAKCIDEINGYMCECADGYEGVHCQHLVDHCAKQPCHNNATCT--NMGATYHCDCT--LG-FDGVHCEMNIDECAENQCDK------------------LGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCPPGVSGKNCESAPNRCIGQPCHNGGECGDFGSHLECACPASFTGKGCEFKNTGCKT--CENGGKCAEAAGGLQK----CECSPGFTGERCETNIDECSTAHCPSGATCVDQVNTHICVCPFNLTGVHCD 2547          

HSP 4 Score: 236.113 bits (601), Expect = 1.515e-61
Identity = 188/572 (32.87%), Postives = 270/572 (47.20%), Query Frame = 3
Query: 1014 VDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESV-NYQDYKCICQRGFEGKMCETSIDNCQK-ISCFNGGSCINMIEGG-KCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQH--GSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIG-PCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGF-RCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCE--INDN 2693
            +DC+   C+N   C   +   +C C   Y G  CE    +C  +PC NGG C      Y+C C   + G  C    + C    C N G C  +   +   C+C+ GF G  CE   D C     C NG  CI    G  KC C+PG+EG NC+ N+++C + PC  NA C+DL NDY C+CP G +GK C I  + C  +PC++G  C D++    C C  G+ G  C+   D C   +PC+ +  C++  N   GY C C DG +  +C+  +  C    C  N  C ++     C C  GF+G  CE+ I+EC  N C       C+D  ND+ C+C PG+ G +C++  ++CA +PC  + QC+D    ++C C   ++GP C      C    C N+  C+  +    Y C C   +    G  CE   + C                     IG PC N  +C +      C C + + G+ CE    N     C NG  C   A G  +C C  GFTGERCE  I+EC    C + A C+D +N + C+C    +G +C+  IN N
Sbjct: 2015 IDCSAKMCENNAECSVFMHRAQCHCKPGYVGDRCEMLEDVCSTQPCYNGGKCEQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVCHDLPGVKSTTCLCRTGFAGPQCEEITDICSTNNPCRNGARCIGEKLGRFKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSPCVHGL-CIDKLYSRQCLCQPGWTGENCDQNIDECAA-SPCQNDAKCIDEIN---GYMCECADGYEGVHCQHLVDHCAKQPCHNNATCTNMGATYHCDCTLGFDGVHCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCV--SLVADYFCVCPPGVS---GKNCESAPNRC---------------------IGQPCHNGGECGDFGSHLECACPASFTGKGCE--FKNTGCKTCENGGKCAEAAGGLQKCECSPGFTGERCETNIDECSTAHCPSGATCVDQVNTHICVCPFNLTGVHCDKMINTN 2553          

HSP 5 Score: 223.402 bits (568), Expect = 1.164e-57
Identity = 205/655 (31.30%), Postives = 301/655 (45.95%), Query Frame = 3
Query:  438 CENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLE-IHKYECQCPKNYLGMNC-ELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGG--SCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVD-VNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCN-PNACYNDAICIPGNKYDSYHCNCS-TALGRYEGSKCEKDVDECNLDRTQLALYGLAVLS--MSNSQ 2360
            C    C+N A C S    +  C C  GY G  CE   + C   PC NGG C+ +     C C   + G  C+F S+ C    C NGG+C  L  +    C C   + G  C E+ + C + NPC    +CI    G  KC C  G+ G  C  +ID+CA  ++P C    TC++ +  Y+C+C  GF+G+RC      C +  C + G C+DK+ S +C+C   + G NC+     C   PC+N   C D    Y C C + + G +C  + + C   PC NN  C ++    Y C C  GF+G  CE +ID C +  C   G  SC + +   KC C PG+ G  C++  ++C + PC N+A+C+D+   Y C C  G TG  CE +   C   PC N   C   V  + C C  G  G  CE+  + C    PC     C +     S  +C CP     + C+ + + CK   C N G+C +     +KC C PGF G  CE  I+EC    C  G+ C D  N ++C+C     G  C+  IN                   +  Q + P+  PT A+   P    ++  +  + +   K++  H + +  +L R++ S  E      NL R  L   GLA +   +S+SQ
Sbjct: 2017 CSAKMCENNAEC-SVFMHRAQCHCKPGYVGDRCEMLEDVCSTQPCYNGGKCEQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVCHDLPGVKSTTCLCRTGFAGPQCEEITDICSTNNPCRNGARCIGEKLGRFKCQCVPGWEGPNCDKNIDDCA--DSP-CALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSPCVH-GLCIDKLYSRQCLCQPGWTGENCDQNIDECAASPCQNDAKCIDEINGYMCECADGYEGVHCQHLVDHCAKQPCHNNATCTNMG-ATYHCDCTLGFDGVHCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCPPGVSGKNCESAPNRCIG-QPCHNGGECGDFG---SHLECACPASFTGKGCEFKNTGCK--TCENGGKCAEAAGGLQKCECSPGFTGERCETNIDECSTAHCPSGATCVDQVNTHICVCPFNLTGVHCDKMINT-----------------NYDLQFLDPFR-PTSASLYAPFRIESSALSVGLWV---KFEKPHQHAAFFSLHRFDNSSQEYVRVSSNLVRLTL-FPGLAAVEVPLSSSQ 2637          

HSP 6 Score: 215.312 bits (547), Expect = 3.172e-55
Identity = 180/564 (31.91%), Postives = 260/564 (46.10%), Query Frame = 3
Query:  918 LCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFD--EDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGF-CESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICP---DGVQNCKKELSKCKNIVCI---NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSF-ICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEIN 2579
            +CEN   C   +   QC CK G+ G+RCE     C+   C NGG C     +Y+C CP  + G  C+ +   C    C NGG+C D    +   C+C   + G  C+++ + C  N    NG  C       +KC C  G+EG  C+ +ID+C    C    +C+++I   KC C  GF G  C I  N C + PC +   CID      C C  G TG+NC+ NIDEC  +PC N A+C D + G+ C+C  G+ G+ C+   D C +  PC     C N+  T   Y C C    DGV +C+  + +C    C       C D  N+ KC+C PG+ G  C+++ ++C ++PC + +QC D+   Y C+C  G+ G KCE +   CA  PC  NG C+  V  + C C    SG  C +  + C    C+N   C  G+      C C  +   + G  CE                        N+    C N  +C    G    C+CS  + G +CE  ++ C    C +GATC +  +   C C    TG  C+  IN
Sbjct: 2021 MCENNAECSVFMHRAQCHCKPGYVGDRCEMLEDVCSTQPCYNGGKCEQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVCHDLPGVKSTTCLCRTGFAGPQCEEITDICSTNNPCRNGARCIGEKLGRFKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSPCVHGL-CIDKLYSRQCLCQPGWTGENCDQNIDECAASPCQNDAKCIDEINGYMCECADGYEGVHCQHLVDHCAK-QPCHNNATCTNMGAT---YHCDCTLGFDGV-HCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCPPGVSGKNCESAPNRCIGQPCHNGGEC--GDFGSHLECACPAS---FTGKGCE----------------------FKNTGCKTCENGGKCAEAAGGLQKCECSPGFTGERCETNIDECSTAHCPSGATCVDQVNTHICVCPFNLTGVHCDKMIN 2551          

HSP 7 Score: 206.838 bits (525), Expect = 1.047e-52
Identity = 160/515 (31.07%), Postives = 222/515 (43.11%), Query Frame = 3
Query: 2694 DCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFK---CKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCK-------------------------------------CQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSAC 4115
            DC+   C  + +C   ++  +C C   Y+G  CE L+  C + PC N G C      Q    Y C C + F G RC+ + D C G  C + GVC  DL   K   C C + + G +CE + T+ C +            N  C++   C  + + G FKC C  G+ G  C+ NIDDCA  PC     C D    Y C+                                     CQPG+ G NC  N +EC ++ C N  KCID+IN + C C  G  G  C+ +VD+C K  C N   C N+   + C+C  GF G  CE +I+EC  N               C   GT  C D    F C CK  +TG  C+ + D C       + PC N+  C+     ++G  Y   C+C +G+ G +C+ ++  C    C+NNG C     D    + C CPPGV G  CE    N C+   C+N G C +      C C     G+ CE   + C
Sbjct: 2016 DCSAKMCENNAECSVFMHRAQCHCKPGYVGDRCEMLEDVCSTQPCYNGGKC-----EQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVCH-DLPGVKSTTCLCRTGFAGPQCE-EITDICST------------NNPCRNGARCIGE-KLGRFKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSPCVHGLCIDKLYSRQCLCQPGWTGENCDQNIDECAASPCQNDAKCIDEINGYMCECADGYEGVHCQHLVDHCAKQPCHNNATCTNMGATYHCDCTLGFDGVHCEMNIDECAEN--------------QCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQC------ADSPCLNDAQCV-----DMGGAYK--CVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVAD----YFCVCPPGVSGKNCE-SAPNRCIGQPCHNGGECGDFGSHLECACPASFTGKGCEFKNTGC 2478          

HSP 8 Score: 206.453 bits (524), Expect = 1.516e-52
Identity = 179/583 (30.70%), Postives = 258/583 (44.25%), Query Frame = 3
Query: 2370 CLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDH--INDYQCICQSGFSGKNCE-INDNDCTESSCLGHGQCV-DKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCN---TGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCE 4097
            C N+ +C        C C   Y G +CE   + C   PC NG  C+ +   ++C C   F G RC+ E +EC    C N   C D   +    C+C++GF+G  CE I D   T + C    +C+ +K+  F+C+C   + G NC+     C  +PC    +C++  +N     Y C C  GF+G RC IK + C  +PC   G+C   L S +C C   + GE C+    E   S               C++   C +  E  G+ C C  GY G  C+  +D CA QPC N   C +    Y C C  GF GV+C++N +EC  N C+   T  C D +N+F CVC  G +G  C+   D C    C N   C ++ G ++C C  G+ G  CE D   C                 PC   G   C+     + C C    +GK CE+  + C         PC N G C      + G +    C CP  + G+ C+  +  C+   C+N G C   E    +  KCEC PG  G  CE + ++EC +  C +  +CV+     IC C     G  C+
Sbjct: 2022 CENNAECSVFMHRAQCHCKPGYVGDRCEMLEDVCSTQPCYNGGKCEQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVCHDLPGVKSTTCLCRTGFAGPQCEEITDICSTNNPCRNGARCIGEKLGRFKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDL-IND----YKCECPTGFSGKRCHIKENLCASSPCV-HGLCIDKLYSRQCLCQPGWTGENCDQNIDECAAS--------------PCQNDAKCID--EINGYMCECADGYEGVHCQHLVDHCAKQPCHNNATCTNMGATYHCDCTLGFDGVHCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAK--------------PCRNNGF--CVSLVADYFCVCPPGVSGKNCESAPNRCI------GQPCHNGGEC-----GDFGSH--LECACPASFTGKGCEFKNTGCK--TCENGGKCA--EAAGGLQ-KCECSPGFTGERCETN-IDECSTAHCPSGATCVDQVNTHICVCPFNLTGVHCD 2547          

HSP 9 Score: 129.798 bits (325), Expect = 2.483e-29
Identity = 104/339 (30.68%), Postives = 147/339 (43.36%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQ-KSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGI--CKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNC 1433
            ++ C    C+N A C  +ING Y+CECA GY+G +C+    +C   PC N  TC  +     C C   + G  CE +   CA + C   G   C+   ++ ++C C   Y G  C++     + +PC  + +C+    G  KC C  G+TG  C  D   CA+     C N G C++ V  Y C C  G +G+ CE+    C    C NGG C D      C CP ++ G  CE K T C  K C+NGG C +     Q                                      KC C  GF G+ CET+ID C    C +G +C++ +    C C
Sbjct: 2245 IDECAASPCQNDAKCIDEING-YMCECADGYEGVHCQHLVDHCAKQPCHNNATCTNMGATYHCDCTLGFDGVHCEMNIDECAENQCDKLGTESCRD-AVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMG-GAYKCVCKSGWTGPKCEQDNGSCAAKP---CRNNGFCVSLVADYFCVCPPGVSGKNCESAPNRCIGQPCHNGGECGDFGSHLECACPASFTGKGCEFKNTGC--KTCENGGKCAEAAGGLQ--------------------------------------KCECSPGFTGERCETNIDECSTAHCPSGATCVDQVNTHICVC 2537          
BLAST of Neurogenic locus notch protein vs. Ensembl Celegans
Match: glp-1 (pep chromosome:WBcel235:III:9092241:9099698:1 gene:WBGene00001609.1 transcript:F02A9.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:glp-1)

HSP 1 Score: 234.572 bits (597), Expect = 9.773e-62
Identity = 236/775 (30.45%), Postives = 326/775 (42.06%), Query Frame = 3
Query: 2826 CLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIK--MDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICK---------------HHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCI---DQINNFSCVCPRGVSGRFCETIVDYCKKME-CQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETR-----------IDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSK--------KCQLNVCKNNGICRPFEIDDRMS-FKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEI-----------------------------TGSAC-NLASIDNSQTYQDEISD-CELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCP--LQSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMI-FSIRVFAENSNSDSSKSRQKRSLSNSVQQGK----PGTKVYLEVDNNNCKTISKLC-FDNSNSAAEFVTAAL 4910
            C   G C N K+ +    Y C C++GF G  CE +  +D  RG  C    + +   ++  C C      + CE    ET  +   +K   E      CK               ++G C+  P  GGF+C C +GYGGS+CE  ID CA   C  G  C +    Y+C C  G  G  C+        N CN G+CI   D+  NF CVC  G  G FC    + C   E C N   C N+ GDF C C  G+AGK CE  I+ CK  +  N         G C+        D      C C++ FTG+ CE             +          N  C+N+G C+N +           C+C   Y G+RC+IN K         C+ N C NN  C    ID + S + C CP G  GL CE   +  C  T C N G+C    G   C+C  G  G+ CEI                             TG  C  +  I+ S+  +  I D CE  KC   A N IC+ ECN   C FDGG+C                 P+S C+        C + F N  C+ +CN E CL+DG DC   + +CP  ++  C +   DG C LEC+ + C FDGGDC     + I   I + + +   EF A     L+Q ++  L + VRI R+  G  +  +      E    +SSK   +  LS+ V++ +     G  +YLEV+   CK   + C F  + S  + + A L
Sbjct:   29 CSVNGKCYNGKLIET---YWCRCKKGFGGAFCERECDLDCKRGEKC----IYDVYGENPTCIC------QDCE---DETPPTERTQKGCEEGYGGPDCKTPLFSGVNPCDSDPCNNGLCY--PFYGGFQCICNNGYGGSYCEEGIDHCAQNECAEGSTCVNSVYNYYCDCPIGKSGRYCERTECALMGNICNHGRCIPNRDEDKNFRCVCDSGYEGEFCNKDKNECLIEETCVNNSTCFNLHGDFTCTCKPGYAGKYCEEAIDMCKDYVCQN--------DGYCA-------HDSNQMPICYCEQGFTGQRCEIECPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRCINGF-----------CVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATC----IDLKNSGYSCHCPLGFYGLNCEQHLL--CTPTTCANGGTCEGVNGVIRCNCPNGFSGDYCEIKDRQLCSRHPCKNGGVCKNTGYCECQYGYTGPTCEEVLVIEKSK--ETVIRDLCEQRKCMDLASNGICNPECNLEECNFDGGDC------------SGGQRPFSKCQYPAR----CADQFANGVCNQECNNEECLYDGLDCQSELFRCPAHIRKHCIERRGDGVCNLECSFIGCGFDGGDCNNGTEAIILSDIRIKVQIDPIEFQATGGETLMQ-ISANLRATVRIQRDELGPLVFRWDGEHEMERVEMNSSKLEDQFVLSHHVRRYRQAVVTGIVLYLEVE-EICK--PEFCRFSTAQSVVDLIAAGL 731          

HSP 2 Score: 155.992 bits (393), Expect = 1.675e-37
Identity = 174/586 (29.69%), Postives = 250/586 (42.66%), Query Frame = 3
Query:  393 ILILLFCPIAISLNFCE---------NHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGV----NGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCL---DKIGSYRCVCPNNYFGTNCENKRTLCEL-KPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCET---------------SIDNCQKI--SCFNGGSCINMIEGGKCNCLPGF--------XXXXXXXXXXXXXXKPCQNNAKCIDLNND-YTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNI--VCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFN-----NPCQHGSQCQDLFNDYLC 2000
            IL+  F PIA  L   E         N KC NG   ++     Y C C  G+ G +CE++ +     C+ G            +C+ +  GE    +  C    C +    ++    + +  C + Y G +C+ P   G  NPC      NG C     G  +C CN GY G+ C   ID CA  E   C  G TC+N+V +Y C C  G +G  CE        + C N G C+   D+  ++RCVC + Y G  C   +  C + + C N   C +   D+ C C   + GK C++  + CK   C+N+G+C   + Q   C C++GF G+ CE                   +C +   +C+N G CIN    G C C P +          +    ++  C+  PC NNA CIDL N  Y+C CP G  G NCE ++  CTP  C NG  CE   G   C C  GF G  CE K        PCK   +C N       Y    P   +    E SK   I  +C   +C+D+ +    IC P      C  +  +C       + CQ+ ++C D F + +C
Sbjct:    6 ILLAFFAPIASQLMGGECGREGACSVNGKCYNGKLIET-----YWCRCKKGFGGAFCERECD---LDCKRGE-----------KCIYDVYGE----NPTCICQDCED----ETPPTERTQKGCEEGYGGPDCKTPLFSGV-NPCDSDPCNNGLCYPFYGG-FQCICNNGYGGSYCEEGIDHCAQNE---CAEGSTCVNSVYNYYCDCPIGKSGRYCERTECALMGNIC-NHGRCIPNRDEDKNFRCVCDSGYEGEFCNKDKNECLIEETCVNNSTCFNLHGDFTCTCKPGYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRCEIECPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRCIN----GFCVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCEQHL-LCTPTTCANGGTCEGVNGVIRCNCPNGFSGDYCEIKDRQLCSRHPCKNGGVCKNTGYCECQYGYTGPTCEEVLVIEKSKETVIRDLCEQRKCMDLASNG--ICNPECNLEECNFDGGDCSGGQRPFSKCQYPARCADQFANGVC 551          

HSP 3 Score: 143.28 bits (360), Expect = 1.330e-33
Identity = 119/362 (32.87%), Postives = 166/362 (45.86%), Query Frame = 3
Query: 2520 GFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLG----HGQCV---DKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFK-CKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKIC-KHHGNCFNDPETGGFKCSCQSGYGGSFCEVN--------IDDCASQPCINGGECGD-GTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINN-FSCVCPRGVSGRFCETIVD--YCKKMECQNGGICKNVIGDFECNCPKGFAGKLCE 3539
            GF+C C  G+ G  CE  I+ C  N C+  + C++ + +Y C C  G SG+ CE      TE + +G    HG+C+   D+   F C C+  Y G  C       D N CL + +C+N     N  G + C C+ G+ G  CE  +D C+   C + G C  D +    C C   + G+RCEI+    C S       +  L    C + +G C+ND       C C+  Y G  CE+N        I  C   PC+N   C D     Y C C  GF G+NC+ +   C   +C  G   + +N    C CP G SG +CE I D   C +  C+NGG+CKN      C C  G+ G  CE
Sbjct:  137 GFQCICNNGYGGSYCEEGIDHCAQNECAEGSTCVNSVYNYYCDCPIGKSGRYCER-----TECALMGNICNHGRCIPNRDEDKNFRCVCDSGYEGEFCNK-----DKNECLIEETCVNNSTCFNLHGDFTCTCKPGYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRCEIE----CPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRCINGFCVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCEQHL-LCTPTTCANGGTCEGVNGVIRCNCPNGFSGDYCE-IKDRQLCSRHPCKNGGVCKNT---GYCECQYGYTGPTCE 479          

HSP 4 Score: 131.339 bits (329), Expect = 4.718e-30
Identity = 144/496 (29.03%), Postives = 199/496 (40.12%), Query Frame = 3
Query: 1299 QDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEI----NIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNI--VCINGQCVDVNNEEK---CICIPGFEGRTCEIEINECF-NNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDE------------VYGFRCQ-----------CMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCIN-TNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINE-CQHNPCSNDAKCIDHINDYQCICQSGFSGKNCE 2681
            + Y C C++GF G  CE   D    + C  G  CI  + G    C+                   CQ+              C EG  G +C+      ++ C  +PC NG  C    GGF C C  G+ G  CE   D C Q   C     C+N   +   Y C CP G      E ++C  +  +C +G+C+   +E+K   C+C  G+EG  C  + NEC     C + S C +L  D+ C C PG+ GK CE  I+ C    C  +G C  +              G RC+           C LP   P C+      +   CYND  CI G       C C      Y G +CE +  +      Q   Y             PC+N+  CI+  N  + C C   + G  CE+    C    C NG TC+ +    RC C  GF+G+ CEI+  + C  +PC N   C    N   C CQ G++G  CE
Sbjct:   42 ETYWCRCKKGFGGAFCERECD----LDCKRGEKCIYDVYGENPTCI-------------------CQDCEDETPPTERTQKGCEEGYGGPDCKTPLFSGVNPCDSDPCNNGL-CYPFYGGFQCICNNGYGGSYCEEGIDHCAQ-NECAEGSTCVN---SVYNYYCDCPIGKSGRYCERTECALMGNICNHGRCIPNRDEDKNFRCVCDSGYEGEFCNKDKNECLIEETCVNNSTCFNLHGDFTCTCKPGYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRCEIECPSGFGGIHCDLPLQRPHCSR-----SNGTCYNDGRCING------FCVCEPD---YIGDRCEINRKDFKFPDIQSCKYN------------PCVNNATCIDLKNSGYSCHCPLGFYGLNCEQ-HLLCTPTTCANGGTCEGVNGVIRCNCPNGFSGDYCEIKDRQLCSRHPCKNGGVC---KNTGYCECQYGYTGPTCE 479          

HSP 5 Score: 128.642 bits (322), Expect = 3.413e-29
Identity = 167/616 (27.11%), Postives = 238/616 (38.64%), Query Frame = 3
Query: 2535 CVAGFTGERCEIE----INECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCI-NRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCR-GNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGN----CFNDPETGGFKC--SCQSGYGGSFCEVNID----DCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNE--------CYSNSC-NTGKCIDQINN-FSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCET-DINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRI-----------DYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELN---KCASKADNKICDLECNKYACGFDGGEC 4259
            C  G+ G  C+      +N C  +PC N+  C      +QCIC +G+ G  CE   + C ++ C     CV+ V  + C C     G  CE  +     N C N G CI NR  ++N   + C C  G+ G  C    + C     C +   C      F C C   Y G+ CE +  + CK Y  +        +  C H  N    C+ +    G +C   C SG+GG  C++ +       ++  C N G C +G    FC C+P + G  C++N  +        C  N C N   CID  N+ +SC CP G  G  CE  +  C    C NGG C+ V G   CNCP GF+G  CE  D   C  +   N         G C  TG           +C C+  +TG  CE  +           D CE+ RK  ++   +NGIC            N  C             N ++C  +    +G  RPF                               +KC     C + F   +  CN+    E+C   G  C           Q E+  C  +    C  +  + +C+LEC+   CGFDGG+C
Sbjct:  101 CEEGYGGPDCKTPLFSGVNPCDSDPC-NNGLCYPFYGGFQCICNNGYGGSYCEEGIDHCAQNECAEGSTCVNSVYNYYCDCPIGKSGRYCERTECALMGNIC-NHGRCIPNRDEDKN---FRCVCDSGYEGEFCNKDKNECLIEETCVNNSTCFNLHGDFTCTCKPGYAGKYCE-EAIDMCKDYVCQN-------DGYCAHDSNQMPICYCEQGFTGQRCEIECPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRCING----FCVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCEQHL-LCTPTTCANGGTCEGVNGVIRCNCPNGFSGDYCEIKDRQLCSRHPCKNG--------GVCKNTG-----------YCECQYGYTGPTCEEVLVIEKSKETVIRDLCEQ-RKCMDLA--SNGIC------------NPEC-------------NLEECNFDGGDCSGGQRPF-------------------------------SKCQYPARCADQFANGV--CNQECNNEECLYDGLDC-----------QSELFRCPAHIRKHCIERRGDGVCNLECSFIGCGFDGGDC 607          

HSP 6 Score: 79.7221 bits (195), Expect = 3.066e-14
Identity = 54/211 (25.59%), Postives = 93/211 (44.08%), Query Frame = 3
Query: 5724 TLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXX------CDLNVTDEY-GRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQHR 6335
            T L LA + +R   +  LL  G++P     + RS L  A+    L ++   L  +  + ++ +   NG T L+   +E     +++    +               +++Y GRTALH+AA+     +V +L+    N+D QD +  TP+ LA KEG  +  + L  N A+  + D +D     VA+ +    + A L    N    N   R
Sbjct:  964 TALMLAVRAHRVRLSVVLLREGANPTIFNNSERSALHEAVVNKDLRILRHLLTDKRLLKEIDELDRNGMTALMLVARELGKHQVEMAELLLSKGAKLDYDGAARKDSNKYKGRTALHYAAMHDNEEMVIMLVRRSSNKDKQDEDGRTPIMLAAKEGCEKTVQYLALNDASLGIVDSMDMTAAQVAEASYHHELAAFLRQVANERHRNDIMR 1174          
BLAST of Neurogenic locus notch protein vs. Ensembl Celegans
Match: crb-1 (Drosophila CRumBs homolog [Source:UniProtKB/TrEMBL;Acc:Q19350])

HSP 1 Score: 197.978 bits (502), Expect = 3.392e-50
Identity = 205/731 (28.04%), Postives = 303/731 (41.45%), Query Frame = 3
Query: 1827 CKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCI--------------CLPGFKGKKCEININECAHNPCG-LNGQCIDE----VYGFRCQCMLPY-SGPTCANKLDPCNPNACYNDAICIPGN------KYDS----YHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLS-----------------------MSNSQIG---PCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHIND-----------------------------------------YQCICQSGFSGKNCEIND-NDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCET-DLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFN-DPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTG-KCIDQINNFSCVCP-RGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPC-SPTGTLECLDRPGTFHCSCKKYFTGKYCETRI 3710
            C +  C +G+C +  N+  C C  G  G+ C+ +++ C +  C  GS+C++  N + CI                P        I  +  AH+  G +    ID+     Y F+ +  L   SG     K D    +  ++  I  P        K+ S    Y     +    + G +  ++V    LD  ++  Y     +                       MS  Q G    CLN   C++      C C + + G  CE  +N+C+   C     C +  D  +C C  GF GE CE+  +EC+   C N  KC+ + ++                                         ++C C  G+SG+ CE  D N+C    C   G CV  V+G  C+C   Y G  CE L   C SN C ++G+C    V  NT   +CNC   + G  C+ +MD C   PC + GVC T D ++F C+C   ++G RCEI+                S +   C H G C    PET    CSC  GY G  C+  ID C + PC+NG  C +    Y C C  GF+G +C++N +EC    C  G KC D+IN++ CVC   G  GR C T ++ C        G C N +G+++C C  GF G  C    N C   IA N  + ++  HG C +P   +E       + C+C + +TG  C  RI
Sbjct:  947 CSSSTCKHGECSETFNDFTCRCSDGSTGKLCD-KVDYCKDASCMKGSRCENADNGHYCIFPITISNGSMLTYSLAPTKFMTLPSIEFSIKAHSQNGHIFTLTIDKSTLSAYLFKKRLALATNSGSGTIQKFDSVIADGNWHQIILNPHKVLIDSVKFISDNQLYPAESKSGASLFVGEQEPQEVTFACLDLFKMGEYPTLSFTKVKIPTNSETWNLTDKASVGTGCMSTDQCGLYSTCLNGATCVDIWNKRKCVCPAGFAGENCEDNVNDCKFVDCGKHGYCLDGIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDVNECNHYDC-NRGHCVMTVSGPACQCEMGYTGRFCEKLLNQCSSNTCSSRGAC--SPVWNNT---VCNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCEIEG---------------SCLKAQCVH-GECIQLSPET--HTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCINGECTNTLGNYKCACRNGFIGPRCSVR-NPCTAQIASNNISSVTCVHGKCVNPVVQIEKNREVAKYECACDRGYTGPTCSQRI 1651          

HSP 2 Score: 197.978 bits (502), Expect = 3.392e-50
Identity = 167/503 (33.20%), Postives = 243/503 (48.31%), Query Frame = 3
Query:  453 CKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCG-SQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSN-DIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDED-YQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCP-EGLTGKNCEINIDECT-PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGY-KCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINE 1937
            C NGATC  DI  K  C C  G+ G  CE   N C    C   G C        C C N + GE CE + + C    C NGG C      K  CQC  +++G +C +  +     +PC   G+C+   D   +C+C  GY+G  C   D++EC  Y+     N G C+ TV    C+C+ G+ G  CE  +  C+++TC + G C     +  C C NN+ G +C+++   C   PC N G+CR  DE+ + C C   + G  C+       +     +G C  ++ + + C C  G+EG  C+  ID C+   C NG +C N + G KC C  GFEG +CEIN++EC  + C+N AKC D  NDY C C   G  G+NC  +I+EC  PN C+NG  C + +G + C C  GF+G RC  ++       PC  +    N+++    + KC+ P       +E++K                  +C C  G+ G TC   I E
Sbjct: 1183 CLNGATC-VDIWNKRKCVCPAGFAGENCEDNVNDCKFVDCGKHGYCLDGIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDVNECNHYDC----NRGHCVMTVSGPACQCEMGYTGRFCEKLLNQCSSNTCSSRGACSPVWNNTVCNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCE--IEGSCLKAQCVHGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCING-ECTNTLGNYKCACRNGFIGPRCSVRN-------PCTAQIASNNISSVTCVHGKCVNPVVQIEKNREVAK-----------------YECACDRGYTGPTCSQRIKE 1653          

HSP 3 Score: 194.512 bits (493), Expect = 3.526e-49
Identity = 166/532 (31.20%), Postives = 250/532 (46.99%), Query Frame = 3
Query:  852 NKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGIC-RDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQD--YKCICQRGFEGKMCET-SIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCE-DRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICL-PGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNA--------------CYNDAICIPGNK-YDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCL 2375
            +K   G  C +  D+C  Y T  C NG TC++     +C C AGF GE CE+++ DC    C   G CLD I   +C+C N + G +CE  +  CE   C NGG C ++  E   C CGN W G +C +V             F + +   D  ++C C  G+ G++CE   ++ C    C N G C+  + G  C C  G+ G  CE  +N+C +  C +   C  + N+  C+C     G +C+  +D C   PC N   C  +    F+C+C + F+G RCE +    K    C   E C+ +  +   + C C  G +   C K++  CK   C+NG  C +     KC C  GFEG  CEI I+EC    C++G++C+D  NDY C+C   GF+G+ C  +INECA+    +NG+C + +  ++C C   + GP C+ + +PC                  C N  + I  N+    Y C C      Y G  C + + E  +      L+G  +  +    I  CL
Sbjct: 1163 DKASVGTGCMS-TDQCGLYST--CLNGATCVDIWNKRKCVCPAGFAGENCEDNVNDCKFVDCGKHGYCLDGIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQCGNSWMGDSC-NVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDVNECNHYDC-NRGHCVMTVSGPACQCEMGYTGRFCEKLLNQCSSNTCSSRGACSPVWNNTVCNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCEIEGSCLK--AQCVHGE-CIQL--SPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCINGECTNTLGNYKCACRNGFIGPRCSVR-NPCTAQIASNNISSVTCVHGKCVNPVVQIEKNREVAKYECACDRG---YTGPTCSQRIKESAMSNISY-LFGPIIAVVIVFAILGCL 1679          

HSP 4 Score: 178.333 bits (451), Expect = 3.382e-44
Identity = 157/492 (31.91%), Postives = 234/492 (47.56%), Query Frame = 3
Query: 1578 INIDEC-TPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSK--CKNIVCINGQCVDVNNEEKCICIPG--FEGRTCEI-EINECFNNPCQHGSQCQDLFNDYL-CICLPGFKGKKCE-ININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDEC------------NLDRTQLALYGLAVLSMSNSQI-GPCLNDNQCIN------TNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQ-SGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLN--------KGSCINRKV----NQNTPGYLCNCRRGFTGPRCEIKM 2933
            ++ D+C   + CLNGA C D      C C  GF G  CE   + CK    C     CL+  +     KCIC +G      EL+K  C+ + C NG     N  EK +C  G  + G +C + +   C ++PCQ+  QC    + +  C C+ G+ G+ CE  ++NEC H  C   G C+  V G  CQC + Y+G  C   L+ C+ N C +   C P   +++  CNC      + G+ C+  +D C              D    +         +  +I G CL   QC++      +  +  C C+  YEG  C+K ++ C+  PC NGA C+N   G++C C  GF G  CEI I+EC    C N AKC D INDY+C+C  +GF G+NC  + N+C   +   +G+C + +  ++C C   +IG  C  ++ PC +    N         G C+N  V    N+    Y C C RG+TGP C  ++
Sbjct: 1172 MSTDQCGLYSTCLNGATCVDIWNKRKCVCPAGFAGENCEDNVNDCK-FVDCGKHGYCLDGIDEA---KCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDVNECNHYDCN-RGHCVMTVSGPACQCEMGYTGRFCEKLLNQCSSNTCSSRGACSP--VWNNTVCNCDN---NWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCEIEGSCLK-AQCVHGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCINGECTNTLGNYKCACRNGFIGPRCS-VRNPCTAQIASNNISSVTCVHGKCVNPVVQIEKNREVAKYECACDRGYTGPTCSQRI 1651          

HSP 5 Score: 164.081 bits (414), Expect = 7.215e-40
Identity = 137/466 (29.40%), Postives = 201/466 (43.13%), Query Frame = 3
Query: 2589 HNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEI-KMDWCRGNPCGDFGVCETDLDS-FKCKCNSEYIGERCEIKKTETCKSYAVEKFK--------------------NESLINK----ICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGEC-GDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCID-QINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKY-FTGKYCETRIDYCEKFRKSGNIPCFNNGICLN-KYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNN 3896
            ++ C N A C+D  N  +C+C +GF+G+NCE N NDC    C  HG C+D ++  +C CN  + G +CE  K  C+   C N G C+  +  +     +C C   + G  C + K   C+ +PC +FG C    D+ F+C C   Y GE CE +    C  Y   +                       E L+N+     C   G C   P      C+C + + G+ C+  +D C   PC N G C  +    + C+CQ  F G  C++    C    C  G+CI       +C C  G  G  C+  +DYCK   C NG  C+N +  ++C C  GF G  CE +I+EC      N                  +C D+   + C C    F G+ C T I+ C            N   C+N +  N +G   N+ C C NG+ G RC + +  C   +  NN
Sbjct: 1180 YSTCLNGATCVDIWNKRKCVCPAGFAGENCEDNVNDCKFVDCGKHGYCLDGIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEK----IVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDVNECNHYDCNRGHCVMTVSGPACQCEMGYTGRFCEKLLNQCSSNTCSSRGAC--SPVWNNTVCNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCEIE-GSCLKAQCVHGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGA----------------KCRDKINDYECVCDGTGFEGRNCTTDINECA-----------NPNNCINGECTNTLG---NYKCACRNGFIGPRCSVRN-PCTAQIASNN 1607          

HSP 6 Score: 160.229 bits (404), Expect = 9.699e-39
Identity = 174/628 (27.71%), Postives = 248/628 (39.49%), Query Frame = 3
Query:  642 FCEFSSN------CASSPCRNGGICK-SLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVN---GKCILANDGEVKCHCNKGYTGNTCSNDI--DECASYETPLCENGGTCINTV-GSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETS-IDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYT----CDCPEGLTGKNC-EINIDECTPNPCLNGARC-EDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDG-------VQNCKKELSKCKNIVCINGQC--VDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPC----------GLNG---------------QCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQI 2363
            FC   +N      C+ + C NGG C  + E   ++C+CPK + G+ C        Q+ C ++   G C+    GE  C C++G+ G+ C N +  D+ A   +P C +   C     GSY            C+++   C   TC+N GTC+ + G+ +C CP  + G +CE     C+   C+NG  C +    Y+C C                                        +GF GK CE      C    C N G CI+      C C PGF+G  CE+     E   C+N A    L N  +    C+CP G  G +C E+    C   PCLNG  C +D    FTC CL  F G+ C    D     + CK    C+      +   C CP+G       + N  +    C +I C+NG    +D   E  C+C  GF+G  CE + + C  NPCQ+G  CQD    Y C C  GF G  CE         P           G++G                C+D   G  C C   Y G  C  K D C+  +C +   C   N   +    C   +G + G +CE  V         L ++  +  S+  S  
Sbjct:    9 FCTLVTNALCNRACSRNTCLNGGTCTVNDETRMFQCECPKGFSGLLC--------QDNCSLHCLHGNCVKGTFGEETCQCSEGWMGSLCDNLVTDDDTAQKCSPQCGDDERCTKGADGSY-----------ICQSNEPSCATHTCQNNGTCVAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLKGSYECKC---------------------------------------LKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELKAEVNEC-ICENPAHVCSLVNGTSRTTQCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQNLFTCFCLPSFTGIYCGEPVDCLVNGSDCKNGGKCVFA---LAATTCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCKLDAEGEPFCVCEEGFDGPFCEPK-SGCTINPCQNGGTCQDADGQYFCHCTSGFGGVHCETVDEPSTPIPTLGTFPSFTTSGIDGFSQSKISCEDCVNSSNCLDVESGPVCICDDGYFGQKCDQKHDKCSKVSCPSGQTCSQVNDNVNITAQCGCEIGHF-GQQCEM-VTSATFSAKSLYIHQSSKFSLGTSSF 571          

HSP 7 Score: 156.377 bits (394), Expect = 1.707e-37
Identity = 176/574 (30.66%), Postives = 243/574 (42.33%), Query Frame = 3
Query:  399 ILLFCPI---AISLNFCENHKCKNGATCQ-SDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFC------EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCE-NDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCE---LKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXX-XXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKIS-CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQ-----NNAKC-IDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYL-----CICLPGFKGKKCEI 2039
             L+FC +   A+    C  + C NG TC  +D    + CEC  G+ G  C+   NC +  C +G   K   G   CQC   W+G  C      + ++   S  C +   C       Y CQ  +           SC +   C  NG C+ A +G VKC C  G+ G+ C  D DEC   +   C+NG  C N  GSY+CKC  GF+G+ CE  D   CT+D C N G C+       C C   + G  CE K  + E     P     +        QC C + + G +C +++       PC N G C       + C C   F G  C   +D     S C NGG C+  +    C C  GF G+NCEI+ +   +  C      N   C +D   +  C C EG  G  CE     CT NPC NG  C+D  G + C C  GF G+ CET   + +  TP  T         T   +     DG    K     C N    +  C+DV +   CIC  G+ G+ C+ + ++C    C  G  C  + ND +     C C  G  G++CE+
Sbjct:    6 FLIFCTLVTNALCNRACSRNTCLNGGTCTVNDETRMFQCECPKGFSGLLCQD--NCSL-HCLHGNCVKGTFGEETCQCSEGWMGSLCDNLVTDDDTAQKCSPQCGDDERCTKGADGSYICQSNE----------PSCATHT-CQNNGTCV-AENGNVKCACPPGFVGDHCETDEDEC---KENFCQNGADCENLKGSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELKAEVNECICENPAHVCSLVNGTSRTTQCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQNLFTCFCLPSFTGIYCGEPVDCLVNGSDCKNGGKCVFALAATTCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCKLDAEGEPFCVCEEGFDGPFCEPK-SGCTINPCQNGGTCQDADGQYFCHCTSGFGGVHCET---VDEPSTPIPTL-------GTFPSFTTSGIDGFSQSKISCEDCVN----SSNCLDVESGPVCICDDGYFGQKCDQKHDKCSKVSCPSGQTCSQV-NDNVNITAQCGCEIGHFGQQCEM 545          

HSP 8 Score: 148.673 bits (374), Expect = 3.866e-35
Identity = 151/514 (29.38%), Postives = 215/514 (41.83%), Query Frame = 3
Query: 1839 VCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCI-DEVYGFRCQCMLPYSGPTC-ANKLDPCNPNACYNDAICIPGNKYDSY-HCNCSTALGRYEGSKCE-KDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKC-IDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVD-KVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCR------GNPCGDF---------------------------------GVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFN-------DPETGGFKCSCQSGYGGSFCEVNIDDCA 3221
             C+NG  CVD+ N+ KC+C  GF G  CE  +N+C    C     C D  ++  CIC  GF G+ CE+  +EC    C   G+C+ +      CQC   + G +C   K   C  + C N   C+   K D++  CNC   +  Y G  CE +DV+ECN                         N   C+ T     C+C   Y GR CEK LN C +N C +   C  + +   C C   + G  C+ +++ C   PC+ND  C  +  N + C CQ  F G  CEI +  C ++ C+ HG+C+        C CN  Y G  C+     C + PCLN  +C N+       GY C C  GF G  CEI +D C       G  C D                                  G C   L ++KC C + +IG RC ++   T +  +       + I+ +   HG C N       + E   ++C+C  GY G  C   I + A
Sbjct: 1182 TCLNGATCVDIWNKRKCVCPAGFAGENCEDNVNDCKFVDCGKHGYCLDGIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQCM--QKTDTFFECNC---MDGYSGELCEQRDVNECNHYD---------------------CNRGHCVMTVSGPACQCEMGYTGRFCEKLLNQCSSNTCSSRGACSPVWNNTVCNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCEI-EGSCLKAQCV-HGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLT-----GYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCINGECTNTLGNYKCACRNGFIGPRCSVRNPCTAQIAS-------NNISSVTCVHGKCVNPVVQIEKNREVAKYECACDRGYTGPTCSQRIKESA 1655          

HSP 9 Score: 139.813 bits (351), Expect = 1.774e-32
Identity = 162/576 (28.12%), Postives = 232/576 (40.28%), Query Frame = 3
Query: 2052 CAHNPCGLNGQCI--DEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGP-CLNDNQCIN-TNGSFICKCSSQY-EGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEIND-NDCTESSCLGHGQCVDK-------------------------------------VNG----FECKCNENYIGTNCEHLK-RPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMD-WCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKI-CKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQ-----------VNTNECYSNS---------------CNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICK----NVIGDFECNCPKGFAGKLCE 3539
            C+ N C   G C   DE   F+C+C   +SG  C    D C+ +  + +  C+ G  +    C CS     + GS C+  V +   D T               +  P C +D +C    +GS+IC+ +        C+               TC       +C C  GF G+ CE + +EC+ N C N A C +    Y+C C  GFSGK CEI D   CT   C  +GQC+                                       VNG     +C+C   ++G +C+ L+ RPCD  PCLN G C++   N     + C C   FTG  C   +D    G+ C + G C   L +  C+C   + G  CEI  +          +++    + I C + G+C  D E   F C C+ G+ G FCE     C   PC NGG C D  G YFC C  GF GV+C+           + T   ++ S                N+  C+D  +   C+C  G  G+ C+   D C K+ C +G  C     NV    +C C  G  G+ CE
Sbjct:   22 CSRNTCLNGGTCTVNDETRMFQCECPKGFSGLLCQ---DNCSLHCLHGN--CVKGT-FGEETCQCSEG---WMGSLCDNLVTD---DDTA-------------QKCSPQCGDDERCTKGADGSYICQSNEPSCATHTCQN------------NGTCVAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLKGSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELKAEVNECICENPAHVCSLVNGTSRTTQCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQNL----FTCFCLPSFTGIYCGEPVDCLVNGSDCKNGGKCVFALAATTCQCPEGFNGSNCEISNS----------YRSHPTCSDIRCLNGGSCKLDAEGEPF-CVCEEGFDGPFCEPK-SGCTINPCQNGGTCQDADGQYFCHCTSGFGGVHCETVDEPSTPIPTLGTFPSFTTSGIDGFSQSKISCEDCVNSSNCLDVESGPVCICDDGYFGQKCDQKHDKCSKVSCPSGQTCSQVNDNVNITAQCGCEIGHFGQQCE 544          

HSP 10 Score: 139.428 bits (350), Expect = 2.486e-32
Identity = 164/585 (28.03%), Postives = 240/585 (41.03%), Query Frame = 3
Query: 1494 CQNNAKCI--DLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCE---TKSDICKQLTP-CKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEI-NINECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDA-IC-IPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGS-FICKCSSQYEGRQC-EKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCI-------DHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNP-------------------------CLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLD----SFKCKCNSEYIGERCEIKKTET--CKSYAVEKFKNESL 3098
            C N   C   D    + C+CP+G +G  C+   D C+ + CL+G   +   G  TCQC +G++G  C+   T  D  ++ +P C  +E C               DG   C+     C    C N G CV  N   KC C PGF G  CE + +EC  N CQ+G+ C++L   Y C CL GF GK CEI +  +C  + C  NGQCI       C+C   + G  C  K +  N   C N A +C +      +  C C +    + G+ C K++     DR                   PCLN   C++   + F C C   + G  C E        + C+NG  C        C+C  GF G  CEI  N  + +P  +D +C+       D   +  C+C+ GF G  CE     CT + C   G C D    + C C   + G +CE +  P    P                         C+N  +C++ +      G +C C  G+ G +C+ K D C    C     C    D    + +C C   + G++CE+  + T   KS  + +    SL
Sbjct:   27 CLNGGTCTVNDETRMFQCECPKGFSGLLCQ---DNCSLH-CLHGNCVKGTFGEETCQCSEGWMGSLCDNLVTDDDTAQKCSPQCGDDERCTKG-----------ADGSYICQSNEPSCATHTCQNNGTCVAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLKGSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELKAE-VNECICENPAHVCSLVNGTSRTTQCECPSG---FMGADC-KELQARPCDRE------------------PCLNGGHCVDDGQNLFTCFCLPSFTGIYCGEPVDCLVNGSDCKNGGKCVFALAATTCQCPEGFNGSNCEIS-NSYRSHPTCSDIRCLNGGSCKLDAEGEPFCVCEEGFDGPFCEPKSG-CTINPCQNGGTCQDADGQYFCHCTSGFGGVHCETVDEPSTPIPTLGTFPSFTTSGIDGFSQSKISCEDCVNSSNCLDVE-----SGPVCICDDGYFGQKCDQKHDKCSKVSCPSGQTCSQVNDNVNITAQCGCEIGHFGQQCEMVTSATFSAKSLYIHQSSKFSL 566          

HSP 11 Score: 136.346 bits (342), Expect = 1.993e-31
Identity = 149/518 (28.76%), Postives = 212/518 (40.93%), Query Frame = 3
Query: 2529 CRCVAGFTGERCEIEINECQHNP-----CSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIK-MDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFC-EVNIDDCASQPCINGGEC-GDGTGMYFCKCQPGFQG------VNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDY-----CKKMECQNGGICK-NVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFN-NGI------------CLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEI 3983
            C+C  G+ G  C+  + +          C +D +C     D   ICQS         N+  C   +C  +G CV +    +C C   ++G +CE  +  C  N C N   C N K       Y C C +GF+G  CEI+    C  + C + G C +      CKC+  + G  CE+K  E  +          SL+N   +              +C C SG+ G+ C E+    C  +PC+NGG C  DG  ++ C C P F G      V+C VN ++C     N GKC+  +   +C CP G +G  CE    Y     C  + C NGG CK +  G+  C C +GF G  CE   + C  N              PC   GT  C D  G + C C   F G +CET  +        G  P F  +GI            C+N   N +       CIC +GY G++C     KC    C +   C     +  ++ +C C  G  G  CE+
Sbjct:   78 CQCSEGWMGSLCDNLVTDDDTAQKCSPQCGDDERCTKGA-DGSYICQS---------NEPSCATHTCQNNGTCVAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLK-----GSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELK-AEVNECICENPAHVCSLVNGTSRTT------------QCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQNLFTCFCLPSFTGIYCGEPVDCLVNGSDCK----NGGKCVFALAATTCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCKLDAEGEPFCVCEEGFDGPFCEPK-SGCTIN--------------PCQNGGT--CQDADGQYFCHCTSGFGGVHCETVDEPSTPIPTLGTFPSFTTSGIDGFSQSKISCEDCVNS-SNCLDVESGPVCICDDGYFGQKCDQKHDKCSKVSCPSGQTCSQVNDNVNITAQCGCEIGHFGQQCEM 545          

HSP 12 Score: 130.954 bits (328), Expect = 7.596e-30
Identity = 178/615 (28.94%), Postives = 241/615 (39.19%), Query Frame = 3
Query: 1593 CTPNPCLNGARCE--DRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVD-VNNEEKCICIPGFEGRTCEIEINECFNNPCQHGS-QCQDLFNDYLCICLPGFKGKK-CEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCE-KDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGF----RCRCVAGFTGERC-EIEINECQHNPCSNDAKCIDH-INDYQCICQSGFSGKNC-EINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCE----HLKRP-CDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCE--------IKKTETCKSYA---VEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECG---DGTGMYF-CKCQPGFQGVNCQVNTNECYS 3338
            C+ N CLNG  C   D    F C+C +GF GL                                 +C D   NC        ++ C++G CV     EE C C  G+ G  C+  + +  ++  Q  S QC D        C  G  G   C+ N   CA + C  NG C+ E    +C C   + G  C    D C  N C N A C   N   SY C C   L  + G  CE +D  +C  D                     C N+ QCI+T     CKCS  ++G  CE                C +L +G     +C C +GF G  C E++   C   PC N   C+D   N + C C   F+G  C E  D     S C   G+CV  +    C+C E + G+NCE    +   P C    CLN GSC  +   +  P   C C  GF GP CE K   C  NPC + G C+     + C C S + G  CE        I    T  S+    ++ F    +  + C +  NC  D E+G   C C  GY G  C+   D C+   C +G  C    D   +   C C+ G  G  C++ T+  +S
Sbjct:   22 CSRNTCLNGGTCTVNDETRMFQCECPKGFSGL---------------------------------LCQD---NC--------SLHCLHGNCVKGTFGEETCQCSEGWMGSLCDNLVTD--DDTAQKCSPQCGDDER-----CTKGADGSYICQSNEPSCATHTCQNNGTCVAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADC--ENLKGSYECKC---LKGFSGKYCEIQDKKQCTSDY--------------------CHNNGQCISTGSDLSCKCSPGFDGAFCELKAEVNECICENPAHVC-SLVNGTSRTTQCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQNLFTCFCLPSFTGIYCGEPVDCLVNGSDCKNGGKCVFALAATTCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSC--KLDAEGEP--FCVCEEGFDGPFCEPK-SGCTINPCQNGGTCQDADGQYFCHCTSGFGGVHCETVDEPSTPIPTLGTFPSFTTSGIDGFSQSKISCEDCVNSSNCL-DVESGPV-CICDDGYFGQKCDQKHDKCSKVSCPSGQTCSQVNDNVNITAQCGCEIGHFGQQCEMVTSATFS 552          

HSP 13 Score: 129.028 bits (323), Expect = 3.025e-29
Identity = 173/613 (28.22%), Postives = 240/613 (39.15%), Query Frame = 3
Query: 1134 CELKPCKNGGICRDFDED--YQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCE---TSIDNCQKIS--CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEI--EINECF-NNPCQHGSQCQDLFNDYLCICLPGFKGKKC-EININECAHNPCGLNGQCIDEVYG-FRCQCMLPYSGPTCANKLD-PCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQC-INTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSG-KNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEI 2927
            C    C NGG C   DE   +QC C   ++G  C D       +    +G C    + +  C C  G+ G +C+   T  D  QK S  C +   C    +G             C+ N   C    CQNN  C+  N +  C CP G  G +CE + DEC  N C NGA CE+  G + C+CL+GF G  CE +    KQ     T + C N                                NGQC+   ++  C C PGF+G  CE+  E+NEC   NP    S          C C  GF G  C E+    C   PC   G C+D+    F C C+  ++G  C   +D   N + C N   C+      +  C C      + GS CE      N  R+      +            CLN   C ++  G   C C   ++G  CE   + C  NPC+NG TC +    + C C +GF G  CE  ++E         +  I  +  +     SG  G    +I+  DC  SS      C+D  +G  C C++ Y G  C+     C    C +  +C     N N     C C  G  G +CE+
Sbjct:   22 CSRNTCLNGGTCTVNDETRMFQCECPKGFSGLLCQD-----NCSLHCLHGNCVKGTFGEETCQCSEGWMGSLCDNLVTDDDTAQKCSPQCGDDERCTKGADGS----------YICQSNEPSCATHTCQNNGTCVAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLKGSYECKCLKGFSGKYCEIQDK--KQC----TSDYCHN--------------------------------NGQCISTGSDLSCKCSPGFDGAFCELKAEVNECICENPAHVCSLVNGTSRTTQCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQNLFTCFCLPSFTGIYCGEPVDCLVNGSDCKNGGKCVFA--LAATTCQCPEG---FNGSNCEIS----NSYRSHPTCSDIR-----------CLNGGSCKLDAEGEPFCVCEEGFDGPFCEP-KSGCTINPCQNGGTCQDADGQYFCHCTSGFGGVHCET-VDE--------PSTPIPTLGTFPSFTTSGIDGFSQSKISCEDCVNSS-----NCLDVESGPVCICDDGYFGQKCDQKHDKCSKVSCPSGQTCSQVNDNVNITAQ-CGCEIGHFGQQCEM 545          

HSP 14 Score: 127.487 bits (319), Expect = 1.053e-28
Identity = 103/367 (28.07%), Postives = 148/367 (40.33%), Query Frame = 3
Query:  438 CENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQK---------------------------------------SNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKN-----GGICRDFDEDYQCICGNQWTGKNCD-------DVXXXXXXXXXXXXGFCESVNYQ--------DYKCICQRGFEGKMCETSI 1358
            C++  C+N   C    +  + C C  GY G  CEQ+                                       + C    C + G C  +  N VC C N W G  C+   + C   PC N G+C++ + + + C+C K ++G  CE+  SC       V+G+CI  +     C CN GY G+ C   ID C +     C NG  C N +  Y+C C  GF G  CE +I +C  + CKNG  C DKI  Y CVC     GT  E +    ++  C N      G C +   +Y+C C N + G  C         + +    +    +G C +   Q         Y+C C RG+ G  C   I
Sbjct: 1294 CKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDVNECNHYDCNRGHCVMTVSGPACQCEMGYTGRFCEKLLNQCSSNTCSSRGACSPVWNNTVCNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCEIEGSCLKAQC--VHGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGP---CLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCD----GTGFEGRNCTTDINECANPNNCINGECTNTLGNYKCACRNGFIGPRCSVRNPCTAQIASNNISSVTCVHGKCVNPVVQIEKNREVAKYECACDRGYTGPTCSQRI 1651          

HSP 15 Score: 119.013 bits (297), Expect = 3.462e-26
Identity = 151/518 (29.15%), Postives = 215/518 (41.51%), Query Frame = 3
Query:  450 KCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCG-SQNPCGVNGKCILANDGEVKCHCNKGYTGNTCS--NDIDECASYETPLCENGG---TCIN-TVGSYQCKCKAGFNGERC-ENDIVDCTNDTCKNGGTCLDK-IGSYRCVCPNNYFGTNC-ENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGK-CNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNN----EEKCICIPGFEGRTCEIEINECFN 1946
            +C +   C    +G Y+C+            + +C    CQN GTC    GN  C C   +VG+ CE   + C  + C+NG  C++L+   YEC+C K + G  CE+ +    + + C  NG+CI +   ++ C C+ G+ G  C    +++EC      +CEN     + +N T  + QC+C +GF G  C E     C  + C NGG C+D     + C C  ++ G  C E    L     CKNGG C        C C   + G NC+                  S +Y+ +                   C  I C NGGSC    EG   C C  GF         + C   PCQN   C D +  Y C C  G  G +CE   +  TP P L           FT   + GF      ++S I      C     CL+V    SG  CIC DG   Q C ++  KC  + C +GQ C  VN+      +C C  G  G+ CE+  +  F+
Sbjct:  105 QCGDDERCTKGADGSYICQ----------SNEPSCATHTCQNNGTCVAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLK-GSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCI-STGSDLSCKCSPGFDGAFCELKAEVNEC------ICENPAHVCSLVNGTSRTTQCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQNLFTCFCLPSFTGIYCGEPVDCLVNGSDCKNGGKCVFALAATTCQCPEGFNGSNCEI-----------------SNSYRSHP-----------------TCSDIRCLNGGSCKLDAEGEPFCVCEEGF-DGPFCEPKSGCTINPCQNGGTCQDADGQYFCHCTSGFGGVHCETVDEPSTPIPTLG------TFPSFTTSGIDGF------SQSKI--SCEDCVNSSNCLDV---ESGPVCICDDGYFGQKCDQKHDKCSKVSCPSGQTCSQVNDNVNITAQCGCEIGHFGQQCEMVTSATFS 552          

HSP 16 Score: 117.472 bits (293), Expect = 9.593e-26
Identity = 140/469 (29.85%), Postives = 190/469 (40.51%), Query Frame = 3
Query: 2805 RPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEI--KMDWCRGN-PCGDFGVCETDLDSFKCKCNSEYIGERCEIKKT---------------ETCKSYAVEKF---KNE-SLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQV-NTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQN-GGICKNVIG---DFECNCPKGFAGKLCETDINECKYNIAGNATNLISNP--HGPCSPTGTLECLDR-PGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSK-----KCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEIT 4103
            R C  N CLN G+C    VN  T  + C C +GF+G  C+    +    GN   G FG          C+C+  ++G  C+   T               E C   A   +    NE S     C+++G C    E G  KC+C  G+ G  CE + D+C    C NG +C +  G Y CKC  GF G  C++ +  +C S+ C N G+CI   ++ SC C  G  G FCE   +   +  C+N   +C  V G     +C CP GF G  C+                L + P    PC   G   C+D     F C C   FTG YC   +D            C N G C+             +C CP G+ G  C+I++       C    C N G C+   +D      C C  G  G FCE    + C    C N G+C +  G+  CHC  G  G  CE  
Sbjct:   20 RACSRNTCLNGGTCT---VNDETRMFQCECPKGFSGLLCQDNCSLHCLHGNCVKGTFG-------EETCQCSEGWMGSLCDNLVTDDDTAQKCSPQCGDDERCTKGADGSYICQSNEPSCATHTCQNNGTCV--AENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLKGSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELKAEV-NECICENPAHVCSLVNGTSRTTQCECPSGFMGADCK---------------ELQARPCDREPCLNGG--HCVDDGQNLFTCFCLPSFTGIYCGEPVDCL-----VNGSDCKNGGKCVFALAAT-------TCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCK---LDAEGEPFCVCEEGFDGPFCEPK--SGCTINPCQNGGTCQDADGQYFCHCTSGFGGVHCETV 441          

HSP 17 Score: 114.775 bits (286), Expect = 6.826e-25
Identity = 111/341 (32.55%), Postives = 148/341 (43.40%), Query Frame = 3
Query: 3120 HGNCFNDPETGGFKCSCQSGYGGSFCE-VNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVN-CQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCET-DINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQN---EVGRNYNFSCICPNGYGGERCK-INSKKCQLNVCKNNGICRPFEIDDRMS-FKCECPPGVGGLFCEIDYVNECL--STKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGS 4109
            HGNC      G   C C  G+ GS C+ +  DD  +Q C    +CGD       +C  G  G   CQ N   C +++C N G C+ +  N  C CP G  G  CET  D CK+  CQNG  C+N+ G +EC C KGF+GK CE  D  +C  +   N        +G C  TG+           C C   F G +CE + +              N  IC N         G +    C CP+G+ G  CK + ++ C    C N G C    +DD  + F C C P   G++C      +CL   + C N G CV       C C +G  G  CEI+ S
Sbjct:   65 HGNCVKGT-FGEETCQCSEGWMGSLCDNLVTDDDTAQKC--SPQCGDDE-----RCTKGADGSYICQSNEPSCATHTCQNNGTCVAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLKGSYECKCLKGFSGKYCEIQDKKQCTSDYCHN--------NGQCISTGS--------DLSCKCSPGFDGAFCELKAE-------------VNECICENPAHVCSLVNGTSRTTQCECPSGFMGADCKELQARPCDREPCLNGGHC----VDDGQNLFTCFCLPSFTGIYCGEPV--DCLVNGSDCKNGGKCVFALAATTCQCPEGFNGSNCEISNS 362          

HSP 18 Score: 110.538 bits (275), Expect = 1.290e-23
Identity = 110/375 (29.33%), Postives = 160/375 (42.67%), Query Frame = 3
Query:  438 CENHKCKNGATCQSDINGKYVCECAYGYKGTYC--EQKSNCPITPCQNGGTCKLIAGNNV-CQCLNEWVGEFCEFS--SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCE-LPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYE------------------------TPLCENGGTCIN-----------TVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCIC-GNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMC--------ETSIDNCQKISCFNGGSCINMI 1412
            CE  +C NG  C  + + K VC+C   + G  C   + +NC  +PCQN G C         C C++ + GE CE    + C    C N G C  + +    CQC   Y G  CE L N C S N C   G C    +  V C+C+  + G  C + +D C  +                            CE  G+C+            +  ++ C C  G+ G+ C+  I  C    C NG  C +K+  Y+C C   + G +CE     C L+ CKNG  CRD   DY+C+C G  + G+NC    N C       NG C +    +YKC C+ GF G  C        + + +N   ++C + G C+N +
Sbjct: 1254 CEGVECHNGGKCVKNRSEKIVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDVNECNHYDC-NRGHC-VMTVSGPACQCEMGYTGRFCEKLLNQC-SSNTCSSRGACSPVWNNTV-CNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCEIEGSCLKAQCVHGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCINGECTNT-LGNYKCACRNGFIGPRCSVRNPCTAQIASNNISSVTCVH-GKCVNPV 1622          

HSP 19 Score: 102.834 bits (255), Expect = 2.662e-21
Identity = 127/446 (28.48%), Postives = 173/446 (38.79%), Query Frame = 3
Query: 3159 KCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCI-DQINNFSCVCPRGVSGRFCE-TIVDYCKKMECQNGGICKNVIGDF-ECNCPKGFAGKLCET-DINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEID------------------------------------YVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCE----------------LNKCASKAD--NKICDLECNKYAC----GFDGGECLHRVP--KRIDGNDIS 4301
            KC C +G+ G  CE N++DC    C   G C DG     C C  GF G +C++  +EC    C N GKC+ ++     C C     G  C  T    CK   CQN G C      F ECNC  G++G+LCE  D+NEC               H  C+    +  +  P    C C+  +TG++CE  ++ C     S N  C + G C   + N V       C C N + G  C+     C    C N+G+CR    +D  +F CEC     G  CEI+                                     ++ C +  C N  +C N      C C  G  G  CEI    C L    N    +D+I+D E                +N+CA+  +  N  C      Y C    GF G  C  R P   +I  N+IS
Sbjct: 1197 KCVCPAGFAGENCEDNVNDCKFVDCGKHGYCLDGIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDVNECN--------------HYDCNRGHCVMTVSGPA---CQCEMGYTGRFCEKLLNQC-----SSNT-CSSRGACSPVWNNTV-------CNCDNNWRGAHCQHQMDTCLDFPCNNDGVCR---TNDENTFSCECQKFFMGTRCEIEGSCLKAQCVHGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCINGECTNTLGNYKCACRNGFIGPRCSVRNPCTAQIASNNIS 1609          

HSP 20 Score: 83.1889 bits (204), Expect = 2.417e-15
Identity = 72/250 (28.80%), Postives = 114/250 (45.60%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCI-LANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERC-----------ENDI--VDCTNDTCKNGGTCLDK---IGSYRCVCPNNYFGTNCENK 1124
            ++ C +  C N   C+++    + CEC   + GT CE + +C    C +G   +L    + C C   + G+ C+   + C + PC NG  C++ ++  Y+C C   + G +CE+     +   C    KC    ND E  C    G+ G  C+ DI+ECA+    +    G C NT+G+Y+C C+ GF G RC            N+I  V C +  C N    ++K   +  Y C C   Y G  C  +
Sbjct: 1406 MDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCEIEGSCLKAQCVHGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCEN-KLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCD-GTGFEGRNCTTDINECANPNNCI---NGECTNTLGNYKCACRNGFIGPRCSVRNPCTAQIASNNISSVTCVHGKCVNPVVQIEKNREVAKYECACDRGYTGPTCSQR 1650          

HSP 21 Score: 79.337 bits (194), Expect = 3.948e-14
Identity = 108/409 (26.41%), Postives = 160/409 (39.12%), Query Frame = 3
Query: 3330 CYSNSC-NTGKCI--DQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKY-CETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSA--------CNLASIDN--SQTYQDEISDCELNKCASKADNKICDLEC------------NKYAC----GFDGGECLHRVPKRIDGNDIS------IASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQ 4448
            C  N+C N G C   D+   F C CP+G SG  C+   D C  + C +G   K   G+  C C +G+ G LC+  + +              +    CSP    +C D        C K   G Y C++    C          C NNG C       V  N N  C CP G+ G+ C+ +  +C+ N C+N   C       + S++C+C  G  G +CEI    +C S  C+NNG C++      C C+ G  G  CE+             ++ S+ N  S+T Q E     +     +   + CD E             N + C     F G  C   V   ++G+D         A   + C+  +  N       N+ R  P C+   CL  G   +DA G+
Sbjct:   22 CSRNTCLNGGTCTVNDETRMFQCECPKGFSGLLCQ---DNCS-LHCLHGNCVKGTFGEETCQCSEGWMGSLCDNLVTD-------------DDTAQKCSP----QCGDDE-----RCTKGADGSYICQSNEPSCATHT------CQNNGTC-------VAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENL----KGSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELKAEVNECICENPAHVCSLVNGTSRTTQCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQNLFTCFCLPSFTGIYCGEPVDCLVNGSDCKNGGKCVFALAATTCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCKLDAEGE 387          

HSP 22 Score: 68.1662 bits (165), Expect = 1.012e-10
Identity = 93/372 (25.00%), Postives = 138/372 (37.10%), Query Frame = 3
Query: 3456 CQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKIN-SKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKA------DNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCIE 4550
            C NG  C ++    +C CP GFAG+ CE ++N+CK+   G         HG         CLD      C C   F G++CE   D CE       + C N G C+        R+    C C N + G+ C +  +  C+ + C+N G C   +  D   F+C C  G  G  CE   VNEC    C N G CV       C C  G  G  CE                    ++ C  N C+S+       +N +C+ + N     + G  C H++   +D                     PC+N       D  C T               +      C K +   +C++E + ++     G+CI+
Sbjct: 1183 CLNGATCVDIWNKRKCVCPAGFAGENCEDNVNDCKFVDCGK--------HG--------YCLDGIDEAKCICNNGFHGEHCELAKDECE------GVECHNGGKCVKN------RSEKIVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQC--MQKTDTF-FECNCMDGYSGELCEQRDVNECNHYDC-NRGHCVMTVSGPACQCEMGYTGRFCE------------------KLLNQCSSNTCSSRGACSPVWNNTVCNCDNN-----WRGAHCQHQMDTCLD--------------------FPCNN-------DGVCRTN-------------DENTFSCECQKFFMGTRCEIEGSCLKAQCVHGECIQ 1459          

HSP 23 Score: 61.2326 bits (147), Expect = 1.285e-8
Identity = 56/177 (31.64%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCE-QKSNCPITPCQNGGTCKLIAGNNVCQCLNE-WVGEFCEFSSNCASSP--CRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCG-------VNGKCI-----LANDGEV---KCHCNKGYTGNTCSNDIDECA 902
            +++C+   C NGA C++ + G Y C CA G++G  CE     C +  C+NG  C+    +  C C    + G  C    N  ++P  C NG    +L    Y+C C   ++G  C + N C +Q           V+GKC+     +  + EV   +C C++GYTG TCS  I E A
Sbjct: 1482 IDYCKAGPCLNGANCENKLTG-YKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCINGECTNTL--GNYKCACRNGFIGPRCSVRNPCTAQIASNNISSVTCVHGKCVNPVVQIEKNREVAKYECACDRGYTGPTCSQRIKESA 1655          
BLAST of Neurogenic locus notch protein vs. Ensembl Celegans
Match: egas-2 (EGF plus ASC domain ion channel [Source:UniProtKB/TrEMBL;Acc:Q9U1T8])

HSP 1 Score: 128.642 bits (322), Expect = 2.468e-29
Identity = 149/533 (27.95%), Postives = 219/533 (41.09%), Query Frame = 3
Query:  471 CQSDINGKYVCECAYGYKGTYC--EQKSNCPITPCQNGGTCKLIAGNNV------CQCLNEWVGEFCEFSSNCASSPCRNGGICKS-LEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTC--INTVGSYQCKCKAGFNGERCENDIVDCTNDTCKN--GGTCLDKIGSYRCVCPNNYFGTN------CENKRTLCELKPCKNGGICRDFDED----YQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCE-SVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGG-KCNCLPGFXXXXXXXXXXXXXXKPCQNN--AKCID-LNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQL---------TPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQ 1958
            C S I   + C C  GY G  C  E  + C  +PC++G TC  ++ N+       C C ++  G  CE+ + CAS+PC+N G C   LE   Y C C  ++ G  CE+ ++  +     V   C L + G +   C   +T N+ ++   +C +Y      +  T   +   G++    +A         D        CK   GG   +  G     C     GT+      C +  TLC        GIC +   D    YQCICG  WT  +C+             NG C  +  Y  Y C C  G+ G +C+   D C   +C  GG+C     GG  C+CL  + G NCE         PC N      +D +  +YTC C  G TG+NC+  ID C PNPC   + C     GF C C+ G  G  C T  D+C            +PC +++   N     +G+ C C D          K  + +C     ++V  ++  + I G    T    +N+   NP Q
Sbjct:   97 CTSKIE-SHTCACQAGYTGADCTSELGTACATSPCRSGATC--VSSNSSATTEYSCICTDQQFGTHCEYDNLCASNPCQNSGNCTMVLENSNYLCTCSPDWQGRRCEVADAVSTP---PVQDGCYLYDTGSIG-ACTTKFTENSLTSS--KCNNYALEQSTDTVTMNYLTLCGAWCMVSEAPLCNTSWYMD------GDCKKSCGGDSAEYCGRLNSRCIVYEAGTSETDANACTDNSTLCNAN--LGQGICINLSSDVTNGYQCICGPLWTDTDCETPVASACTPSPCWNGICVLNEQYNTYTCACDDGYFGDLCQYP-DVCTSSTCLYGGTCTETSSGGYTCSCLSQYFGTNCEEINRCNYADPCVNGDCQTTVDGITTNYTCTCDSGWTGENCDTMIDYCIPNPCSYNSTCSPYFKGFNCTCITGLTGANCSTIIDLCVPYKDSTGKWIKSPCNSKDDLANCTIEINGFNCSCSD----------KWTDTLCD----LNVLIKDVLLTIYGHVDLTMITLLNDLMQNPSQ 597          

HSP 2 Score: 98.9821 bits (245), Expect = 3.288e-20
Identity = 74/238 (31.09%), Postives = 108/238 (45.38%), Query Frame = 3
Query: 2508 NLADGFRCRCVAGFTGERCEIEI-NECQHNPCSNDAKCI-DHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNG-FECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFN-DPETGGFKCSCQSGYGGSFCEVNI 3209
            ++ +G++C C   +T   CE  + + C  +PC N    + +  N Y C C  G+ G  C+  D  CT S+CL  G C +  +G + C C   Y GTNCE + R   ++PC+N G C    V+  T  Y C C  G+TG  C+  +D+C  NPC     C      F C C +   G  C     + C  Y   K      I   C    +  N   E  GF CSC   +  + C++N+
Sbjct:  337 DVTNGYQCICGPLWTDTDCETPVASACTPSPCWNGICVLNEQYNTYTCACDDGYFGDLCQYPDV-CTSSTCLYGGTCTETSSGGYTCSCLSQYFGTNCEEINRCNYADPCVN-GDC-QTTVDGITTNYTCTCDSGWTGENCDTMIDYCIPNPCSYNSTCSPYFKGFNCTCITGLTGANCS-TIIDLCVPY---KDSTGKWIKSPCNSKDDLANCTIEINGFNCSCSDKWTDTLCDLNV 567          

HSP 3 Score: 92.0485 bits (227), Expect = 4.559e-18
Identity = 121/481 (25.16%), Postives = 176/481 (36.59%), Query Frame = 3
Query:  438 CENHKCKNGATC---QSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNN--VCQCLNEWVGEFCEFSSNCASSPCRNG-----------------------GICKSLEIHKYECQCPKNYL---GMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNK------GYTGNTCSNDIDECASYETPLCENG---GTCIN----TVGSYQCKCKAGFNGERCENDIVD-CTNDTCKNGGTCL-DKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDE-DYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVN---YQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTP----------NPC---LNGARCEDRVGGFTCQCLQGFVGLRCE 1691
            C    C++GATC    S    +Y C C     GT+CE  + C   PCQN G C ++  N+  +C C  +W G  CE +   ++ P ++G                         C +  + +       NYL   G  C +  +        ++G C  +  G+   +C +       Y   T   D + C    T LC      G CIN        YQC C   +    CE  +   CT   C NG   L ++  +Y C C + YFG  C+    +C    C  GG C +     Y C C +Q+ G NC+++ N C       NG C++       +Y C C  G+ G+ C+T ID C    C    +C    +G  C C+                                       GLTG NC   ID C P          +PC    + A C   + GF C C   +    C+
Sbjct:  125 CATSPCRSGATCVSSNSSATTEYSCICTDQQFGTHCEYDNLCASNPCQNSGNCTMVLENSNYLCTCSPDWQGRRCEVADAVSTPPVQDGCYLYDTGSIGACTTKFTENSLTSSKCNNYALEQSTDTVTMNYLTLCGAWCMVSEAPLCNTSWYMDGDCKKSCGGDSAEYCGRLNSRCIVYEAGTSETDANACTDNST-LCNANLGQGICINLSSDVTNGYQCICGPLWTDTDCETPVASACTPSPCWNGICVLNEQYNTYTCACDDGYFGDLCQYPD-VCTSSTCLYGGTCTETSSGGYTCSCLSQYFGTNCEEI-NRCNYADPCVNGDCQTTVDGITTNYTCTCDSGWTGENCDTMIDYCIPNPCSYNSTCSPYFKGFNCTCI--------------------------------------TGLTGANCSTIIDLCVPYKDSTGKWIKSPCNSKDDLANCTIEINGFNCSCSDKWTDTLCD 564          

HSP 4 Score: 91.2781 bits (225), Expect = 7.846e-18
Identity = 140/561 (24.96%), Postives = 217/561 (38.68%), Query Frame = 3
Query: 1998 CICLPGFKG--KKCEININECAHNPCGLNGQ--CIDEVYGFRCQCMLPYSGPTCANKL-DPCNPNACYNDAICIPGNKYDS--YHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQC--INTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNG--------FECKCNENYIGTN------CEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKM-DWCRGNPCGDFGVCETD--LDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDC-ASQPCINGG--ECGDG-TGMYFCKCQPGFQGVNCQVNTNECYSNSCN-TGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNV-------------IGDFECNCPKGFAGKLCETDI 3548
            C C+ G     + C+  +++C  +PCG      C  ++    C C   Y+G  C ++L   C  + C + A C+  N   +  Y C C+    +  G+ CE D                  L  SN    PC N   C  +  N +++C CS  ++GR+CE                 D  + G    C   FT        N    + C+N A  ++   D   +      G  C +++     +S    G C     G           +C     GT+      C      C++N  L +G CIN   +  T GY C C   +T   CE  +   C  +PC + G+C  +   +++ C C+  Y G+ C+    + C S               C + G C  +  +GG+ CSC S Y G+ CE  I+ C  + PC+NG      DG T  Y C C  G+ G NC    + C  N C+    C      F+C C  G++G  C TI+D C   +   G   K+              I  F C+C   +   LC+ ++
Sbjct:   64 CYCVDGTTNGTEPCDTIVDQCGDDPCGEPEYFLCTSKIESHTCACQAGYTGADCTSELGTACATSPCRSGATCVSSNSSATTEYSCICT---DQQFGTHCEYDN-----------------LCASN----PCQNSGNCTMVLENSNYLCTCSPDWQGRRCEVADAVSTPPVQDGCYLYDTGSIG---ACTTKFTE-------NSLTSSKCNNYA--LEQSTDTVTMNYLTLCGAWCMVSEAPLCNTSWYMDGDCKKSCGGDSAEYCGRLNSRCIVYEAGTSETDANACTDNSTLCNAN--LGQGICINLSSDV-TNGYQCICGPLWTDTDCETPVASACTPSPCWN-GICVLNEQYNTYTCACDDGYFGDLCQYP--DVCTS-------------STCLYGGTC-TETSSGGYTCSCLSQYFGTNCE-EINRCNYADPCVNGDCQTTVDGITTNYTCTCDSGWTGENCDTMIDYCIPNPCSYNSTCSPYFKGFNCTCITGLTGANCSTIIDLCVPYKDSTGKWIKSPCNSKDDLANCTIEINGFNCSCSDKWTDTLCDLNV 567          

HSP 5 Score: 79.7221 bits (195), Expect = 2.448e-14
Identity = 127/532 (23.87%), Postives = 201/532 (37.78%), Query Frame = 3
Query: 1539 CDCPEGLTG--KNCEINIDECTPNPC--LNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSG-YKCICPDGVQNCKKELSK-CKNIVCIN-GQCVDV--NNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIP--GNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATC--DNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHIN-DYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNG----FECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCR----------GNPCG---DFGVCETDLDSFKCKCNSEYIGERCEI 3041
            C C +G T   + C+  +D+C  +PC       C  ++   TC C  G+ G  C ++       +PC++   C++ N++ +  Y CIC D       E    C +  C N G C  V  N+   C C P ++GR CE+  +     P Q G    D           G  G  C     E +      N   +++         L   G  C     P    + Y D  C    G     Y    ++    YE    E D + C  + T         L  +N   G C+N +  + TNG + C C   +    CE P+ +           C  +   + + C C  G+ G+ C+   + C  + C     C +  +  Y C C S + G NCE   N C  +    +G C   V+G    + C C+  + G NC+ +   C  NPC    +C     +    G+ C C  G TG  C   +D C            +PC    D   C  +++ F C C+ ++    C++
Sbjct:   64 CYCVDGTTNGTEPCDTIVDQCGDDPCGEPEYFLCTSKIESHTCACQAGYTGADCTSELGTACATSPCRSGATCVSSNSSATTEYSCICTDQQFGTHCEYDNLCASNPCQNSGNCTMVLENSNYLCTCSPDWQGRRCEVA-DAVSTPPVQDGCYLYDT----------GSIG-ACTTKFTENSLTSSKCNNYALEQSTDTVTMNYLTLCGAWCMVSEAPLCNTSWYMDGDCKKSCGGDSAEYCGRLNSRCIVYEAGTSETDANACTDNST---------LCNANLGQGICINLSSDV-TNG-YQCICGPLWTDTDCETPVASACTPSPCWNGICVLNEQYNTYTCACDDGYFGDLCQYP-DVCTSSTCLYGGTCTETSSGGYTCSCLSQYFGTNCE-EINRCNYADPCVNGDCQTTVDGITTNYTCTCDSGWTGENCDTMIDYCIPNPCSYNSTC-----SPYFKGFNCTCITGLTGANCSTIIDLCVPYKDSTGKWIKSPCNSKDDLANCTIEINGFNCSCSDKWTDTLCDL 565          

HSP 6 Score: 77.411 bits (189), Expect = 1.235e-13
Identity = 118/492 (23.98%), Postives = 185/492 (37.60%), Query Frame = 3
Query: 1533 YTCDCPEGLTGKNCEINI-DECTPNPCLNGARC----EDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCIC-----------------LPG-----------------------FKGKKCEININECAHNP--CGLN---GQCI----DEVYGFRCQCMLPYSGPTCANKL-DPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXG---ATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCT----------ESSCLGH---GQCVDKVNGFECKCNENYIGTNCE 2795
            +TC C  G TG +C   +   C  +PC +GA C          ++C C     G  CE   ++C    PC+    C  V    S Y C C    Q  + E++   +   +   C   +      C   F   +  +  ++C N   +  +    +  +YL +C                 + G                       ++    E + N C  N   C  N   G CI    D   G++C C   ++   C   +   C P+ C+N  IC+   +Y++Y C C      Y G  C+   D C    +   LYG           G C        ++G + C C SQY G  CE+       +PC NG    T D +   + C C +G+TGE C+  I+ C  NPCS ++ C  +   + C C +G +G NC    + C           +S C        C  ++NGF C C++ +  T C+
Sbjct:  104 HTCACQAGYTGADCTSELGTACATSPCRSGATCVSSNSSATTEYSCICTDQQFGTHCE-YDNLCAS-NPCQNSGNCTMVLE-NSNYLCTCSPDWQGRRCEVADAVSTPPVQDGCYLYDTGSIGACTTKFTENS--LTSSKCNNYALEQSTDTVTM--NYLTLCGAWCMVSEAPLCNTSWYMDGDCKKSCGGDSAEYCGRLNSRCIVYEAGTSETDANACTDNSTLCNANLGQGICINLSSDVTNGYQCICGPLWTDTDCETPVASACTPSPCWN-GICVLNEQYNTYTCACDDG---YFGDLCQYP-DVCT---SSTCLYG-----------GTCTE-----TSSGGYTCSCLSQYFGTNCEEINRCNYADPCVNGDCQTTVDGITTNYTCTCDSGWTGENCDTMIDYCIPNPCSYNSTCSPYFKGFNCTCITGLTGANCSTIIDLCVPYKDSTGKWIKSPCNSKDDLANCTIEINGFNCSCSDKWTDTLCD 564          

HSP 7 Score: 75.8702 bits (185), Expect = 3.808e-13
Identity = 62/204 (30.39%), Postives = 89/204 (43.63%), Query Frame = 3
Query: 3120 HGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGD-GTGMYFCKCQPGFQGVNCQVNTNEC-YSNSCNTGKC---IDQIN-NFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLE-CLDRPGTFHCSCKKYFTGKYCETRI 3710
            +G C  + +   + C+C  GY G  C+   D C S  C+ GG C +  +G Y C C   + G NC+   N C Y++ C  G C   +D I  N++C C  G +G  C+T++DYC    C     C      F C C  G  G  C T I+ C          + S    PC+    L  C      F+CSC   +T   C+  +
Sbjct:  370 NGICVLNEQYNTYTCACDDGYFGDLCQYP-DVCTSSTCLYGGTCTETSSGGYTCSCLSQYFGTNCE-EINRCNYADPCVNGDCQTTVDGITTNYTCTCDSGWTGENCDTMIDYCIPNPCSYNSTCSPYFKGFNCTCITGLTGANCSTIIDLCVPYKDSTGKWIKS----PCNSKDDLANCTIEINGFNCSCSDKWTDTLCDLNV 567          

HSP 8 Score: 75.485 bits (184), Expect = 4.910e-13
Identity = 116/457 (25.38%), Postives = 173/457 (37.86%), Query Frame = 3
Query: 2730 CVDKVNGFECKCNENYIGTNC-EHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDS--FKCKCNSEYIGERCEIKKTET-------CKSYAV-------EKFKNESLINKICKHHG-NCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGEC-----GDGT---GMYFCKCQPGFQGVNCQVNTNECYSNS--CNT----GKCI----DQINNFSCVCPRGVSGRFCET-IVDYCKKMECQNGG-ICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCE--TRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCE 3980
            C  K+    C C   Y G +C   L   C ++PC +  +C++   +  T  Y C C     G  CE   + C  NPC + G C   L++  + C C+ ++ G RCE+    +       C  Y          KF   SL +  C ++      D  T  +   C     G++C V+     +      G+C     GD     G    +C   ++    + + N C  NS  CN     G CI    D  N + C+C    +   CET +   C    C NG  +       + C C  G+ G LC+        ++  ++T L     G C+ T +       G + CSC   + G  CE   R +Y +        PC N G C        G   N++C C +G+ GE C      C  N C  N  C P+       F C C  G+ G  C 
Sbjct:   97 CTSKIESHTCACQAGYTGADCTSELGTACATSPCRSGATCVSSNSSATTE-YSCICTDQQFGTHCEYD-NLCASNPCQNSGNCTMVLENSNYLCTCSPDWQGRRCEVADAVSTPPVQDGCYLYDTGSIGACTTKFTENSLTSSKCNNYALEQSTDTVTMNYLTLC-----GAWCMVSEAPLCNTSWYMDGDCKKSCGGDSAEYCGRLNSRCIV-YEAGTSETDANACTDNSTLCNANLGQGICINLSSDVTNGYQCICGPLWTDTDCETPVASACTPSPCWNGICVLNEQYNTYTCACDDGYFGDLCQYP------DVCTSSTCLYG---GTCTETSS-------GGYTCSCLSQYFGTNCEEINRCNYAD--------PCVN-GDCQTTVD---GITTNYTCTCDSGWTGENCDTMIDYCIPNPCSYNSTCSPY----FKGFNCTCITGLTGANCS 513          

HSP 9 Score: 70.8626 bits (172), Expect = 1.107e-11
Identity = 80/293 (27.30%), Postives = 118/293 (40.27%), Query Frame = 3
Query: 1518 DLNNDYTCDCPEGLTGKNCEINI-DECTPNPCLNGA-RCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNE-EKCICIPGFEGRTCEIEINEC-FNNPCQHG---SQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDA----ICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDE-CNLD----RTQLALYGLAVLSM 2348
            D+ N Y C C    T  +CE  +   CTP+PC NG     ++   +TC C  G+ G  C+   D+C       T   CL                                  G C + ++    C C+  + G  CE EIN C + +PC +G   +    +  +Y C C  G+ G+ C+  I+ C  NPC  N  C     GF C C+   +G  C+  +D C P   Y D+    I  P N  D    NC+  +  +  S  +K  D  C+L+       L +YG   L+M
Sbjct:  337 DVTNGYQCICGPLWTDTDCETPVASACTPSPCWNGICVLNEQYNTYTCACDDGYFGDLCQ-YPDVC-------TSSTCL--------------------------------YGGTCTETSSGGYTCSCLSQYFGTNCE-EINRCNYADPCVNGDCQTTVDGITTNYTCTCDSGWTGENCDTMIDYCIPNPCSYNSTCSPYFKGFNCTCITGLTGANCSTIIDLCVP---YKDSTGKWIKSPCNSKDDLA-NCTIEINGFNCSCSDKWTDTLCDLNVLIKDVLLTIYGHVDLTM 584          

HSP 10 Score: 63.929 bits (154), Expect = 1.551e-9
Identity = 54/170 (31.76%), Postives = 73/170 (42.94%), Query Frame = 3
Query:  414 PIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTC-KLIAGNNVCQCLNEWVGEFCEFSSNC-ASSPCRNGGICKSLE--IHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYE 911
            P+A +   C    C NG    ++    Y C C  GY G  C+    C  + C  GGTC +  +G   C CL+++ G  CE  + C  + PC NG    +++     Y C C   + G NC+        NPC  N  C     G   C C  G TG  CS  ID C  Y+
Sbjct:  358 PVASA---CTPSPCWNGICVLNEQYNTYTCACDDGYFGDLCQYPDVCTSSTCLYGGTCTETSSGGYTCSCLSQYFGTNCEEINRCNYADPCVNGDCQTTVDGITTNYTCTCDSGWTGENCDTMIDYCIPNPCSYNSTCSPYFKG-FNCTCITGLTGANCSTIIDLCVPYK 523          
BLAST of Neurogenic locus notch protein vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0304659)

HSP 1 Score: 1003.82 bits (2594), Expect = 0.000e+0
Identity = 688/1991 (34.56%), Postives = 1007/1991 (50.58%), Query Frame = 3
Query:  438 CENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQ------KSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILAN-DGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLI--NKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISD-------CELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCP--LQSFCDKHYADGQCQLECNTMECSFDGGDCI-ESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKK-PEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNF-PPEKRL--KLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSR-------VPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYV 6305
            C  H C+NG TC   I+  Y C C   + G +C+       + + P+  CQNG TC    G+  C C+N W G  C  +++ C  + C  G  C    +  + CQC K   G+ C L ++C S NPC  +  C  +  +G   C C  GY G  CS DIDEC   +   CE+ G C+NT GSY+C C  GF G RCE +I +C +  C+N G+CLD  G++RCVC   + GT CE     C+  PC N G C D    ++C C   +TG  C    + C+  PC+N G C   +   Y C C  G+ G  CE +I++C    C  G  CI+ +   KC C PG+ G  C+  +NECE+ PCQ +  C D    Y C C  G +GKNCE+N++EC  NPC NGA C D +  + CQC+ GF G  CE   D C   +PC    +C++  N   GYKC CP G    +C  ++ +C +  C+N G+C D  NE  C C PG+ G+ CE++I+EC +NPCQHG  C D  N + C C+PG+ G+KCE NI++C  NPCG  G CID+V G++C C +P++G  C +K+DPC  N C N+A C P + +  + C C      Y G  C++D+DEC+L                     PC N   C+N  GS+ C C+  YEGR C    ++C + PC+NG TC +    + C CV GF G+ CE +INEC   PC N A C  ++N Y C C  GFSG NC+ ND DCTESSCL  G C+D +NG+ C C   Y G NC++    CDSNPCLN  +C     ++    Y C+C  GFTG +C   +DWC  +PC +   C      F CKC++ + G+ C++ +T +C+  A  K  +   +  N  CK +GN           C C  GY GS+C+  ID+C SQPC NGG C D  G Y C+C+ GFQG NC++N ++C  N C N G C D++ NFSC CP G  G  CE   D CK   C N G C + +G FEC C  GF G  CE DINEC  N              PCS  GTL+C+     +HC+C+    G++CE ++D+C +       PC N G C         R     CIC NG+ G+ C+++ + C  N C+   +      D+   ++CECP G  G  CEID ++EC    C    +C +  G   C C     G++C+I  +     +  +        +D       C+   C  K  N ICD +CN YAC FDG +C   +            +PW+NC   +     C N F N +C+ +CN  AC +DG DC   +  C     ++C KHY DG C   CN  ECS+DG DC  ++++  +  G + ++ +   E     + + L++++H+L + VR+ +++ G  +I + +        + +   +K  +  + Q  + G ++YLE+DN  C      CF ++  AAEF+ A       R    I SV+   +PG +   EPP         +  ++   +LV +   F      T  K+      W+PEG          F     V S R+R+ +         E+ N+ +    +   +  V   G++                +    V +  N    S+  M   +   ++R+  + H+D+++ R I          +    +  G     ++R    +    L IA       +   D+ N NE S   +I+ L ++       +  +GET LHLAA++ R +AA+ LL+AG+D N  +  GR+ L  A+ A A+ V    L  +    +L+ +  +G+T LI A + A   +++ L+        D+N  D  G+TALHWAA       V++LL +  NRDAQD+++ TPL+LA +EG  E CK L+ N AN +++DH+DRLPRDVA       IV LL+++V
Sbjct:  297 CLGHLCQNGGTCIDGIS-DYTCRCPPNFTGRFCQDDVDECAQRDHPV--CQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCID-GVGSFYCQCTKGKTGLLCHLDDACTS-NPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECD--QGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHD-SIAGYSCECPPGYTGTSCEININDCDSNPCHRG-KCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECIS-SPCANNGVCIDQVN---GYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLG---YTGRYCDEDIDECSLSS-------------------PCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATC-----HEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDV-QTISCQDAADRKGLSLRQLCNNGTCKDYGN--------SHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSN--------------PCSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDFCAQS------PCQNGGNCNI-------RQSGHHCICNNGFYGKNCELSGQDCDSNPCR---VGNCVVADEGFGYRCECPRGTLGEHCEIDTLDECSPNPCAQGAACEDLLGDYECLCPSKWKGKRCDIYDANYPGWNGGSGSGNDRYAADLEQQRAMCDKRGCTEKQGNGICDSDCNTYACNFDGNDCSLGI------------NPWANCTANE-----CWNKFKNGKCNEECNNAACHYDGHDCERKLKSCDSLFDAYCQKHYGDGFCDYGCNNAECSWDGLDCENKTQSPVLAEGAMSVVMLMNVEAFREIQAQFLRNMSHMLRTTVRLKKDALGHDIIINWKDNVRVPEIEDTDFARKNKILYTQQVHQTGIQIYLEIDNRKCTE----CFTHAVEAAEFLAATAAKHQLRNDFQIHSVRGIKNPGDEDNGEPP-------ANVKYVITGIILVIIALAFFGMVLSTQRKRAHGV-TWFPEG----------FRAPAAVMSRRRRDPH-------GQEMRNLNKQVAMQ---SQGVGQPGAHWSDDESDMPLPKRQRSDPVSGVGLGNNGGYASDHTMVSEYEEADQRVWSQAHLDVVDVRAI----------MTPPAHQDGGKHDVDARGPCGLTP--LMIAAVRGGGLDTGEDIEN-NEDSTAQVISDLLAQGAELNATMDKTGETSLHLAARFARADAAKRLLDAGADANCQDNTGRTPLHAAVAADAMGVFQILLRNR--ATNLNARMHDGTTPLILAARLAIEGMVEDLITADA----DINAADNSGKTALHWAAAVNNTEAVNILLMHHANRDAQDDKDETPLFLAAREGSYEACKALLDNFANREITDHMDRLPRDVASERLHHDIVRLLDEHV 2140          

HSP 2 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 470/1351 (34.79%), Postives = 666/1351 (49.30%), Query Frame = 3
Query:  408 FCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNN--VCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCT---NDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQ-DYKCICQRGFEGKMCETSIDNCQKIS-CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVN--GFECKCNENYIGTNCEHLKRPCD-SNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECK--YNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYAC----GFDGGECLHRVPKRIDGNDISIASP---WSNCEIIKS-ENIPCHNWFNNKRCD 4385
             C IA+  N C++  C NG TCQ     +Y C CA GY G  CE K+ C  +PC+NG TC  +AG++   C C   + G+ C +    C S+PC+ GG C +     Y+C CP  Y G +C+      S +PC   G C  +N    +C C KG+ G  C  + D+C  +   LC+NGGTCI+ +  Y C+C   F G  C++D+ +C    +  C+NG TC +  GSY C+C N + G +C N    C+   C  G  C D    + C C    TG  C  + + C  NPC  +  C++      Y C C  G++G  C   ID C + S C + G C+N     +CNC  GF G  CE N+NECE+ PCQN   C+D    + C C  G TG  CEI+IDEC  NPCLN   C D++ GF C C  GF G RC+   D C Q  PC+   IC   +++ +GY C CP G    +C+  ++ C +  C  G+C+D  N  KC+C PG+ G  C+ +INEC +NPCQ    CQD    Y C C  G  GK CE+N+NEC  NPC     CID +  ++CQC+  ++G  C   +D C  + C N+ +CI  ++ + Y C C    G Y+ + C  DVDEC  +                    PC+N+ +C +    FIC C   Y G++CE  ++ C +NPC++G TC +  + F C+C+ G+TG++CE  I++C  NPC N   CID +N Y+C+C+  F+G++CE   + C  + C    +C    N   F C C   Y G  C+     C  S+PC N  SC+      N PG Y C C +G+ G  C I  D C   PC + G C   +  + C C   + G+ CE    E               +++ C++   C        + C+C  G+ G  C+ N +DC    C+NGG C DG   Y C C  G+ G NCQ   N+C SN C N   C +Q N ++C CP G +G+ C   VD+C +  C+NG  C  +   F C C  G+ GKLC+     C+   +  G +   + N        GT  C D   +  C C + + G YC+  ID C+      + PC N G C    ++ +G    + C C  G+ G+ C++N   C  N C+N G C     D  M+F C CPPG  G+ CEI+  ++C    C+NNGSC++  G   C C  G  G +CE                   +I++C  N C S A    C    N Y C    G  G  C H+V       D    SP     NC I +S  +  C+N F  K C+
Sbjct:  134 LCEIAVP-NACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTH-GSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGIC-RSNGLSYECKCPKGFEGKNCEQNYDDCLGH---LCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLC-HLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDC-QSQPCRNRGIC---HDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCI--DQVNGYKCECPR--GFYD-AHCLSDVDECASN--------------------PCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCL------NVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINE--------------CLSQPCQNGATCSQ--YVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCN-------NGT--CKDYGNSHVCYCSQGYAGSYCQKEIDECQ------SQPCQNGGTC----RDLIGA---YECQCRQGFQGQNCELNIDDCAPNPCQNGGTCH----DRVMNFSCSCPPGTMGIICEINK-DDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCE------------------GDINECLSNPC-SNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKV-------DFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCE 1373          

HSP 3 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 453/1315 (34.45%), Postives = 638/1315 (48.52%), Query Frame = 3
Query:  417 IAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNN----VCQCLNEWVGEFCEFS--SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCI-LANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVN-YQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKC--IDLNNDYTCDCPEGLTGKNCEINIDECTP-NPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVC--ETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQ---------LNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDL---ECNKYACGFDGGECLHRV 4271
             A+    C +  C+NG TC + +NGK  C C   Y G YCE ++ C    CQNGGTC++   N      C+C   +    CE +  + C    C NGG C+   + +Y C C   Y G  CE  N C S +PC     C  LA      C C  G+TG+TCS DI+EC S     C+ GGTC+NT GSYQC C  G+ G+ C+     C+   C+NGG C     SY C CP  + G NCE     C    C+NGG C D   DY C C   +TG+ C DDV    + +           N +  Y CIC  G+ G  C  + D+C++ +CF G +CI+ +    C C  G +        + C + PC  +A C    +N  Y C C  G  G +C  +IDEC   +PC +   C +  G + C C QGF G RCET  + C+   PC+ E  CL+   T   ++C+C  G     C+ ++ +C++  C+N G C D  N  KC C  GF G  C+I I++C + PC++   C D    Y C C PG+ G  CEININ+C  NPC   G+CID+V  F+C C   Y+G  C  +++ C  N C  D  C   ++  SY+C C        G  CE +V+EC+ +                    PC N   CI+   S+ C+C   + G+ CEK ++ C ++PC N   C +  +G++C C  GF    C  +++EC  NPC N+ +C D IN++ C C  G++GK CE++ ++C+ + C   G C DK+N F C+C   Y G  CE     C +NPC N G+CI+ KVN    GY C C+  FTG  CE KMD C  N C +   C   ++   F C C   Y G  C             ++  +E  ++  C++  +C N P  G ++C C  GY G  C +N DDCAS PC NGG C DG G Y C C  GF G +C+ + NEC S  C  G  C   +N+++C CP G SG  C+T  + C +  C NGG C + I  + C+C  G++G  C+  +N+C  N              PC    T  C ++   + C C   FTGK C   +D+C      G  PC N   C           + FSC C  G+ G+ C + +  CQ         L    NNG C+    D   S  C C  G  G +C+ + ++EC S  C N G+C +  G   C C +G  G+ CE+    C      N  T  D + +   + C       IC++   +C   AC  + G C+ RV
Sbjct:   55 TALVAASCTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNLCAS-SPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNP---CKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKG-KTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECES-HPCQNEGSCLDDPGT---FRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPC-HRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQ--DRVGSYYCQCQAGT---SGKNCEVNVNECHSN--------------------PCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCID-KVN----GYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYC-------------DEDIDECSLSSPCRNGASCLNVP--GSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSN--------------PCLNGAT--CHEQNNEYTCHCPSGFTGKQCSEYVDWC------GQSPCENGATCSQ-------MKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTCK----DYGNSHVCYCSQGYAGSYCQKE-IDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFSCS-CPPGTMGIICEINKDDCKPGAC-HNNGSCIDRV 1278          

HSP 4 Score: 526.168 bits (1354), Expect = 1.250e-150
Identity = 382/1194 (31.99%), Postives = 549/1194 (45.98%), Query Frame = 3
Query:  411 CPIAISLNFCENHK----------CKNGATCQSDINGKYVCECAYGYKGTYCEQKS-NCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIH-KYECQCPKNYLGMNC-ELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC------------------DDVXXXXXXXXXXXXGF--------CESVNYQ----------DYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGL--------------------------------------TGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCIC--PDGVQNCKKELSKCKNIVCIN------------------------------------------GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQH---------NPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCI--DQINNFSCVCPRGVSGRFCET-IVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKY 3563
            CP   +  FC++            C+NGATC ++ +G Y C C  G+ G  C   + +C    C  G TC    G+  CQC     G  C     C S+PC    IC +  I+  Y C C   Y G++C E  + C   +PC  NG C+    G  +C+C++G+TG  C  +I+EC S+    C+N G+C++  G+++C C  GF G +CE DI +C ++ C N GTC DKI  ++C C   + G  C+     C+ +PC+N GIC D    Y C C   +TG +C                  DDV +   +      G+        CES   Q           Y C CQ G  GK CE +++ C    C NG +CI+ I   KC C+PGF G +CE NV+EC + PC NN  CID  N Y C+CP G                                       TGK CE++IDEC+ NPC +G  C D++  F+CQC+ G+ G +CET  D C    PC     C++  N   GYKC+C  P   ++C+ ++  C +  C N                                            C++V    +C+C  G+EGR C I  ++C + PCQ+G  C D   DY C+C+ GF GK CE +INEC   PC     C   V  + C C L +SG  C    + C  ++C N   CI G   + Y+C+C   L  Y G+ C+  +++C+ +                    PCLN   C   N  + C C S + G+QC + ++ C  +PC NGATC  +   F C+C AG+TG+ C+++   CQ              N+  C D+ N + C C  G++G  C+   ++C    C   G C D +  +EC+C + + G NCE     C  NPC N G+C +R +N     + C+C  G  G  CEI  D C+   C + G C   +  F+C C   ++G RCE    E C S           +  +  +H             C+C+ G+ G  CE  +D CA  PC NGG C      + C C  GF G NC+++  +C SN C  G C+  D+   + C CPRG  G  CE   +D C    C  G  C++++GD+EC CP  + GK C  DI +  Y
Sbjct:  319 CPPNFTGRFCQDDVDECAQRDHPVCQNGATC-TNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICV-NTPGSYRCNCSQGFTGPRCETNINECESHP---CQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCV-TNPCGNGGTCIDKVN---GYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDG--INGYNCSC---LAGYSGANCQYKLNKCDSN--------------------PCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTCKDYGNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMN-----FSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINE-CLSNPCSNAGTLDCVQLVNNYH-------------CNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQDCDSNPCRVGNCVVADEGFGYRCECPRGTLGEHCEIDTLDECSPNPCAQGAACEDLLGDYECLCPSKWKGKRC--DIYDANY 1457          

HSP 5 Score: 451.055 bits (1159), Expect = 3.197e-127
Identity = 339/1007 (33.66%), Postives = 478/1007 (47.47%), Query Frame = 3
Query: 1323 RGFEGKMCETSIDNCQKISCFNGGSCINMIEGGK-CNCLPGFXXXXXXXXXXXXXXKPCQNNAKC-IDLNN---DYTCDCPEGLTGKNCEINI-DECTPNPCLNGARCEDR-VGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVC-INGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPC---NPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNS--------------------QIGPCLNDNQCINT--NGSFICKCSSQYEGRQC-EKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNEC-LSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNK 4229
            RG +  +   S   C  + C NGG+C+  + G   C C   + G+ CE        + CQN   C +   N     +C CP G     CEI + + C    CLNG  C+ + +  +TC C  G+ G RCETK ++C   +PC+    C  +  + S + C CP G     C  ++ +C++  C   G CV+ +   +C+C  G+ G+ C+ +   C  +PCQ+G  C+     Y C C  GF+GK CE N ++C  + C   G CID +  + C+C   ++G  C + +D C   +   C N A C   N + SY C C   +  + G  C  + D+C   +     YG   +    S                       PC  D  C  +  NGS+ C C++ Y+G  C E      + +PC +   C N    +RC C  GFTG RCE  INEC+ +PC N+  C+D    ++C+C  GF+G  CEI+ ++C  + CL  G C DK+NGF+C C   + G  C+     C S PC N+G C     + +  GY C C  G+TG  CEI ++ C  NPC   G C  D++SFKC C+  Y G  C+ K+   C+S               C+  G+C +    G + C CQ+G  G  CEVN+++C S PC NG  C DG   Y C+C PGF G +C+ N +EC S+ C N G CIDQ+N + C CPRG     C + VD C    C N G C++ I +F C+CP G+ GK CE DI+EC  N              PC   GT  C D+   F C C   +TG+ CET ID C         PC N G C++K          + C+C   + G  C+     C  N CKN   C P    + + F C C  G  G +C+ D ++EC LS+ C N  SC+N  G   C C KG  G  C I    C      N  T  D I D     C    D K C+ + N+
Sbjct:   51 RGTDTALVAAS---CTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNPCNSMR-CQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETK-NLCAS-SPCRNGATCTALAGSSS-FTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCT--NTHGSYSCIC---VNGWAGLDCSNNTDDC---KQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGIC-----HDSIAGYSCECPPGYTGTSCEININDCDSNPC-HRGKCIDDVNSFKCLCDPGYTGYICQ-KQINECES-------------NPCQFDGHCQD--RVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSN--------------PCQHGGT--CYDKLNAFSCQCMPGYTGQKCETNIDDCVTN------PCGNGGTCIDKVN-------GYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSS--NFLDFSCTCKLGYTGRYCDED-IDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSC-LCVDGFDGKHCETDINE 987          

HSP 6 Score: 378.637 bits (971), Expect = 6.083e-105
Identity = 289/917 (31.52%), Postives = 411/917 (44.82%), Query Frame = 3
Query: 1548 PEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFT-CQCLQGFVGLRCETKSDICKQLTPCKTEEIC-LNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEI-NECFNNPCQHGSQCQ-DLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYG---FRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINEC---QHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQ-----------------------------------NTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEI 4160
            P  + G +  +    CT   C NG  C  ++ G T C C   +VG  CE + + C  +  C+    C +   N R G  C CP                                    GF+   CEI + N C +  C +G  CQ     +Y C C  G+ G++CE   N CA +PC  NG     + G   F C C   ++G TC+  ++ C  N C     C+  N + SY C C T    Y G  C+     C+                      PC N   C +   S+ CKC   +EG+ CE+  ++C  + C+NG TC +    + CRC   FTG  C+ +++EC    H  C N A C +    Y CIC +G++G +C  N +DC +++C     C+D V  F C+C +   G  C HL   C SNPC     C    +N                                    NTPG Y CNC +GFTGPRCE  ++ C  +PC + G C  D  +F+C C   + G +CEI   E C+S               C + G C +  +  GFKCSC  G+ G+ C++NIDDC SQPC N G C D    Y C+C PG+ G +C++N N+C SN C+ GKCID +N+F C+C  G +G  C+  ++ C+   CQ  G C++ +G + C C  G +GK CE ++NEC  N              PC+   T  C+D   ++ C C   FTG++CE  +D C       + PC NNG+C+++          + C CP G+    C  +  +C  N C N G C     D    F C CPPG  G  CE+D ++EC S  C + G+C +      C C  G  G+KCE     C      N  T  D++
Sbjct:   47 PNTVRGTDTALVAASCTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHR-NPCNSMR-CQNGGTCQVTFRNGRPGISCKCP-----------------------------------LGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETK-NLCASSPC-RNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCV--NTHGSYQCMCPTG---YTGKDCDTKYKPCSPS--------------------PCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLC-HLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDE-CQS-------------NPCLNDGTCHD--KINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSN--------------PCNNGAT--CIDGINSYKCQCVPGFTGQHCEKNVDECI------SSPCANNGVCIDQVN-------GYKCECPRGFYDAHCLSDVDECASNPCVNEGRCE----DGINEFICHCPPGYTGKRCELD-IDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKV 848          
BLAST of Neurogenic locus notch protein vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0070507)

HSP 1 Score: 1003.82 bits (2594), Expect = 0.000e+0
Identity = 688/1991 (34.56%), Postives = 1007/1991 (50.58%), Query Frame = 3
Query:  438 CENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQ------KSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILAN-DGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLI--NKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISD-------CELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCP--LQSFCDKHYADGQCQLECNTMECSFDGGDCI-ESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKK-PEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNF-PPEKRL--KLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSR-------VPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYV 6305
            C  H C+NG TC   I+  Y C C   + G +C+       + + P+  CQNG TC    G+  C C+N W G  C  +++ C  + C  G  C    +  + CQC K   G+ C L ++C S NPC  +  C  +  +G   C C  GY G  CS DIDEC   +   CE+ G C+NT GSY+C C  GF G RCE +I +C +  C+N G+CLD  G++RCVC   + GT CE     C+  PC N G C D    ++C C   +TG  C    + C+  PC+N G C   +   Y C C  G+ G  CE +I++C    C  G  CI+ +   KC C PG+ G  C+  +NECE+ PCQ +  C D    Y C C  G +GKNCE+N++EC  NPC NGA C D +  + CQC+ GF G  CE   D C   +PC    +C++  N   GYKC CP G    +C  ++ +C +  C+N G+C D  NE  C C PG+ G+ CE++I+EC +NPCQHG  C D  N + C C+PG+ G+KCE NI++C  NPCG  G CID+V G++C C +P++G  C +K+DPC  N C N+A C P + +  + C C      Y G  C++D+DEC+L                     PC N   C+N  GS+ C C+  YEGR C    ++C + PC+NG TC +    + C CV GF G+ CE +INEC   PC N A C  ++N Y C C  GFSG NC+ ND DCTESSCL  G C+D +NG+ C C   Y G NC++    CDSNPCLN  +C     ++    Y C+C  GFTG +C   +DWC  +PC +   C      F CKC++ + G+ C++ +T +C+  A  K  +   +  N  CK +GN           C C  GY GS+C+  ID+C SQPC NGG C D  G Y C+C+ GFQG NC++N ++C  N C N G C D++ NFSC CP G  G  CE   D CK   C N G C + +G FEC C  GF G  CE DINEC  N              PCS  GTL+C+     +HC+C+    G++CE ++D+C +       PC N G C         R     CIC NG+ G+ C+++ + C  N C+   +      D+   ++CECP G  G  CEID ++EC    C    +C +  G   C C     G++C+I  +     +  +        +D       C+   C  K  N ICD +CN YAC FDG +C   +            +PW+NC   +     C N F N +C+ +CN  AC +DG DC   +  C     ++C KHY DG C   CN  ECS+DG DC  ++++  +  G + ++ +   E     + + L++++H+L + VR+ +++ G  +I + +        + +   +K  +  + Q  + G ++YLE+DN  C      CF ++  AAEF+ A       R    I SV+   +PG +   EPP         +  ++   +LV +   F      T  K+      W+PEG          F     V S R+R+ +         E+ N+ +    +   +  V   G++                +    V +  N    S+  M   +   ++R+  + H+D+++ R I          +    +  G     ++R    +    L IA       +   D+ N NE S   +I+ L ++       +  +GET LHLAA++ R +AA+ LL+AG+D N  +  GR+ L  A+ A A+ V    L  +    +L+ +  +G+T LI A + A   +++ L+        D+N  D  G+TALHWAA       V++LL +  NRDAQD+++ TPL+LA +EG  E CK L+ N AN +++DH+DRLPRDVA       IV LL+++V
Sbjct:  297 CLGHLCQNGGTCIDGIS-DYTCRCPPNFTGRFCQDDVDECAQRDHPV--CQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCID-GVGSFYCQCTKGKTGLLCHLDDACTS-NPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECD--QGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHD-SIAGYSCECPPGYTGTSCEININDCDSNPCHRG-KCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECIS-SPCANNGVCIDQVN---GYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLG---YTGRYCDEDIDECSLSS-------------------PCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATC-----HEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDV-QTISCQDAADRKGLSLRQLCNNGTCKDYGN--------SHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSN--------------PCSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDFCAQS------PCQNGGNCNI-------RQSGHHCICNNGFYGKNCELSGQDCDSNPCR---VGNCVVADEGFGYRCECPRGTLGEHCEIDTLDECSPNPCAQGAACEDLLGDYECLCPSKWKGKRCDIYDANYPGWNGGSGSGNDRYAADLEQQRAMCDKRGCTEKQGNGICDSDCNTYACNFDGNDCSLGI------------NPWANCTANE-----CWNKFKNGKCNEECNNAACHYDGHDCERKLKSCDSLFDAYCQKHYGDGFCDYGCNNAECSWDGLDCENKTQSPVLAEGAMSVVMLMNVEAFREIQAQFLRNMSHMLRTTVRLKKDALGHDIIINWKDNVRVPEIEDTDFARKNKILYTQQVHQTGIQIYLEIDNRKCTE----CFTHAVEAAEFLAATAAKHQLRNDFQIHSVRGIKNPGDEDNGEPP-------ANVKYVITGIILVIIALAFFGMVLSTQRKRAHGV-TWFPEG----------FRAPAAVMSRRRRDPH-------GQEMRNLNKQVAMQ---SQGVGQPGAHWSDDESDMPLPKRQRSDPVSGVGLGNNGGYASDHTMVSEYEEADQRVWSQAHLDVVDVRAI----------MTPPAHQDGGKHDVDARGPCGLTP--LMIAAVRGGGLDTGEDIEN-NEDSTAQVISDLLAQGAELNATMDKTGETSLHLAARFARADAAKRLLDAGADANCQDNTGRTPLHAAVAADAMGVFQILLRNR--ATNLNARMHDGTTPLILAARLAIEGMVEDLITADA----DINAADNSGKTALHWAAAVNNTEAVNILLMHHANRDAQDDKDETPLFLAAREGSYEACKALLDNFANREITDHMDRLPRDVASERLHHDIVRLLDEHV 2140          

HSP 2 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 470/1351 (34.79%), Postives = 666/1351 (49.30%), Query Frame = 3
Query:  408 FCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNN--VCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCT---NDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQ-DYKCICQRGFEGKMCETSIDNCQKIS-CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVN--GFECKCNENYIGTNCEHLKRPCD-SNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECK--YNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYAC----GFDGGECLHRVPKRIDGNDISIASP---WSNCEIIKS-ENIPCHNWFNNKRCD 4385
             C IA+  N C++  C NG TCQ     +Y C CA GY G  CE K+ C  +PC+NG TC  +AG++   C C   + G+ C +    C S+PC+ GG C +     Y+C CP  Y G +C+      S +PC   G C  +N    +C C KG+ G  C  + D+C  +   LC+NGGTCI+ +  Y C+C   F G  C++D+ +C    +  C+NG TC +  GSY C+C N + G +C N    C+   C  G  C D    + C C    TG  C  + + C  NPC  +  C++      Y C C  G++G  C   ID C + S C + G C+N     +CNC  GF G  CE N+NECE+ PCQN   C+D    + C C  G TG  CEI+IDEC  NPCLN   C D++ GF C C  GF G RC+   D C Q  PC+   IC   +++ +GY C CP G    +C+  ++ C +  C  G+C+D  N  KC+C PG+ G  C+ +INEC +NPCQ    CQD    Y C C  G  GK CE+N+NEC  NPC     CID +  ++CQC+  ++G  C   +D C  + C N+ +CI  ++ + Y C C    G Y+ + C  DVDEC  +                    PC+N+ +C +    FIC C   Y G++CE  ++ C +NPC++G TC +  + F C+C+ G+TG++CE  I++C  NPC N   CID +N Y+C+C+  F+G++CE   + C  + C    +C    N   F C C   Y G  C+     C  S+PC N  SC+      N PG Y C C +G+ G  C I  D C   PC + G C   +  + C C   + G+ CE    E               +++ C++   C        + C+C  G+ G  C+ N +DC    C+NGG C DG   Y C C  G+ G NCQ   N+C SN C N   C +Q N ++C CP G +G+ C   VD+C +  C+NG  C  +   F C C  G+ GKLC+     C+   +  G +   + N        GT  C D   +  C C + + G YC+  ID C+      + PC N G C    ++ +G    + C C  G+ G+ C++N   C  N C+N G C     D  M+F C CPPG  G+ CEI+  ++C    C+NNGSC++  G   C C  G  G +CE                   +I++C  N C S A    C    N Y C    G  G  C H+V       D    SP     NC I +S  +  C+N F  K C+
Sbjct:  134 LCEIAVP-NACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTH-GSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGIC-RSNGLSYECKCPKGFEGKNCEQNYDDCLGH---LCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLC-HLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDC-QSQPCRNRGIC---HDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCI--DQVNGYKCECPR--GFYD-AHCLSDVDECASN--------------------PCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCL------NVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINE--------------CLSQPCQNGATCSQ--YVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCN-------NGT--CKDYGNSHVCYCSQGYAGSYCQKEIDECQ------SQPCQNGGTC----RDLIGA---YECQCRQGFQGQNCELNIDDCAPNPCQNGGTCH----DRVMNFSCSCPPGTMGIICEINK-DDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCE------------------GDINECLSNPC-SNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKV-------DFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCE 1373          

HSP 3 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 453/1315 (34.45%), Postives = 638/1315 (48.52%), Query Frame = 3
Query:  417 IAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNN----VCQCLNEWVGEFCEFS--SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCI-LANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVN-YQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKC--IDLNNDYTCDCPEGLTGKNCEINIDECTP-NPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVC--ETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQ---------LNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDL---ECNKYACGFDGGECLHRV 4271
             A+    C +  C+NG TC + +NGK  C C   Y G YCE ++ C    CQNGGTC++   N      C+C   +    CE +  + C    C NGG C+   + +Y C C   Y G  CE  N C S +PC     C  LA      C C  G+TG+TCS DI+EC S     C+ GGTC+NT GSYQC C  G+ G+ C+     C+   C+NGG C     SY C CP  + G NCE     C    C+NGG C D   DY C C   +TG+ C DDV    + +           N +  Y CIC  G+ G  C  + D+C++ +CF G +CI+ +    C C  G +        + C + PC  +A C    +N  Y C C  G  G +C  +IDEC   +PC +   C +  G + C C QGF G RCET  + C+   PC+ E  CL+   T   ++C+C  G     C+ ++ +C++  C+N G C D  N  KC C  GF G  C+I I++C + PC++   C D    Y C C PG+ G  CEININ+C  NPC   G+CID+V  F+C C   Y+G  C  +++ C  N C  D  C   ++  SY+C C        G  CE +V+EC+ +                    PC N   CI+   S+ C+C   + G+ CEK ++ C ++PC N   C +  +G++C C  GF    C  +++EC  NPC N+ +C D IN++ C C  G++GK CE++ ++C+ + C   G C DK+N F C+C   Y G  CE     C +NPC N G+CI+ KVN    GY C C+  FTG  CE KMD C  N C +   C   ++   F C C   Y G  C             ++  +E  ++  C++  +C N P  G ++C C  GY G  C +N DDCAS PC NGG C DG G Y C C  GF G +C+ + NEC S  C  G  C   +N+++C CP G SG  C+T  + C +  C NGG C + I  + C+C  G++G  C+  +N+C  N              PC    T  C ++   + C C   FTGK C   +D+C      G  PC N   C           + FSC C  G+ G+ C + +  CQ         L    NNG C+    D   S  C C  G  G +C+ + ++EC S  C N G+C +  G   C C +G  G+ CE+    C      N  T  D + +   + C       IC++   +C   AC  + G C+ RV
Sbjct:   55 TALVAASCTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNLCAS-SPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNP---CKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKG-KTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECES-HPCQNEGSCLDDPGT---FRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPC-HRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQ--DRVGSYYCQCQAGT---SGKNCEVNVNECHSN--------------------PCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCID-KVN----GYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYC-------------DEDIDECSLSSPCRNGASCLNVP--GSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSN--------------PCLNGAT--CHEQNNEYTCHCPSGFTGKQCSEYVDWC------GQSPCENGATCSQ-------MKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTCK----DYGNSHVCYCSQGYAGSYCQKE-IDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFSCS-CPPGTMGIICEINKDDCKPGAC-HNNGSCIDRV 1278          

HSP 4 Score: 526.168 bits (1354), Expect = 1.250e-150
Identity = 382/1194 (31.99%), Postives = 549/1194 (45.98%), Query Frame = 3
Query:  411 CPIAISLNFCENHK----------CKNGATCQSDINGKYVCECAYGYKGTYCEQKS-NCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIH-KYECQCPKNYLGMNC-ELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC------------------DDVXXXXXXXXXXXXGF--------CESVNYQ----------DYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGL--------------------------------------TGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCIC--PDGVQNCKKELSKCKNIVCIN------------------------------------------GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQH---------NPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCI--DQINNFSCVCPRGVSGRFCET-IVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKY 3563
            CP   +  FC++            C+NGATC ++ +G Y C C  G+ G  C   + +C    C  G TC    G+  CQC     G  C     C S+PC    IC +  I+  Y C C   Y G++C E  + C   +PC  NG C+    G  +C+C++G+TG  C  +I+EC S+    C+N G+C++  G+++C C  GF G +CE DI +C ++ C N GTC DKI  ++C C   + G  C+     C+ +PC+N GIC D    Y C C   +TG +C                  DDV +   +      G+        CES   Q           Y C CQ G  GK CE +++ C    C NG +CI+ I   KC C+PGF G +CE NV+EC + PC NN  CID  N Y C+CP G                                       TGK CE++IDEC+ NPC +G  C D++  F+CQC+ G+ G +CET  D C    PC     C++  N   GYKC+C  P   ++C+ ++  C +  C N                                            C++V    +C+C  G+EGR C I  ++C + PCQ+G  C D   DY C+C+ GF GK CE +INEC   PC     C   V  + C C L +SG  C    + C  ++C N   CI G   + Y+C+C   L  Y G+ C+  +++C+ +                    PCLN   C   N  + C C S + G+QC + ++ C  +PC NGATC  +   F C+C AG+TG+ C+++   CQ              N+  C D+ N + C C  G++G  C+   ++C    C   G C D +  +EC+C + + G NCE     C  NPC N G+C +R +N     + C+C  G  G  CEI  D C+   C + G C   +  F+C C   ++G RCE    E C S           +  +  +H             C+C+ G+ G  CE  +D CA  PC NGG C      + C C  GF G NC+++  +C SN C  G C+  D+   + C CPRG  G  CE   +D C    C  G  C++++GD+EC CP  + GK C  DI +  Y
Sbjct:  319 CPPNFTGRFCQDDVDECAQRDHPVCQNGATC-TNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICV-NTPGSYRCNCSQGFTGPRCETNINECESHP---CQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCV-TNPCGNGGTCIDKVN---GYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDG--INGYNCSC---LAGYSGANCQYKLNKCDSN--------------------PCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTCKDYGNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMN-----FSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINE-CLSNPCSNAGTLDCVQLVNNYH-------------CNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQDCDSNPCRVGNCVVADEGFGYRCECPRGTLGEHCEIDTLDECSPNPCAQGAACEDLLGDYECLCPSKWKGKRC--DIYDANY 1457          

HSP 5 Score: 451.055 bits (1159), Expect = 3.197e-127
Identity = 339/1007 (33.66%), Postives = 478/1007 (47.47%), Query Frame = 3
Query: 1323 RGFEGKMCETSIDNCQKISCFNGGSCINMIEGGK-CNCLPGFXXXXXXXXXXXXXXKPCQNNAKC-IDLNN---DYTCDCPEGLTGKNCEINI-DECTPNPCLNGARCEDR-VGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVC-INGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPC---NPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNS--------------------QIGPCLNDNQCINT--NGSFICKCSSQYEGRQC-EKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNEC-LSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNK 4229
            RG +  +   S   C  + C NGG+C+  + G   C C   + G+ CE        + CQN   C +   N     +C CP G     CEI + + C    CLNG  C+ + +  +TC C  G+ G RCETK ++C   +PC+    C  +  + S + C CP G     C  ++ +C++  C   G CV+ +   +C+C  G+ G+ C+ +   C  +PCQ+G  C+     Y C C  GF+GK CE N ++C  + C   G CID +  + C+C   ++G  C + +D C   +   C N A C   N + SY C C   +  + G  C  + D+C   +     YG   +    S                       PC  D  C  +  NGS+ C C++ Y+G  C E      + +PC +   C N    +RC C  GFTG RCE  INEC+ +PC N+  C+D    ++C+C  GF+G  CEI+ ++C  + CL  G C DK+NGF+C C   + G  C+     C S PC N+G C     + +  GY C C  G+TG  CEI ++ C  NPC   G C  D++SFKC C+  Y G  C+ K+   C+S               C+  G+C +    G + C CQ+G  G  CEVN+++C S PC NG  C DG   Y C+C PGF G +C+ N +EC S+ C N G CIDQ+N + C CPRG     C + VD C    C N G C++ I +F C+CP G+ GK CE DI+EC  N              PC   GT  C D+   F C C   +TG+ CET ID C         PC N G C++K          + C+C   + G  C+     C  N CKN   C P    + + F C C  G  G +C+ D ++EC LS+ C N  SC+N  G   C C KG  G  C I    C      N  T  D I D     C    D K C+ + N+
Sbjct:   51 RGTDTALVAAS---CTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNPCNSMR-CQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETK-NLCAS-SPCRNGATCTALAGSSS-FTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCT--NTHGSYSCIC---VNGWAGLDCSNNTDDC---KQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGIC-----HDSIAGYSCECPPGYTGTSCEININDCDSNPC-HRGKCIDDVNSFKCLCDPGYTGYICQ-KQINECES-------------NPCQFDGHCQD--RVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSN--------------PCQHGGT--CYDKLNAFSCQCMPGYTGQKCETNIDDCVTN------PCGNGGTCIDKVN-------GYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSS--NFLDFSCTCKLGYTGRYCDED-IDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSC-LCVDGFDGKHCETDINE 987          

HSP 6 Score: 378.637 bits (971), Expect = 6.083e-105
Identity = 289/917 (31.52%), Postives = 411/917 (44.82%), Query Frame = 3
Query: 1548 PEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFT-CQCLQGFVGLRCETKSDICKQLTPCKTEEIC-LNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEI-NECFNNPCQHGSQCQ-DLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYG---FRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINEC---QHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQ-----------------------------------NTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEI 4160
            P  + G +  +    CT   C NG  C  ++ G T C C   +VG  CE + + C  +  C+    C +   N R G  C CP                                    GF+   CEI + N C +  C +G  CQ     +Y C C  G+ G++CE   N CA +PC  NG     + G   F C C   ++G TC+  ++ C  N C     C+  N + SY C C T    Y G  C+     C+                      PC N   C +   S+ CKC   +EG+ CE+  ++C  + C+NG TC +    + CRC   FTG  C+ +++EC    H  C N A C +    Y CIC +G++G +C  N +DC +++C     C+D V  F C+C +   G  C HL   C SNPC     C    +N                                    NTPG Y CNC +GFTGPRCE  ++ C  +PC + G C  D  +F+C C   + G +CEI   E C+S               C + G C +  +  GFKCSC  G+ G+ C++NIDDC SQPC N G C D    Y C+C PG+ G +C++N N+C SN C+ GKCID +N+F C+C  G +G  C+  ++ C+   CQ  G C++ +G + C C  G +GK CE ++NEC  N              PC+   T  C+D   ++ C C   FTG++CE  +D C       + PC NNG+C+++          + C CP G+    C  +  +C  N C N G C     D    F C CPPG  G  CE+D ++EC S  C + G+C +      C C  G  G+KCE     C      N  T  D++
Sbjct:   47 PNTVRGTDTALVAASCTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHR-NPCNSMR-CQNGGTCQVTFRNGRPGISCKCP-----------------------------------LGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETK-NLCASSPC-RNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCV--NTHGSYQCMCPTG---YTGKDCDTKYKPCSPS--------------------PCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLC-HLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDE-CQS-------------NPCLNDGTCHD--KINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSN--------------PCNNGAT--CIDGINSYKCQCVPGFTGQHCEKNVDECI------SSPCANNGVCIDQVN-------GYKCECPRGFYDAHCLSDVDECASNPCVNEGRCE----DGINEFICHCPPGYTGKRCELD-IDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKV 848          
BLAST of Neurogenic locus notch protein vs. Ensembl Fly
Match: crb (gene:FBgn0259685 transcript:FBtr0111008)

HSP 1 Score: 343.969 bits (881), Expect = 1.515e-94
Identity = 338/1132 (29.86%), Postives = 480/1132 (42.40%), Query Frame = 3
Query:  432 NFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQK--SNCPITPCQNGGTC-KLIAGNNVCQCLNEWVGEFCEFSSN----CASSPCRNGGICKSL-EIHKYECQCPKNYLGMNCEL-PNSCGSQNPCGVNGKCILANDGEVKCHCN-KGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKN---GGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSID-NCQKIS--------------------CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGG-FTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLN--VNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCM-LPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECN----------LDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEY-IGERCEIKKTETCKSYAVEKFKNE------SLINKICKHHGNCFNDPETGGFKCSC--QSGYGGSFCEVNIDDCA--------------------SQPCINGGECGDG-----TGMYFCKCQP-GFQG--VNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKY 3563
            NFC N  C    TC S   G Y C C   Y G  C++   S C   PC+NGG+C +   G+  C C     G+ CE   N    C ++PC N G C  +       C+CPK Y G  CE+  + C SQ PC  NG CI   +G   C C+  GYTG  C  ++DEC   +   C NGG C +T G Y C+C  G+ GE C+  +  C    C NGGTCLDK   ++C+CP  Y G  C+   +  +  P  +   GG         +C+C    +  + + +              C S   + Y  I     + K CE  +  NCQ  +                    C NGG+C   + G  C C  G+ G+ CE   N      CQ    C+       C CPE    K C    ++C   PC NG  C D   G + C+C +G+ G  C    D C  L P    +IC N    N +  YKC C  G    +C  ++ +C +  C+NG  C +  N  +C+C PG+EG  CE++I+EC +NPC +GS C D  N++ C C+PG  G+ C+I+I++C  +PC   GQCID++ GFRC C    Y G  C   +D C  N C N A C+  ++   Y C+C      Y+G  CE+D++EC           L+R+ + LY ++ ++                  +  F  + +S YE                              C CV G  G+ CEI INEC  NPCS    C D I  Y C C+ GF G +CEIN ++C   +    G C D+++ ++C C+ NY G NC  L + CD NPCLN G+C+   +N+ T  Y C C  GF G +CE               +  T L S   +    Y I  +          ++     KNE       LIN     H +  N  E G F  S    S +   F  +N                         SQP       G       + +     QP  F G   +  VN    + +  +      ++ N    CPR           + CK   C + G C ++   F C+CP+ F G  C+ ++    +
Sbjct:  267 NFCLNDPCMGHGTCSSSPEG-YECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQ-PCQNNGSCIDRING-FSCDCSGTGYTGAFCQTNVDEC---DKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMT-CQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGG---------KCVCKPGSSASDMEPLTPLELDILDAT--LCPSEKKKRY--ISPEWLKRKRCELKLSYNCQTSTGDGASALALTPINCNATNGKCLNGGTC--SMNGTHCYCAVGYSGDRCEKAENCSPLN-CQEPMVCV----QNQCLCPE---NKVC----NQCATQPCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDECT-LHP----KICGNGICKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCL--DRVKDYFCDCHNG---YKGKNCEQDINECESNPCQYNGNCLERSNITLYQMSRITDLPKVF------------SQPFSFENASGYE------------------------------CVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEKTT---------TLSMVATSLISVTTEREEGYDINLQFRTTLPNGVLAFGTTGEKNEPVSYILELINGRLNLHSSLLNKWE-GVFIGSKLNDSNWHKVFVAINTSHLVLSANDEQAIFPVGSYETANNSQPSFPRTYLGGTIPNLKSYLRHLTHQPSAFVGCMQDIMVNGKWIFPDEQDANISYTKLENVQSGCPR----------TEQCKPNPCHSNGECTDLWHTFACHCPRPFFGHTCQHNMTAATF 1292          

HSP 2 Score: 331.257 bits (848), Expect = 1.218e-90
Identity = 289/889 (32.51%), Postives = 413/889 (46.46%), Query Frame = 3
Query: 1131 LCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSID---NCQKISCFNGGSCINMIEGGK--CNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCP-EGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVN---NTRSGYKCICPDGVQNCKKELS-KCKNIVCINGQCVDVNNEEKCICIPGFEGRTCE----IEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININ------------ECAHNPC---GLNGQCID----EVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICI------PGNKY--------------------DSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCN-ENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNEC-YSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGIC-----KNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLIS 3596
             C   PC   G C    E Y+C C  +++GKNC  D  +PC  NPC+N G C   +  DY+C C     G+ CET ++    CQ   C N G+C+ +   G   C C  G+ G  CE++ +EC ++PCQNN  CID  N ++CDC   G TG  C+ N+DEC  NPCLNG RC D  G +TCQCL G+ G       +IC +   C+T++ CLN     +   G++C+CP        +++  C     I+ +CV      KC+C PG      E    +E++      C    + + +  ++L       K K+CE+ ++              A  P      NG+C++     + G  C C + YSG  C  K + C+P  C    +C+      P NK                       Y C C+     + G  C  DVDEC L   ++   G+                  C N  GS+ C C+  + G  C+  ++ C + PC NGATC N  + + C C  G+ GE CE++I+EC  NPCSN + CID IN++ C C  G +G+ C+I+ +DC    CL  GQC+D++ GF C C+   Y G NCE     C SNPC N   C++R  +     Y C+C  G+ G  CE  ++ C  NPC   G C                 ER  I                 S I  + K     F+     G++C C  G  G  CE+NI++C S PC   G C DG G Y C+C+PGF+G +C++N +EC   N C  G C DQI+++ C C     G+ C  ++  C +  C NGG C       V   + C C  GF G  CE         ++  AT+LIS
Sbjct:  268 FCLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGG-------EICDRPMTCQTQQ-CLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVG----GKCVCKPGSSASDMEPLTPLELDILDATLCPSEKKKRYISPEWL-------KRKRCELKLSYNCQTSTGDGASALALTPINCNATNGKCLNGGTCSMNGTHCYCAVGYSGDRC-EKAENCSPLNCQEPMVCVQNQCLCPENKVCNQCATQPCQNGGECVDLPNGDYECKCTRG---WTGRTCGNDVDECTL-HPKICGNGI------------------CKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCLDRVKD-----YFCDCHNGYKGKNCEQDINECESNPCQYNGNCL----------------ERSNI------------TLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEKTT-----TLSMVATSLIS 1076          

HSP 3 Score: 286.96 bits (733), Expect = 3.947e-77
Identity = 239/728 (32.83%), Postives = 345/728 (47.39%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECA-YGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCG---VNGKCI-----LANDGEV-------------------------------KCHCNKGYTGNTCSNDIDECASYETPL--------CENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDF-DEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCL-QGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVC-INGQCVDVNNEE--------------------------KCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININEC-AHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQ 2360
            +  + C +  C+N  +C   ING + C+C+  GY G +C+   + C   PC NGG C    G   CQCL+ W GE C+    C +  C NGG C    I  ++C CP  Y G  C++  SC  Q P     V GKC+      A+D E                                +C     Y   T + D    A   TP+        C NGGTC  ++    C C  G++G+RCE    +C+   C+    C+      +C+CP N     C  +       PC+NGG C D  + DY+C C   WTG+ C +DV           NG C++     YKC C  GF G  C++ +D C    C NG +C N I   +C C PG+EG NCE++++EC + PC N + CID  N++TC+C  G+TG+ C+I+ID+C  +PCLNG +C D++GGF C C   G+ G  CE   D C    PC     CL+       Y C C +G +  NC++++++C++  C  NG C++ +N                            +C+C+PG  G+ CEI INEC +NPC     C D    Y C C PGF+G  CEINI+EC  +NPC   G C D++  + C C   Y G  C+  L  C+ N C N   C+P    +  H    T    ++G KCEK         T L++   +++S++  +
Sbjct:  385 VDTDECASQPCQNNGSCIDRING-FSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDKPI-GFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSASDMEPLTPLELDILDATLCPSEKKKRYISPEWLKRKRCELKLSYNCQTSTGD-GASALALTPINCNATNGKCLNGGTC--SMNGTHCYCAVGYSGDRCEK-AENCSPLNCQEPMVCVQN----QCLCPENKVCNQCATQ-------PCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDECTLHPKICGNGICKN-EKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLS-NPCTNGAKCLD---RVKDYFCDCHNGYKGKNCEQDINECESNPCQYNGNCLERSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPC-QRGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEK--------TTTLSMVATSLISVTTER 1081          

HSP 4 Score: 238.039 bits (606), Expect = 3.379e-62
Identity = 256/897 (28.54%), Postives = 380/897 (42.36%), Query Frame = 3
Query: 1827 CKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIE-INECFNNPCQHGSQC-QDLFNDYLCICLPGFKGKKCEININ---ECAHNPCGLNGQCIDEVYG----FRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKN------CEINDNDCT-----------ESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSN--PCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMD--------------------------WCRGNPCGDFGVCETDLDS--FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCP-KGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNK-----YQ----NEVGRNYN----------FSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEI-----DYVNECLSTKCY--------------------------------NNGSCVNGFGKAICH-----CNKGSCGEKCEITGSACNLASIDNSQTYQDE 4157
            C N  C+ +G C       +C C   + G+ C+ +  + C  NPC++G  C ++   DY C C P   G+ CE  +N    C  NPC  NG C+  V G      C+C   Y+G  C    D C    C N+  CI  ++ + + C+CS     Y G+ C+ +VDEC+ +                    PCLN  +C +T G + C+C   + G  C++P+          G TC +   GF+C C   +TGE C+I  +  Q   C  D++C+      +C+C+ G S  +       E++  D T               L   +C  K++ + C+ +     +        C++    CLN G+C       +  G  C C  G++G RCE   +                           C   PC + G C  DL +  ++CKC   + G  C     E             +L  KIC   GN     E G +KC C  G+ G  C+ ++D+C S PC+NG  C +    Y C CQPG++G NC+V+ +EC SN C+ G  CID+INNF+C C  G++GR C+  +D C    C NGG C + +G F C+C   G+ G+ CE +I+EC  N              PC  T   +CLDR   + C C   + GK CE  I+ CE      + PC  NG CL +     YQ     ++ + ++          + C+C  G  G+ C+IN  +C  N C  +G C     D   ++ CEC PG  G  CEI     D  N C    CY                                N G+C+      + H     C  G  G+KCE T +   +A+   S T + E
Sbjct:  269 CLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACV--VIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCI--DRINGFSCDCSGT--GYTGAFCQTNVDECDKN--------------------PCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLN-GGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQ--CPIDSECVGG----KCVCKPGSSASDMEPLTPLELDILDATLCPSEKKKRYISPEWLKRKRCELKLS-YNCQTSTGDGASALALTPINCNATNGKCLNGGTC-------SMNGTHCYCAVGYSGDRCEKAENCSPLNCQEPMVCVQNQCLCPENKVCNQCATQPCQNGGEC-VDLPNGDYECKCTRGWTGRTCGNDVDEC------------TLHPKIC---GNGICKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSN--------------PC--TNGAKCLDRVKDYFCDCHNGYKGKNCEQDINECE------SNPCQYNGNCLERSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCN----DGIGTYTCECEPGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEKTTTLSMVATSLISVTTERE 1082          

HSP 5 Score: 236.884 bits (603), Expect = 7.282e-62
Identity = 263/908 (28.96%), Postives = 378/908 (41.63%), Query Frame = 3
Query: 1932 NECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEI-NINECAHNPCGLNGQCIDEVYG-FRCQCMLPYSGPTCANKLD---PCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCS-SQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDN---DC-TESSCLGHGQCV------------------DKVNGFECKCNENYIGTNCEHLKR-------------------------PCDSNP----CLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKM--------------------------DWCRGNPCGDFGVCETDLDS--FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCP-KGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLE---CNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCD 4385
            N C N+PC     C      Y C C   + GK C+  N + CA NPC   G C++   G ++C C   +SG  C  +++    C  N C N+  C+      +  C C      Y G++CE D DEC                   SQ  PC N+  CI+    F C CS + Y G  C+  ++ C  NPC NG  C +    + C+C+ G+ GE C+  +  CQ   C N   C+D    +QC+C   ++G+ C+I  +    C  +S C+G G+CV                  D ++   C   +     + E LKR                         P + N     CLN G+C       +  G  C C  G++G RCE                             + C   PC + G C  DL +  ++CKC   + G  C     E             +L  KIC   GN     E G +KC C  G+ G  C+ ++D+C S PC+NG  C +    Y C CQPG++G NC+V+ +EC SN C+ G  CID+INNF+C C  G++GR C+  +D C    C NGG C + +G F C+C   G+ G+ CE +I+EC  N              PC  T   +CLDR   + C C   + GK CE  I+ CE      + PC  NG CL                       ER  I   +            +PF  ++   ++C C PG+ G  CEI+ +NEC S  C  +G+C +G G   C C  G  G  CEI    C+  +     T  D+I D + + C +    K C +    C++  C  +GG CL                P+   E+    N  C N F   +C+
Sbjct:  267 NFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKG---YAGARCEVDTDEC------------------ASQ--PCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMT-CQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVG-GKCVCKPGSSASDMEPLTPLELDILDATLCPSEKKKRYISPEWLKRKRCELKLSYNCQTSTGDGASALALTPINCNATNGKCLNGGTC-------SMNGTHCYCAVGYSGDRCEKAENCSPLNCQEPMVCVQNQCLCPENKVCNQCATQPCQNGGEC-VDLPNGDYECKCTRGWTGRTCGNDVDEC------------TLHPKIC---GNGICKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSN--------------PC--TNGAKCLDRVKDYFCDCHNGYKGKNCEQDINECE------SNPCQYNGNCL-----------------------ERSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEIN-INECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCD-CDANYGGKNCSVLLKGCDQNPC-LNGGACL----------------PYLINEVTHLYNCTCENGFQGDKCE 1062          

HSP 6 Score: 193.356 bits (490), Expect = 1.417e-48
Identity = 193/735 (26.26%), Postives = 292/735 (39.73%), Query Frame = 3
Query: 2367 PCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXX--XXXGATCDNLADGFRCRCVAGFTGERCEIEIN---ECQHNPCSNDAKC--IDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCN-ENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKT----------------------ETCKSYAVEKFKNESLINKIC-KHHGNCFNDPE---------TGGFKCSCQSGYGGSFCEVNIDDCASQ--PCINGGECG-DGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVI-GDFECNCPKGFAGKLCETDINECKYN--IAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCN-KGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDP---QCNTEACLFDG 4421
            PC+    C ++   + C+C+++Y G+ C+K   +          G+  +N    ++C C    +G+ CE E+N    CQ NPC N+  C  I       C C  G++G  CE++ ++C    C  +G C+D++NGF C C+   Y G  C+     CD NPCLN G C +         Y C C  G+ G  C+  M  C+   C + G C      F+C C  EY GE C+I  +                             +   + + L   +C       +  PE            + C   +G G S   +   +C +    C+NGG C  +GT    C C  G+ G  C+   N    N      C+       C+CP          + + C    CQNGG C ++  GD+EC C +G+ G+ C  D++EC  +  I GN                   C +  G++ C C   FTG +C++ +D C  F      PC N   C NK          + C+C  GY GE C+++  +C  N C N   C    ID   +F C C PG+ G  C+ID +++C+   C N G C++  G   C C+  G  GE CE+                   I +C  N C                    +G +CL RV                     K     CHN +  K C+    +C +  C ++G
Sbjct:  273 PCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFD-----TYGWYTCQCLDGWGGEICDRPMT-CQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSASDMEPLTPLELDILDATLCPSEKKKRYISPEWLKRKRCELKLSYNCQTSTGDGASALALTPINCNATNGKCLNGGTCSMNGT---HCYCAVGYSGDRCEKAENCSPLNCQEPMVCVQN----QCLCPE-------NKVCNQCATQPCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDECTLHPKICGNGI-----------------CKNEKGSYKCYCTPGFTGVHCDSDVDECLSF------PCLNGATCHNKINA-------YECVCQPGYEGENCEVDIDECGSNPCSNGSTC----IDRINNFTCNCIPGMTGRICDID-IDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELN------------------IDECLSNPCT-------------------NGAKCLDRV---------------------KDYFCDCHNGYKGKNCEQDINECESNPCQYNG 894          

HSP 7 Score: 180.259 bits (456), Expect = 1.424e-44
Identity = 156/462 (33.77%), Postives = 206/462 (44.59%), Query Frame = 3
Query:  408 FCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELP-NSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCK-AGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQD---YKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXX-XXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC-----EDRVGGFTCQCLQGFVGLRCE---TKSDICKQLTPCKTEE 1739
             CP     N C    C+NG  C    NG Y C+C  G+ G  C    + C + P  C N G CK   G+  C C   + G  C+   + C S PC NG  C + +I+ YEC C   Y G NCE+  + CGS NPC  NG   +       C+C  G TG  C  DID+C       C NGG CI+ +G ++C C   G+ GE CE +I +C ++ C NG  CLD++  Y C C N Y G NCE     CE  PC+  G C +                  +               F +  ++++   Y+C+C  G  GK CE +I+ C    C   G+C + I    C C PGFEG +            PCQ    C D  +DY CDC     GKNC + +  C  NPCLNG  C      +    + C C  GF G +CE   T S +   L    TE 
Sbjct:  644 LCPENKVCNQCATQPCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDECTLHPKICGN-GICKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHN-KINAYECVCQPGYEGENCEVDIDECGS-NPCS-NGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDP---CLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCLDRVKDYFCDCHNGYKGKNCEQDINECESNPCQYNGNCLE----------------RSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQ-RGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEKTTTLSMVATSLISVTTER 1081          

HSP 8 Score: 169.088 bits (427), Expect = 2.954e-41
Identity = 176/609 (28.90%), Postives = 259/609 (42.53%), Query Frame = 3
Query: 2679 EINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLK-RPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMD---WCRGNPCGDFGVCET--DLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQ-SGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKM-----ECQNGG-ICK----------------NVIGDFECN--------CPKGFAGKLCETDIN-ECKYNIAGNATNLISNP------------HGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKF---------------------RKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLN--VCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDL---ECNKYACGFDGGECLHRV 4271
             + DN C    C+GHG C     G+EC+C   Y G NC+     PC  NPC N GSC+     +N+ G Y C C    +G  CE +++    C+ NPC + G C       +  C+C   Y G RCE+  T+ C S             + C+++G+C +     GF C C  +GY G+FC+ N+D+C   PC+NGG C D  G Y C+C  G+ G  C      C +  C N G C+D+   F C+CP   +G  C+ I   C +      EC  G  +CK                +++    C          P+    K CE  ++  C+ +    A+ L   P             G CS  GT          HC C   ++G  CE + + C                         +    PC N G C++        N ++ C C  G+ G  C  +  +C L+  +C  NGIC+    +++ S+KC C PG  G+ C+ D V+ECLS  C N  +C N      C C  G  GE CE+    C      N  T  D I++   N C      +ICD+   +C    C  +GG+C+ ++
Sbjct:  263 RLPDNFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCL-----ENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEV-DTDECAS-------------QPCQNNGSCID--RINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICD-RPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQ-IAPSCAQQCPIDSECVGGKCVCKPGSSASDMEPLTPLELDILDATLCPSEKKKRYISPEWLKRKRCELKLSYNCQTSTGDGASALALTPINCNATNGKCLNGGTCSMNGT----------HCYCAVGYSGDRCE-KAENCSPLNCQEPMVCVQNQCLCPENKVCNQCATQPCQNGGECVDL------PNGDYECKCTRGWTGRTCGNDVDECTLHPKIC-GNGICK----NEKGSYKCYCTPGFTGVHCDSD-VDECLSFPCLNGATCHNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCN-CIPGMTGRICDIDIDDCVGDPC-LNGGQCIDQL 823          

HSP 9 Score: 149.443 bits (376), Expect = 2.729e-35
Identity = 123/352 (34.94%), Postives = 168/352 (47.73%), Query Frame = 3
Query:  786 QNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCEN-KRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCP-EGLTGKNCEINIDECTP--NPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELS 1823
            Q+ C  +G C   +D E  C C  G+ G+ C  DIDEC + E   C N GTCIN V ++ C+C+ GF G+ CE +I +C +  C NGG C D I SY C CP +Y G  C+  K+  CE +PC+NG  C++                                 GF  S    ++ C C  GFEG +C+  I  C+   C NGG C+       C C  G+ G  CE ++NECE+ PCQN  +C DL   Y CDC   G  G  CE +IDEC    + C    RC ++ G F C C + + G  C   +D C     C     C+     +  Y C CP+G   +NC   ++
Sbjct: 1805 QSDCKNDGFCQSPSD-EYACTCQPGFEGDDCGTDIDECLNTE---CLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQN---------------------------------GFNASTG-NNFTCTCVPGFEGPLCD--IPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNF-TDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPIT 2115          

HSP 10 Score: 139.813 bits (351), Expect = 2.530e-32
Identity = 98/301 (32.56%), Postives = 141/301 (46.84%), Query Frame = 3
Query: 2502 CDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKR-PCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTE---------------------TCKSYAVEKFKNESLINK------ICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGM---YFCKCQPGFQGVNC 3311
            C + +D + C C  GF G+ C  +I+EC +  C N+  CI+ +  + C CQ GF G++CE N ++C +  C   G C D +  + C C E+Y+G  C+ LK+  C++ PC N  +C N         + C C  GF GP C+I   +C   PC + G+C T      CKC+  Y G  CE    E                      C+    E  + E+ I++       C   G CFN P  G F+C CQ  Y G++C       A+  C NGG C +  G    Y+C+C  GF G NC
Sbjct: 1814 CQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIP--FCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKP--GSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNC 2110          

HSP 11 Score: 137.887 bits (346), Expect = 9.804e-32
Identity = 112/341 (32.84%), Postives = 158/341 (46.33%), Query Frame = 3
Query: 1938 CFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCIN-----TNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQ-SGFSGKNCEINDNDCTESS--CLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCD-SNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKM 2933
            CF + C++   CQ   ++Y C C PGF+G  C  +I+EC +  C  NG CI++V  F CQC   + G  C   +D C    C+N   C   +   SY C+C      Y G +C+                   VL     +  PC N + C N     T  +F C C   +EG  C+  +  C   PC NG  C        C+C  G+TG  CE +INEC+ NPC N  +C D +  Y+C CQ +GF G  CE + ++C      C G G+C +K   F+C C + Y G  C +   PC+ ++ C N G C+     +  P Y C C  GF G  C   +
Sbjct: 1803 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCT--DLIASYVCDCPE---DYMGPQCD-------------------VLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCD--IPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYC-NFTDPCNATDLCSNGGRCVESCGAK--PDYYCECPEGFAGKNCTAPI 2114          

HSP 12 Score: 135.576 bits (340), Expect = 4.457e-31
Identity = 112/331 (33.84%), Postives = 153/331 (46.22%), Query Frame = 3
Query: 1821 SKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTC-ANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCV-AGFTGERCEIEINEC--QHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNG---FECKCNENYIGTNC 2792
            S CKN    +G C   ++E  C C PGFEG  C  +I+EC N  C +   C +    + C C PGF+G+ CE NI+ECA  PC   G C D +  + C C   Y GP C   K   C    C N + C  G    + +    T +  +EG  C  D+  C                    +I PC N   C+ T    +CKCS  Y GR CE+ +N C +NPC+NG  C +L   + C C   GF G RCE +I+EC  + + C    +C +    +QCICQ  + G  C   D       C   G+CV+       + C+C E + G NC
Sbjct: 1806 SDCKN----DGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLC--DIPFC--------------------EITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNC 2110          

HSP 13 Score: 130.568 bits (327), Expect = 1.687e-29
Identity = 121/364 (33.24%), Postives = 162/364 (44.51%), Query Frame = 3
Query:  303 QAGFGIYLILILSVLQLKQEKQMKLSIGAAILILLFCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQN-PCGVNGKCI----LANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYF-GTNCENKRTLCELKPCKNGGICRDFDE--DYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFC-ESVNYQ-DYKCICQRGFEGKMCETSI 1358
            +A  G  L+   S+ +L     + +   A   +    P    +  C    CKN   CQS  + +Y C C  G++G  C      C  T C N GTC        CQC   + G+ CE +   CA  PC NGG C  L I  Y C CP++Y+G  C++      +N PC     C      +      C C  G+ G  C  DI  C   E   C+NGG C+ T     CKC  G+ G  CE DI +C ++ C+NGG C D +G Y C C    F G  CEN    C ++    GG+ R F++   +QCIC   + G  C+        + C N G C ES   + DY C C  GF GK C   I
Sbjct: 1759 EARVGDLLLPYFSMAELYSRTNVSVQQKAQFRLNATRPEEGCI-LCFQSDCKNDGFCQSPSD-EYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDL-IASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLC--DIPFC---EITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPI 2114          

HSP 14 Score: 127.102 bits (318), Expect = 1.854e-28
Identity = 111/354 (31.36%), Postives = 144/354 (40.68%), Query Frame = 3
Query: 2940 CRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSN-------SCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKY-FTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFC 3977
            C  + C + G C++  D + C C   + G+ C     E               +N  C ++G C N  +   F C CQ G+ G  CE NID+CA QPC NGG C D    Y C C   + G  C V       N       +C  G      NNF+C C  G  G  C+  + +C+   C NGG+C        C C  G+ G+LCE DINEC+ N              PC   G  +C D  G + C C+   F G  CE  ID C      G+  C   G C NK         +F CIC   Y G  C         ++C N G C       +  + CECP G  G  C
Sbjct: 1803 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDE--------------CLNTECLNNGTCIN--QVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCD--IPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESN--------------PCQNGG--QCKDLVGRYECDCQGTGFEGIRCENDIDEC---NMEGDY-CGGLGRCFNKPG-------SFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVE-SCGAKPDYYCECPEGFAGKNC 2110          

HSP 15 Score: 120.168 bits (300), Expect = 2.395e-26
Identity = 107/382 (28.01%), Postives = 153/382 (40.05%), Query Frame = 3
Query: 1494 CQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCING-QCVDVNNEEKCICIPGFEGRTCEI-EINECFNNPCQHGSQCQDLFN-----DYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDN---LADGFRCRCVAGFTGERCEIEINECQHNPCSND 2609
            C+N+  C   +++Y C C  G  G +C  +IDEC    CLN   C ++V  F CQC  GF G                                        Q+C++ + +C +  C NG  C D+     C C   + G  C++ +   C N PC++GS CQ+ FN     ++ C C+PGF+G  C+I    C   PC   G C+       C+C L Y+G  C   ++ C  N C N   C   +    Y C+C      +EG +CE D+DECN++       G                  +C N  GSF C C   Y G  C         + C NG  C         + C C  GF G+ C   I   +  P + D
Sbjct: 1808 CKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEG----------------------------------------QHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIPF--CEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQC--KDLVGRYECDCQGT--GFEGIRCENDIDECNMEGDYCGGLG------------------RCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPITAKEDGPSTTD 2125          

HSP 16 Score: 115.161 bits (287), Expect = 8.254e-25
Identity = 109/346 (31.50%), Postives = 158/346 (45.66%), Query Frame = 3
Query: 3111 CKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDY-CKKMECQNGGICKNVI-----GDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICP-NGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTK-CYNNGSCVNGFGKA---ICHCNKGSCGEKCEITGSA 4112
            CK+ G C +  +   + C+CQ G+ G  C  +ID+C +  C+N G C +    +FC+CQPGF+G +C+ N +EC    C N G C D I ++ C CP    G  C+ +    C+   C+NG  C+N        +F C C  GF G LC  DI  C+                PC   G   CL       C C   +TG+ CE  I+ CE      + PC N G C    ++ VGR   + C C   G+ G RC+ +  +C +      G+ R F  +   SF+C C     G +C  ++ + C +T  C N G CV   G      C C +G  G+ C    +A
Sbjct: 1808 CKNDGFCQSPSDE--YACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLC--DIPFCEIT--------------PCDNGGL--CLTTGAVPMCKCSLGYTGRLCEQDINECE------SNPCQNGGQC----KDLVGR---YECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCF--NKPGSFQCICQKPYCGAYC--NFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPITA 2116          

HSP 17 Score: 112.849 bits (281), Expect = 3.305e-24
Identity = 91/291 (31.27%), Postives = 127/291 (43.64%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQK-SNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEF--SSNCASSPCRNGGICK----SLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCK-AGFNGERCENDIVDC----------------------------------------TNDTCKNGGTCLDKIGS---YRCVCPNNYFGTNCENKRTLCELKP 1148
            ++ C N +C N  TC + +   + C+C  G++G +CEQ    C   PC NGG C  +  + VC C  +++G  C+      C + PCRNG  C+    +   + + C C   + G  C++P       PC   G C L       C C+ GYTG  C  DI+EC   E+  C+NGG C + VG Y+C C+  GF G RCENDI +C                                          D C NGG C++  G+   Y C CP  + G NC    T  E  P
Sbjct: 1838 IDECLNTECLNNGTCINQV-AAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIPFC--EITPCDNGGLC-LTTGAVPMCKCSLGYTGRLCEQDINEC---ESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPITAKEDGP 2121          

HSP 18 Score: 109.383 bits (272), Expect = 4.790e-23
Identity = 95/303 (31.35%), Postives = 133/303 (43.89%), Query Frame = 3
Query: 3216 CASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGT---FHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECP-PGVGGLFCEIDYVNEC--LSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEIT 4103
            C    C N G C   +  Y C CQPGF+G +C  + +EC +  C N G CI+Q+  F C C  G  G+ CE  +D C    C NGG C ++I  + C+CP+ + G  C+                 ++  + PC    T +      T   F C+C   F G  C+  I +CE        PC N G+CL      +       C C  GY G  C+ +  +C+ N C+N G C+    D    ++C+C   G  G+ CE D ++EC      C   G C N  G   C C K  CG  C  T
Sbjct: 1803 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCD-------------VLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCD--IPFCEI------TPCDNGGLCLTTGAVPM-------CKCSLGYTGRLCEQDINECESNPCQNGGQCK----DLVGRYECDCQGTGFEGIRCEND-IDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNFT 2072          

HSP 19 Score: 97.0561 bits (240), Expect = 2.494e-19
Identity = 83/266 (31.20%), Postives = 111/266 (41.73%), Query Frame = 3
Query: 3330 CYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCN-KGSCGEKCEITGSACNL 4121
            C+ + C N G C    + ++C C  G  G  C T +D C   EC N G C N +  F C C  GF G+ CE +I+EC      N  N                C D   ++ C C + + G  C+       K     N PC N   C N +    G   NF+C C  G+ G  C I    C++  C N G+C    +       C+C  G  G  CE D +NEC S  C N G C +  G+  C C   G  G +CE     CN+
Sbjct: 1803 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGN----------------CTDLIASYVCDCPEDYMGPQCDVL-----KQMTCENEPCRNGSTCQNGFNASTGN--NFTCTCVPGFEGPLCDI--PFCEITPCDNGGLC----LTTGAVPMCKCSLGYTGRLCEQD-INECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNM 2038          

HSP 20 Score: 85.8853 bits (211), Expect = 5.014e-16
Identity = 106/404 (26.24%), Postives = 148/404 (36.63%), Query Frame = 3
Query: 3354 GKCIDQINNFSCVCPRGVSGRFCETI-VDYCKKMECQNGGIC-KNVIGDFECNCPKGFAGKLCETDIN---ECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICP-NGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCI 4547
            G C      + C C    SG+ C+      C K  C+NGG C +N  GD++C C    +G+ CET++N    C+ N              PC   G    +   G   C C K + G  CE   D C       + PC NNG C+++          FSC C   GY G  C+ N  +C  N C N G C     D    + C+C  G GG  C  D    C + +C N G+C++      C C     GE C+I  S      ID         S+C   KC  K  +   D+E                 P  +D  D ++      C   K +      W   KRC+        L   ++C  + G             DG   L    + C+   G C+
Sbjct:  278 GTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTN--------------PCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDEC------ASQPCQNNGSCIDRING-------FSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRC----FDTYGWYTCQCLDGWGGEIC--DRPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPID---------SECVGGKCVCKPGSSASDME--------------PLTPLELDILDATL------CPSEKKKRYISPEWLKRKRCE--------LKLSYNCQTSTG-------------DGASALALTPINCNATNGKCL 598          

HSP 21 Score: 81.2629 bits (199), Expect = 1.599e-14
Identity = 99/382 (25.92%), Postives = 142/382 (37.17%), Query Frame = 3
Query: 3441 CKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKI-NSKKCQLNVCKNNGICR-PFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKC--ASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-----PLQSFCDKHYADGQCQLE--CNTMECSFDGGDCIES 4553
            C + +C+N G C++   ++ C C  GF G  C TDI+EC               +  C   GT  C+++   F C C+  F G++CE  ID C       + PC N G C +   + V       C CP  Y G +C +     C+   C+N   C+  F      +F C C PG  G  C+I +   C  T C N G C+      +C C+ G  G  CE                   +I++CE N C    +  + +   EC+    GF+G  C          NDI                              +CN E       D    +G+C       Q  C K Y    C     CN  +   +GG C+ES
Sbjct: 1803 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECL--------------NTECLNNGT--CINQVAAFFCQCQPGFEGQHCEQNIDEC------ADQPCHNGGNCTDLIASYV-------CDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIPF---CEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCE------------------QDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRC---------ENDID-----------------------------ECNMEG------DYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVES 2090          
BLAST of Neurogenic locus notch protein vs. Ensembl Fly
Match: crb (gene:FBgn0259685 transcript:FBtr0084603)

HSP 1 Score: 337.806 bits (865), Expect = 1.175e-92
Identity = 289/854 (33.84%), Postives = 405/854 (47.42%), Query Frame = 3
Query: 1131 LCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSID---NCQKISCFNGGSCINMIEGGK--CNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCP-EGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVN---NTRSGYKCICPDGVQNCKKELS-KCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINE-------------CFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKL-DPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCN-ENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNEC-YSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGIC-----KNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLIS 3596
             C   PC   G C    E Y+C C  +++GKNC  D  +PC  NPC+N G C   +  DY+C C     G+ CET ++    CQ   C N G+C+ +   G   C C  G+ G  CE++ +EC ++PCQNN  CID  N ++CDC   G TG  C+ N+DEC  NPCLNG RC D  G +TCQCL G+ G       +IC +   C+T++ CLN     +   G++C+CP        +++  C     I+ +CV      KC+C PG  G  C+    +               N  C +G  C    N   C C  G+ G +CE      A N   LN  C + +   + QC+ P       NK+ + C    C N   C+     D Y C C+     + G  C  DVDEC L   ++   G+                  C N  GS+ C C+  + G  C+  ++ C + PC NGATC N  + + C C  G+ GE CE++I+EC  NPCSN + CID IN++ C C  G +G+ C+I+ +DC    CL  GQC+D++ GF C C+   Y G NCE     C SNPC N   C++R  +     Y C+C  G+ G  CE  ++ C  NPC   G C                 ER  I   +             S I  + K     F+     G++C C  G  G  CE+NI++C S PC   G C DG G Y C+C+PGF+G +C++N +EC   N C  G C DQI+++ C C     G+ C  ++  C +  C NGG C       V   + C C  GF G  CE         ++  AT+LIS
Sbjct:  268 FCLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGG-------EICDRPMTCQTQQ-CLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVG----GKCVCKPGSSGYNCQTSTGDGASALALTPINCNATNGKCLNGGTCS--MNGTHCYCAVGYSGDRCEK-----AENCSPLN--CQEPMVCVQNQCLCP------ENKVCNQCATQPCQNGGECVDLPNGD-YECKCTRG---WTGRTCGNDVDECTL-HPKICGNGI------------------CKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCLDRVKD-----YFCDCHNGYKGKNCEQDINECESNPCQYNGNCL----------------ERSNITLYQM------------SRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEKTT-----TLSMVATSLIS 1033          

HSP 2 Score: 302.753 bits (774), Expect = 5.461e-82
Identity = 236/691 (34.15%), Postives = 344/691 (49.78%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECA-YGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYE--TPL--------CENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDF-DEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCL-QGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVC-INGQCVDVNNEE--------------------------KCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININEC-AHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQ 2360
            +  + C +  C+N  +C   ING + C+C+  GY G +C+   + C   PC NGG C    G   CQCL+ W GE C+    C +  C NGG C    I  ++C CP  Y G  C++  SC  Q  C ++ +C+       KC C  G +G  C     + AS    TP+        C NGGTC  ++    C C  G++G+RCE    +C+   C+    C+      +C+CP N     C  +       PC+NGG C D  + DY+C C   WTG+ C +DV           NG C++     YKC C  GF G  C++ +D C    C NG +C N I   +C C PG+EG NCE++++EC + PC N + CID  N++TC+C  G+TG+ C+I+ID+C  +PCLNG +C D++GGF C C   G+ G  CE   D C    PC     CL+       Y C C +G +  NC++++++C++  C  NG C++ +N                            +C+C+PG  G+ CEI INEC +NPC     C D    Y C C PGF+G  CEINI+EC  +NPC   G C D++  + C C   Y G  C+  L  C+ N C N   C+P    +  H    T    ++G KCEK         T L++   +++S++  +
Sbjct:  385 VDTDECASQPCQNNGSCIDRING-FSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDKPI-GFQCLCPPEYTGELCQIAPSCAQQ--CPIDSECVGG-----KCVCKPGSSGYNCQTSTGDGASALALTPINCNATNGKCLNGGTC--SMNGTHCYCAVGYSGDRCEK-AENCSPLNCQEPMVCVQN----QCLCPENKVCNQCATQ-------PCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDECTLHPKICGNGICKN-EKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLS-NPCTNGAKCLD---RVKDYFCDCHNGYKGKNCEQDINECESNPCQYNGNCLERSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPC-QRGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEK--------TTTLSMVATSLISVTTER 1038          

HSP 3 Score: 300.827 bits (769), Expect = 2.469e-81
Identity = 264/824 (32.04%), Postives = 376/824 (45.63%), Query Frame = 3
Query:  432 NFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQK--SNCPITPCQNGGTC-KLIAGNNVCQCLNEWVGEFCEFSSN----CASSPCRNGGICKSL-EIHKYECQCPKNYLGMNCEL-PNSCGSQNPCGVNGKCILANDGEVKCHCN-KGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKN---GGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVN----------YQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDL-NNDYTCDCPEGLTGKNCEINIDECTPNP--CLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICL-PGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINEC-QHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCV-----DKVNGFECKCNENYIGTNCE 2795
            NFC N  C    TC S   G Y C C   Y G  C++   S C   PC+NGG+C +   G+  C C     G+ CE   N    C ++PC N G C  +       C+CPK Y G  CE+  + C SQ PC  NG CI   +G   C C+  GYTG  C  ++DEC   +   C NGG C +T G Y C+C  G+ GE C+  +  C    C NGGTCLDK   ++C+CP  Y G  C+   +  +  P  +   GG         +C+C    +G NC                 C + N               C C  G+ G  CE + +NC  ++C     C+      +C C             N+C  +PCQN  +C+DL N DY C C  G TG+ C  ++DECT +P  C NG  C++  G + C C  GF G+ C++  D C    PC     C N  N    Y+C+C  G   +NC+ ++ +C +  C NG  C+D  N   C CIPG  GR C+I+I++C  +PC +G QC D    + C C   G++G+ CE+NI+EC  NPC    +C+D V  + C C   Y G  C   ++ C  N C              Y+ NC                    L+R+ + LY ++ +    + +    +          + C C     G+ CE  +N C +NPC     C++    + C C  GF G  CEI I+EC ++NPC     C D I+DY C C + + GKNC +    C ++ CL  G C+     +  + + C C   + G  CE
Sbjct:  267 NFCLNDPCMGHGTCSSSPEG-YECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQ-PCQNNGSCIDRING-FSCDCSGTGYTGAFCQTNVDEC---DKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMT-CQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGG---------KCVCKPGSSGYNCQTSTGDGASALALTPINCNATNGKCLNGGTCSMNGTHCYCAVGYSGDRCEKA-ENCSPLNCQEPMVCVQ----NQCLC-------PENKVCNQCATQPCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDECTLHPKICGNGI-CKNEKGSYKCYCTPGFTGVHCDSDVDECLSF-PCLNGATCHNKIN---AYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCLDRVKDYFCDCHNGYKGKNCEQDINECESNPC-------------QYNGNC--------------------LERSNITLYQMSRI----TDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQR-GTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCE 1019          

HSP 4 Score: 253.832 bits (647), Expect = 4.650e-67
Identity = 254/862 (29.47%), Postives = 357/862 (41.42%), Query Frame = 3
Query: 2046 NECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTC-ANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQC--INTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCV-AGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKR-----PCDSN----------------------------------------PCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKM--------------------------DWCRGNPCGDFGVCETDLDS--FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCP-KGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLE---CNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCD 4385
            N C ++PC  +G C     G+ C+C   YSG  C  +   PC  N C N   C+  ++ D Y C C      + G  CE +V+   L                  Q  PCLN+  C  I  +G+  C+C   Y G +CE   + C + PC+N  +C +  +GF C C   G+TG  C+  ++EC  NPC N  +C D    Y C C  G+ G+ C+     C    CL  G C+DK  GF+C C   Y G  C+         P DS                                          CLN G+C       +  G  C C  G++G RCE                             + C   PC + G C  DL +  ++CKC   + G  C     E             +L  KIC   GN     E G +KC C  G+ G  C+ ++D+C S PC+NG  C +    Y C CQPG++G NC+V+ +EC SN C+ G  CID+INNF+C C  G++GR C+  +D C    C NGG C + +G F C+C   G+ G+ CE +I+EC  N              PC  T   +CLDR   + C C   + GK CE  I+ CE      + PC  NG CL                       ER  I   +            +PF  ++   ++C C PG+ G  CEI+ +NEC S  C  +G+C +G G   C C  G  G  CEI    C+  +     T  D+I D + + C +    K C +    C++  C  +GG CL                P+   E+    N  C N F   +C+
Sbjct:  267 NFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGD-YQCFCDP---NHSGQHCETEVNIHPL-----------------CQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICD-RPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSGYNCQTSTGDGASALALTPINCNATNGKCLNGGTC-------SMNGTHCYCAVGYSGDRCEKAENCSPLNCQEPMVCVQNQCLCPENKVCNQCATQPCQNGGEC-VDLPNGDYECKCTRGWTGRTCGNDVDEC------------TLHPKIC---GNGICKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSN--------------PC--TNGAKCLDRVKDYFCDCHNGYKGKNCEQDINECE------SNPCQYNGNCL-----------------------ERSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEIN-INECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCD-CDANYGGKNCSVLLKGCDQNPC-LNGGACL----------------PYLINEVTHLYNCTCENGFQGDKCE 1019          

HSP 5 Score: 180.644 bits (457), Expect = 9.874e-45
Identity = 176/576 (30.56%), Postives = 254/576 (44.10%), Query Frame = 3
Query: 2679 EINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLK-RPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMD---WCRGNPCGDFGVCET--DLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQ-SGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKM-----ECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAG-----NATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKF---------------------RKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLN--VCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDL---ECNKYACGFDGGECLHRV 4271
             + DN C    C+GHG C     G+EC+C   Y G NC+     PC  NPC N GSC+     +N+ G Y C C    +G  CE +++    C+ NPC + G C       +  C+C   Y G RCE+  T+ C S             + C+++G+C +     GF C C  +GY G+FC+ N+D+C   PC+NGG C D  G Y C+C  G+ G  C      C +  C N G C+D+   F C+CP   +G  C+ I   C +      EC  G          +C C  G +G  C+T   +    +A      NATN      G CS  GT          HC C   ++G  CE + + C                         +    PC N G C++        N ++ C C  G+ G  C  +  +C L+  +C  NGIC+    +++ S+KC C PG  G+ C+ D V+ECLS  C N  +C N      C C  G  GE CE+    C      N  T  D I++   N C      +ICD+   +C    C  +GG+C+ ++
Sbjct:  263 RLPDNFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCL-----ENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEV-DTDECAS-------------QPCQNNGSCID--RINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICD-RPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQ-IAPSCAQQCPIDSECVGG----------KCVCKPGSSGYNCQTSTGDGASALALTPINCNATNGKCLNGGTCSMNGT----------HCYCAVGYSGDRCE-KAENCSPLNCQEPMVCVQNQCLCPENKVCNQCATQPCQNGGECVDL------PNGDYECKCTRGWTGRTCGNDVDECTLHPKIC-GNGICK----NEKGSYKCYCTPGFTGVHCDSD-VDECLSFPCLNGATCHNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCN-CIPGMTGRICDIDIDDCVGDPC-LNGGQCIDQL 780          

HSP 6 Score: 180.259 bits (456), Expect = 1.293e-44
Identity = 156/462 (33.77%), Postives = 206/462 (44.59%), Query Frame = 3
Query:  408 FCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELP-NSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCK-AGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQD---YKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXX-XXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC-----EDRVGGFTCQCLQGFVGLRCE---TKSDICKQLTPCKTEE 1739
             CP     N C    C+NG  C    NG Y C+C  G+ G  C    + C + P  C N G CK   G+  C C   + G  C+   + C S PC NG  C + +I+ YEC C   Y G NCE+  + CGS NPC  NG   +       C+C  G TG  C  DID+C       C NGG CI+ +G ++C C   G+ GE CE +I +C ++ C NG  CLD++  Y C C N Y G NCE     CE  PC+  G C +                  +               F +  ++++   Y+C+C  G  GK CE +I+ C    C   G+C + I    C C PGFEG +            PCQ    C D  +DY CDC     GKNC + +  C  NPCLNG  C      +    + C C  GF G +CE   T S +   L    TE 
Sbjct:  601 LCPENKVCNQCATQPCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDECTLHPKICGN-GICKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHN-KINAYECVCQPGYEGENCEVDIDECGS-NPCS-NGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDP---CLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCLDRVKDYFCDCHNGYKGKNCEQDINECESNPCQYNGNCLE----------------RSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQ-RGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEKTTTLSMVATSLISVTTER 1038          

HSP 7 Score: 149.828 bits (377), Expect = 2.507e-35
Identity = 123/352 (34.94%), Postives = 168/352 (47.73%), Query Frame = 3
Query:  786 QNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCEN-KRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCP-EGLTGKNCEINIDECTP--NPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELS 1823
            Q+ C  +G C   +D E  C C  G+ G+ C  DIDEC + E   C N GTCIN V ++ C+C+ GF G+ CE +I +C +  C NGG C D I SY C CP +Y G  C+  K+  CE +PC+NG  C++                                 GF  S    ++ C C  GFEG +C+  I  C+   C NGG C+       C C  G+ G  CE ++NECE+ PCQN  +C DL   Y CDC   G  G  CE +IDEC    + C    RC ++ G F C C + + G  C   +D C     C     C+     +  Y C CP+G   +NC   ++
Sbjct: 1762 QSDCKNDGFCQSPSD-EYACTCQPGFEGDDCGTDIDECLNTE---CLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQN---------------------------------GFNASTG-NNFTCTCVPGFEGPLCD--IPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNF-TDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPIT 2072          

HSP 8 Score: 139.813 bits (351), Expect = 2.175e-32
Identity = 98/301 (32.56%), Postives = 141/301 (46.84%), Query Frame = 3
Query: 2502 CDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKR-PCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTE---------------------TCKSYAVEKFKNESLINK------ICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGM---YFCKCQPGFQGVNC 3311
            C + +D + C C  GF G+ C  +I+EC +  C N+  CI+ +  + C CQ GF G++CE N ++C +  C   G C D +  + C C E+Y+G  C+ LK+  C++ PC N  +C N         + C C  GF GP C+I   +C   PC + G+C T      CKC+  Y G  CE    E                      C+    E  + E+ I++       C   G CFN P  G F+C CQ  Y G++C       A+  C NGG C +  G    Y+C+C  GF G NC
Sbjct: 1771 CQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIP--FCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKP--GSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNC 2067          

HSP 9 Score: 137.887 bits (346), Expect = 8.501e-32
Identity = 112/341 (32.84%), Postives = 158/341 (46.33%), Query Frame = 3
Query: 1938 CFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCIN-----TNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQ-SGFSGKNCEINDNDCTESS--CLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCD-SNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKM 2933
            CF + C++   CQ   ++Y C C PGF+G  C  +I+EC +  C  NG CI++V  F CQC   + G  C   +D C    C+N   C   +   SY C+C      Y G +C+                   VL     +  PC N + C N     T  +F C C   +EG  C+  +  C   PC NG  C        C+C  G+TG  CE +INEC+ NPC N  +C D +  Y+C CQ +GF G  CE + ++C      C G G+C +K   F+C C + Y G  C +   PC+ ++ C N G C+     +  P Y C C  GF G  C   +
Sbjct: 1760 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCT--DLIASYVCDCPE---DYMGPQCD-------------------VLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCD--IPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYC-NFTDPCNATDLCSNGGRCVESCGAK--PDYYCECPEGFAGKNCTAPI 2071          

HSP 10 Score: 135.961 bits (341), Expect = 4.065e-31
Identity = 112/331 (33.84%), Postives = 153/331 (46.22%), Query Frame = 3
Query: 1821 SKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTC-ANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCV-AGFTGERCEIEINEC--QHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNG---FECKCNENYIGTNC 2792
            S CKN    +G C   ++E  C C PGFEG  C  +I+EC N  C +   C +    + C C PGF+G+ CE NI+ECA  PC   G C D +  + C C   Y GP C   K   C    C N + C  G    + +    T +  +EG  C  D+  C                    +I PC N   C+ T    +CKCS  Y GR CE+ +N C +NPC+NG  C +L   + C C   GF G RCE +I+EC  + + C    +C +    +QCICQ  + G  C   D       C   G+CV+       + C+C E + G NC
Sbjct: 1763 SDCKN----DGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLC--DIPFC--------------------EITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNC 2067          

HSP 11 Score: 130.568 bits (327), Expect = 1.566e-29
Identity = 121/364 (33.24%), Postives = 162/364 (44.51%), Query Frame = 3
Query:  303 QAGFGIYLILILSVLQLKQEKQMKLSIGAAILILLFCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQN-PCGVNGKCI----LANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYF-GTNCENKRTLCELKPCKNGGICRDFDE--DYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFC-ESVNYQ-DYKCICQRGFEGKMCETSI 1358
            +A  G  L+   S+ +L     + +   A   +    P    +  C    CKN   CQS  + +Y C C  G++G  C      C  T C N GTC        CQC   + G+ CE +   CA  PC NGG C  L I  Y C CP++Y+G  C++      +N PC     C      +      C C  G+ G  C  DI  C   E   C+NGG C+ T     CKC  G+ G  CE DI +C ++ C+NGG C D +G Y C C    F G  CEN    C ++    GG+ R F++   +QCIC   + G  C+        + C N G C ES   + DY C C  GF GK C   I
Sbjct: 1716 EARVGDLLLPYFSMAELYSRTNVSVQQKAQFRLNATRPEEGCI-LCFQSDCKNDGFCQSPSD-EYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDL-IASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLC--DIPFC---EITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPI 2071          

HSP 12 Score: 127.102 bits (318), Expect = 1.841e-28
Identity = 111/354 (31.36%), Postives = 144/354 (40.68%), Query Frame = 3
Query: 2940 CRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSN-------SCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKY-FTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFC 3977
            C  + C + G C++  D + C C   + G+ C     E               +N  C ++G C N  +   F C CQ G+ G  CE NID+CA QPC NGG C D    Y C C   + G  C V       N       +C  G      NNF+C C  G  G  C+  + +C+   C NGG+C        C C  G+ G+LCE DINEC+ N              PC   G  +C D  G + C C+   F G  CE  ID C      G+  C   G C NK         +F CIC   Y G  C         ++C N G C       +  + CECP G  G  C
Sbjct: 1760 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDE--------------CLNTECLNNGTCIN--QVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCD--IPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESN--------------PCQNGG--QCKDLVGRYECDCQGTGFEGIRCENDIDEC---NMEGDY-CGGLGRCFNKPG-------SFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVE-SCGAKPDYYCECPEGFAGKNC 2067          

HSP 13 Score: 120.553 bits (301), Expect = 1.912e-26
Identity = 107/382 (28.01%), Postives = 153/382 (40.05%), Query Frame = 3
Query: 1494 CQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCING-QCVDVNNEEKCICIPGFEGRTCEI-EINECFNNPCQHGSQCQDLFN-----DYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDN---LADGFRCRCVAGFTGERCEIEINECQHNPCSND 2609
            C+N+  C   +++Y C C  G  G +C  +IDEC    CLN   C ++V  F CQC  GF G                                        Q+C++ + +C +  C NG  C D+     C C   + G  C++ +   C N PC++GS CQ+ FN     ++ C C+PGF+G  C+I    C   PC   G C+       C+C L Y+G  C   ++ C  N C N   C   +    Y C+C      +EG +CE D+DECN++       G                  +C N  GSF C C   Y G  C         + C NG  C         + C C  GF G+ C   I   +  P + D
Sbjct: 1765 CKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEG----------------------------------------QHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIPF--CEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQC--KDLVGRYECDCQGT--GFEGIRCENDIDECNMEGDYCGGLG------------------RCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPITAKEDGPSTTD 2082          

HSP 14 Score: 114.775 bits (286), Expect = 8.484e-25
Identity = 109/346 (31.50%), Postives = 158/346 (45.66%), Query Frame = 3
Query: 3111 CKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDY-CKKMECQNGGICKNVI-----GDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICP-NGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTK-CYNNGSCVNGFGKA---ICHCNKGSCGEKCEITGSA 4112
            CK+ G C +  +   + C+CQ G+ G  C  +ID+C +  C+N G C +    +FC+CQPGF+G +C+ N +EC    C N G C D I ++ C CP    G  C+ +    C+   C+NG  C+N        +F C C  GF G LC  DI  C+                PC   G   CL       C C   +TG+ CE  I+ CE      + PC N G C    ++ VGR   + C C   G+ G RC+ +  +C +      G+ R F  +   SF+C C     G +C  ++ + C +T  C N G CV   G      C C +G  G+ C    +A
Sbjct: 1765 CKNDGFCQSPSDE--YACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLC--DIPFCEIT--------------PCDNGGL--CLTTGAVPMCKCSLGYTGRLCEQDINECE------SNPCQNGGQC----KDLVGR---YECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCF--NKPGSFQCICQKPYCGAYC--NFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPITA 2073          

HSP 15 Score: 113.235 bits (282), Expect = 3.177e-24
Identity = 91/291 (31.27%), Postives = 127/291 (43.64%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQK-SNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEF--SSNCASSPCRNGGICK----SLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKA-GFNGERCENDIVDC----------------------------------------TNDTCKNGGTCLDKIGS---YRCVCPNNYFGTNCENKRTLCELKP 1148
            ++ C N +C N  TC + +   + C+C  G++G +CEQ    C   PC NGG C  +  + VC C  +++G  C+      C + PCRNG  C+    +   + + C C   + G  C++P       PC   G C L       C C+ GYTG  C  DI+EC   E+  C+NGG C + VG Y+C C+  GF G RCENDI +C                                          D C NGG C++  G+   Y C CP  + G NC    T  E  P
Sbjct: 1795 IDECLNTECLNNGTCINQV-AAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIPFC--EITPCDNGGLC-LTTGAVPMCKCSLGYTGRLCEQDINEC---ESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPITAKEDGP 2078          

HSP 16 Score: 108.997 bits (271), Expect = 5.009e-23
Identity = 95/303 (31.35%), Postives = 133/303 (43.89%), Query Frame = 3
Query: 3216 CASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGT---FHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECP-PGVGGLFCEIDYVNEC--LSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEIT 4103
            C    C N G C   +  Y C CQPGF+G +C  + +EC +  C N G CI+Q+  F C C  G  G+ CE  +D C    C NGG C ++I  + C+CP+ + G  C+                 ++  + PC    T +      T   F C+C   F G  C+  I +CE        PC N G+CL      +       C C  GY G  C+ +  +C+ N C+N G C+    D    ++C+C   G  G+ CE D ++EC      C   G C N  G   C C K  CG  C  T
Sbjct: 1760 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCD-------------VLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCD--IPFCEI------TPCDNGGLCLTTGAVPM-------CKCSLGYTGRLCEQDINECESNPCQNGGQCK----DLVGRYECDCQGTGFEGIRCEND-IDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNFT 2029          

HSP 17 Score: 97.0561 bits (240), Expect = 2.524e-19
Identity = 83/266 (31.20%), Postives = 111/266 (41.73%), Query Frame = 3
Query: 3330 CYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCN-KGSCGEKCEITGSACNL 4121
            C+ + C N G C    + ++C C  G  G  C T +D C   EC N G C N +  F C C  GF G+ CE +I+EC      N  N                C D   ++ C C + + G  C+       K     N PC N   C N +    G   NF+C C  G+ G  C I    C++  C N G+C    +       C+C  G  G  CE D +NEC S  C N G C +  G+  C C   G  G +CE     CN+
Sbjct: 1760 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGN----------------CTDLIASYVCDCPEDYMGPQCDVL-----KQMTCENEPCRNGSTCQNGFNASTGN--NFTCTCVPGFEGPLCDI--PFCEITPCDNGGLC----LTTGAVPMCKCSLGYTGRLCEQD-INECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNM 1995          

HSP 18 Score: 81.2629 bits (199), Expect = 1.428e-14
Identity = 99/382 (25.92%), Postives = 142/382 (37.17%), Query Frame = 3
Query: 3441 CKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKI-NSKKCQLNVCKNNGICR-PFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKC--ASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-----PLQSFCDKHYADGQCQLE--CNTMECSFDGGDCIES 4553
            C + +C+N G C++   ++ C C  GF G  C TDI+EC               +  C   GT  C+++   F C C+  F G++CE  ID C       + PC N G C +   + V       C CP  Y G +C +     C+   C+N   C+  F      +F C C PG  G  C+I +   C  T C N G C+      +C C+ G  G  CE                   +I++CE N C    +  + +   EC+    GF+G  C          NDI                              +CN E       D    +G+C       Q  C K Y    C     CN  +   +GG C+ES
Sbjct: 1760 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECL--------------NTECLNNGT--CINQVAAFFCQCQPGFEGQHCEQNIDEC------ADQPCHNGGNCTDLIASYV-------CDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIPF---CEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCE------------------QDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRC---------ENDID-----------------------------ECNMEG------DYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVES 2047          

HSP 19 Score: 53.9138 bits (128), Expect = 3.055e-6
Identity = 87/331 (26.28%), Postives = 119/331 (35.95%), Query Frame = 3
Query: 3609 PCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKIN---SKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCN-KGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICD--LECNKYACGFDGGECLHRV-------PKRIDGNDISIA-SPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACL----FDGWDCMDAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCI 4547
            PC   GT  C   P  + C C   ++GK C+      +        PC N G CL   +N  G   ++ C C   + G+ C+        CQ N C NNG C    I    +  CECP G  G  CE+D  +EC S  C NNGSC++      C C+  G  G  C+     C+     N     D        +C      +ICD  + C    C  +GG CL +        P    G    IA S    C I                 D +C    C+      G++C  + G             DG   L    + C+   G C+
Sbjct:  273 PCMGHGT--CSSSPEGYECRCTARYSGKNCQK-----DNGSPCAKNPCENGGSCL---ENSRG---DYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGAC--VVIGGSGALTCECPKGYAGARCEVD-TDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYG-WYTCQCLDGWGGEICDRPMTCQTQQC-LNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPI-----------------DSECVGGKCVCKPGSSGYNCQTSTG-------------DGASALALTPINCNATNGKCL 555          
BLAST of Neurogenic locus notch protein vs. Ensembl Fly
Match: crb (gene:FBgn0259685 transcript:FBtr0334925)

HSP 1 Score: 337.035 bits (863), Expect = 1.784e-92
Identity = 337/1146 (29.41%), Postives = 480/1146 (41.88%), Query Frame = 3
Query:  432 NFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQK--SNCPITPCQNGGTC-KLIAGNNVCQCLNEWVGEFCEFSSN----CASSPCRNGGICKSL-EIHKYECQCPKNYLGMNCEL-PNSCGSQNPCGVNGKCILANDGEVKCHCN-KGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKN---GGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSID-NCQKIS--------------------CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGG-FTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLN--VNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCING---------------QCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCM-LPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECN----------LDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEY-IGERCEIKKTETCKSYAVEKFKNE------SLINKICKHHGNCFNDPETGGFKCSC--QSGYGGSFCEVNIDDCA--------------------SQPCINGGECGDG-----TGMYFCKCQP-GFQG--VNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKY 3563
            NFC N  C    TC S   G Y C C   Y G  C++   S C   PC+NGG+C +   G+  C C     G+ CE   N    C ++PC N G C  +       C+CPK Y G  CE+  + C SQ PC  NG CI   +G   C C+  GYTG  C  ++DEC   +   C NGG C +T G Y C+C  G+ GE C+  +  C    C NGGTCLDK   ++C+CP  Y G  C+   +  +  P  +   GG         +C+C    +  + + +              C S   + Y  I     + K CE  +  NCQ  +                    C NGG+C   + G  C C  G+ G+ CE   N      CQ    C+       C CPE    K C    ++C   PC NG  C D   G + C+C +G+ G  C    D C  L P    +IC N    N +  YKC C  G    +C  ++ +C +  C+NG               + +   N  +C+C PG+EG  CE++I+EC +NPC +GS C D  N++ C C+PG  G+ C+I+I++C  +PC   GQCID++ GFRC C    Y G  C   +D C  N C N A C+  ++   Y C+C      Y+G  CE+D++EC           L+R+ + LY ++ ++                  +  F  + +S YE                              C CV G  G+ CEI INEC  NPCS    C D I  Y C C+ GF G +CEIN ++C   +    G C D+++ ++C C+ NY G NC  L + CD NPCLN G+C+   +N+ T  Y C C  GF G +CE               +  T L S   +    Y I  +          ++     KNE       LIN     H +  N  E G F  S    S +   F  +N                         SQP       G       + +     QP  F G   +  VN    + +  +      ++ N    CPR           + CK   C + G C ++   F C+CP+ F G  C+ ++    +
Sbjct:  267 NFCLNDPCMGHGTCSSSPEG-YECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQ-PCQNNGSCIDRING-FSCDCSGTGYTGAFCQTNVDEC---DKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMT-CQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGG---------KCVCKPGSSASDMEPLTPLELDILDAT--LCPSEKKKRY--ISPEWLKRKRCELKLSYNCQTSTGDGASALALTPINCNATNGKCLNGGTC--SMNGTHCYCAVGYSGDRCEKAENCSPLN-CQEPMVCV----QNQCLCPE---NKVC----NQCATQPCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDECT-LHP----KICGNGICKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKLFFFKFGKHRILRQINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCL--DRVKDYFCDCHNG---YKGKNCEQDINECESNPCQYNGNCLERSNITLYQMSRITDLPKVF------------SQPFSFENASGYE------------------------------CVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEKTT---------TLSMVATSLISVTTEREEGYDINLQFRTTLPNGVLAFGTTGEKNEPVSYILELINGRLNLHSSLLNKWE-GVFIGSKLNDSNWHKVFVAINTSHLVLSANDEQAIFPVGSYETANNSQPSFPRTYLGGTIPNLKSYLRHLTHQPSAFVGCMQDIMVNGKWIFPDEQDANISYTKLENVQSGCPR----------TEQCKPNPCHSNGECTDLWHTFACHCPRPFFGHTCQHNMTAATF 1306          

HSP 2 Score: 321.242 bits (822), Expect = 1.492e-87
Identity = 289/903 (32.00%), Postives = 414/903 (45.85%), Query Frame = 3
Query: 1131 LCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSID---NCQKISCFNGGSCINMIEGGK--CNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCP-EGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVN---NTRSGYKCICPDGVQNCKKELS-KCKNIVCINGQCVDVNNEEKCICIPGFEGRTCE----IEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININ------------ECAHNPC---GLNGQCID----EVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICI------PGNKY--------------------DSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDN--------------LADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCN-ENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNEC-YSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGIC-----KNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLIS 3596
             C   PC   G C    E Y+C C  +++GKNC  D  +PC  NPC+N G C   +  DY+C C     G+ CET ++    CQ   C N G+C+ +   G   C C  G+ G  CE++ +EC ++PCQNN  CID  N ++CDC   G TG  C+ N+DEC  NPCLNG RC D  G +TCQCL G+ G       +IC +   C+T++ CLN     +   G++C+CP        +++  C     I+ +CV      KC+C PG      E    +E++      C    + + +  ++L       K K+CE+ ++              A  P      NG+C++     + G  C C + YSG  C  K + C+P  C    +C+      P NK                       Y C C+     + G  C  DVDEC L   ++   G+                  C N  GS+ C C+  + G  C+  ++ C + PC NGATC N                + + C C  G+ GE CE++I+EC  NPCSN + CID IN++ C C  G +G+ C+I+ +DC    CL  GQC+D++ GF C C+   Y G NCE     C SNPC N   C++R  +     Y C+C  G+ G  CE  ++ C  NPC   G C                 ER  I   +             S I  + K     F+     G++C C  G  G  CE+NI++C S PC   G C DG G Y C+C+PGF+G +C++N +EC   N C  G C DQI+++ C C     G+ C  ++  C +  C NGG C       V   + C C  GF G  CE         ++  AT+LIS
Sbjct:  268 FCLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGG-------EICDRPMTCQTQQ-CLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVG----GKCVCKPGSSASDMEPLTPLELDILDATLCPSEKKKRYISPEWL-------KRKRCELKLSYNCQTSTGDGASALALTPINCNATNGKCLNGGTCSMNGTHCYCAVGYSGDRC-EKAENCSPLNCQEPMVCVQNQCLCPENKVCNQCATQPCQNGGECVDLPNGDYECKCTRG---WTGRTCGNDVDECTL-HPKICGNGI------------------CKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKLFFFKFGKHRILRQINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCLDRVKD-----YFCDCHNGYKGKNCEQDINECESNPCQYNGNCL----------------ERSNITLYQM------------SRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEKTT-----TLSMVATSLIS 1090          

HSP 3 Score: 277.33 bits (708), Expect = 3.236e-74
Identity = 239/742 (32.21%), Postives = 345/742 (46.50%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECA-YGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCG---VNGKCI-----LANDGEV-------------------------------KCHCNKGYTGNTCSNDIDECASYETPL--------CENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDF-DEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCIN--------------MIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCL-QGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVC-INGQCVDVNNEE--------------------------KCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININEC-AHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQ 2360
            +  + C +  C+N  +C   ING + C+C+  GY G +C+   + C   PC NGG C    G   CQCL+ W GE C+    C +  C NGG C    I  ++C CP  Y G  C++  SC  Q P     V GKC+      A+D E                                +C     Y   T + D    A   TP+        C NGGTC  ++    C C  G++G+RCE    +C+   C+    C+      +C+CP N     C  +       PC+NGG C D  + DY+C C   WTG+ C +DV           NG C++     YKC C  GF G  C++ +D C    C NG +C N               I   +C C PG+EG NCE++++EC + PC N + CID  N++TC+C  G+TG+ C+I+ID+C  +PCLNG +C D++GGF C C   G+ G  CE   D C    PC     CL+       Y C C +G +  NC++++++C++  C  NG C++ +N                            +C+C+PG  G+ CEI INEC +NPC     C D    Y C C PGF+G  CEINI+EC  +NPC   G C D++  + C C   Y G  C+  L  C+ N C N   C+P    +  H    T    ++G KCEK         T L++   +++S++  +
Sbjct:  385 VDTDECASQPCQNNGSCIDRING-FSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDKPI-GFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSASDMEPLTPLELDILDATLCPSEKKKRYISPEWLKRKRCELKLSYNCQTSTGD-GASALALTPINCNATNGKCLNGGTC--SMNGTHCYCAVGYSGDRCEK-AENCSPLNCQEPMVCVQN----QCLCPENKVCNQCATQ-------PCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDECTLHPKICGNGICKN-EKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKLFFFKFGKHRILRQINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLS-NPCTNGAKCLD---RVKDYFCDCHNGYKGKNCEQDINECESNPCQYNGNCLERSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPC-QRGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEK--------TTTLSMVATSLISVTTER 1095          

HSP 4 Score: 241.121 bits (614), Expect = 3.483e-63
Identity = 251/885 (28.36%), Postives = 370/885 (41.81%), Query Frame = 3
Query: 2046 NECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCA-NKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQC--INTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCV-AGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCE---------HLKRPCDSNPCLNKGSCINRKVNQNTP-------GYLCNC--RRGFTGP------RCEIKMDW---------------------CRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEK----FKNESL--INKIC--------KHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCING-GECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTG---------------KCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKY-FTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGIC----------------------RPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLE---CNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCD 4385
            N C ++PC  +G C     G+ C+C   YSG  C  +   PC  N C N   C+  ++ D Y C C      + G  CE +V+   L                  Q  PCLN+  C  I  +G+  C+C   Y G +CE   + C + PC+N  +C +  +GF C C   G+TG  C+  ++EC  NPC N  +C D    Y C C  G+ G+ C+     C    CL  G C+DK  GF+C C   Y G  C+          +   C    C+ K       +   TP         LC    ++ +  P      RCE+K+ +                          C + G C   ++   C C   Y G+RCE  K E C     ++     +N+ L   NK+C        ++ G C + P  G ++C C  G+ G  C  ++D+C   P I G G C +  G Y C C PGF GV+C  + +EC S  C  G               + + QIN + CVC  G  G  CE  +D C    C NG  C + I +F CNC  G  G++C+ DI++C  +              PC   G  +C+D+ G F C C    + G+ CE  ID C       + PC N   CL++ +       ++ C C NGY G+ C+ +  +C+ N C+ NG C                      +PF  ++   ++C C PG+ G  CEI+ +NEC S  C  +G+C +G G   C C  G  G  CEI    C+  +     T  D+I D + + C +    K C +    C++  C  +GG CL                P+   E+    N  C N F   +C+
Sbjct:  267 NFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGD-YQCFCDP---NHSGQHCETEVNIHPL-----------------CQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICD-RPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSASDMEPLTPLELDILDATLCPSEKKKRYISPEWLKRKRCELKLSYNCQTSTGDGASALALTPINCNATNGKCLNGGTCS--MNGTHCYCAVGYSGDRCE--KAENCSPLNCQEPMVCVQNQCLCPENKVCNQCATQPCQNGGECVDLP-NGDYECKCTRGWTGRTCGNDVDECTLHPKICGNGICKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKLFFFKFGKHRILRQINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGD--------------PCLNGG--QCIDQLGGFRCDCSGTGYEGENCELNIDECL------SNPCTNGAKCLDRVK-------DYFCDCHNGYKGKNCEQDINECESNPCQYNGNCLERSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEIN-INECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCD-CDANYGGKNCSVLLKGCDQNPC-LNGGACL----------------PYLINEVTHLYNCTCENGFQGDKCE 1076          

HSP 5 Score: 228.024 bits (580), Expect = 4.208e-59
Identity = 256/911 (28.10%), Postives = 380/911 (41.71%), Query Frame = 3
Query: 1827 CKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIE-INECFNNPCQHGSQC-QDLFNDYLCICLPGFKGKKCEININ---ECAHNPCGLNGQCIDEVYG----FRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKN------CEINDNDCT-----------ESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSN--PCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMD--------------------------WCRGNPCGDFGVCETDLDS--FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDG--------------TGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCP-KGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNK-----YQ----NEVGRNYN----------FSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEI-----DYVNECLSTKCY--------------------------------NNGSCVNGFGKAICH-----CNKGSCGEKCEITGSACNLASIDNSQTYQDE 4157
            C N  C+ +G C       +C C   + G+ C+ +  + C  NPC++G  C ++   DY C C P   G+ CE  +N    C  NPC  NG C+  V G      C+C   Y+G  C    D C    C N+  CI  ++ + + C+CS     Y G+ C+ +VDEC+ +                    PCLN  +C +T G + C+C   + G  C++P+          G TC +   GF+C C   +TGE C+I  +  Q   C  D++C+      +C+C+ G S  +       E++  D T               L   +C  K++ + C+ +     +        C++    CLN G+C       +  G  C C  G++G RCE   +                           C   PC + G C  DL +  ++CKC   + G  C     E             +L  KIC   GN     E G +KC C  G+ G  C+ ++D+C S PC+NG  C +                  Y C CQPG++G NC+V+ +EC SN C+ G  CID+INNF+C C  G++GR C+  +D C    C NGG C + +G F C+C   G+ G+ CE +I+EC  N              PC  T   +CLDR   + C C   + GK CE  I+ CE      + PC  NG CL +     YQ     ++ + ++          + C+C  G  G+ C+IN  +C  N C  +G C     D   ++ CEC PG  G  CEI     D  N C    CY                                N G+C+      + H     C  G  G+KCE T +   +A+   S T + E
Sbjct:  269 CLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACV--VIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCI--DRINGFSCDCSGT--GYTGAFCQTNVDECDKN--------------------PCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLN-GGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQ--CPIDSECVGG----KCVCKPGSSASDMEPLTPLELDILDATLCPSEKKKRYISPEWLKRKRCELKLS-YNCQTSTGDGASALALTPINCNATNGKCLNGGTC-------SMNGTHCYCAVGYSGDRCEKAENCSPLNCQEPMVCVQNQCLCPENKVCNQCATQPCQNGGEC-VDLPNGDYECKCTRGWTGRTCGNDVDEC------------TLHPKIC---GNGICKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKLFFFKFGKHRILRQINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSN--------------PC--TNGAKCLDRVKDYFCDCHNGYKGKNCEQDINECE------SNPCQYNGNCLERSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCN----DGIGTYTCECEPGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEKTTTLSMVATSLISVTTERE 1096          

HSP 6 Score: 194.126 bits (492), Expect = 8.161e-49
Identity = 195/742 (26.28%), Postives = 297/742 (40.03%), Query Frame = 3
Query: 2367 PCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXX--XXXGATCDNLADGFRCRCVAGFTGERCEIEIN---ECQHNPCSNDAKC--IDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCN-ENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKT----------------------ETCKSYAVEKFKNESLINKIC-KHHGNCFNDPE---------TGGFKCSCQSGYGGSFCEVNIDDCASQ--PCINGGECG-DGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVI-GDFECNCPKGFAGKLCETDINECKYN--IAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKY------QNEVGRNYN-FSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCN-KGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDP---QCNTEACLFDG 4421
            PC+    C ++   + C+C+++Y G+ C+K   +          G+  +N    ++C C    +G+ CE E+N    CQ NPC N+  C  I       C C  G++G  CE++ ++C    C  +G C+D++NGF C C+   Y G  C+     CD NPCLN G C +         Y C C  G+ G  C+  M  C+   C + G C      F+C C  EY GE C+I  +                             +   + + L   +C       +  PE            + C   +G G S   +   +C +    C+NGG C  +GT    C C  G+ G  C+   N    N      C+       C+CP          + + C    CQNGG C ++  GD+EC C +G+ G+ C  D++EC  +  I GN                   C +  G++ C C   FTG +C++ +D C  F      PC N   C NK       ++ + R  N + C+C  GY GE C+++  +C  N C N   C    ID   +F C C PG+ G  C+ID +++C+   C N G C++  G   C C+  G  GE CE+                   I +C  N C                    +G +CL RV                     K     CHN +  K C+    +C +  C ++G
Sbjct:  273 PCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFD-----TYGWYTCQCLDGWGGEICDRPMT-CQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSASDMEPLTPLELDILDATLCPSEKKKRYISPEWLKRKRCELKLSYNCQTSTGDGASALALTPINCNATNGKCLNGGTCSMNGT---HCYCAVGYSGDRCEKAENCSPLNCQEPMVCVQN----QCLCPE-------NKVCNQCATQPCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDECTLHPKICGNGI-----------------CKNEKGSYKCYCTPGFTGVHCDSDVDECLSF------PCLNGATCHNKLFFFKFGKHRILRQINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTC----IDRINNFTCNCIPGMTGRICDID-IDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELN------------------IDECLSNPCT-------------------NGAKCLDRV---------------------KDYFCDCHNGYKGKNCEQDINECESNPCQYNG 908          

HSP 7 Score: 175.252 bits (443), Expect = 4.401e-43
Identity = 156/475 (32.84%), Postives = 206/475 (43.37%), Query Frame = 3
Query:  408 FCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKS-------------LEIHKYECQCPKNYLGMNCELP-NSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCK-AGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQD---YKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXX-XXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC-----EDRVGGFTCQCLQGFVGLRCE---TKSDICKQLTPCKTEE 1739
             CP     N C    C+NG  C    NG Y C+C  G+ G  C    + C + P  C N G CK   G+  C C   + G  C+   + C S PC NG  C +              +I+ YEC C   Y G NCE+  + CGS NPC  NG   +       C+C  G TG  C  DID+C       C NGG CI+ +G ++C C   G+ GE CE +I +C ++ C NG  CLD++  Y C C N Y G NCE     CE  PC+  G C +                  +               F +  ++++   Y+C+C  G  GK CE +I+ C    C   G+C + I    C C PGFEG +            PCQ    C D  +DY CDC     GKNC + +  C  NPCLNG  C      +    + C C  GF G +CE   T S +   L    TE 
Sbjct:  644 LCPENKVCNQCATQPCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDECTLHPKICGN-GICKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKLFFFKFGKHRILRQINAYECVCQPGYEGENCEVDIDECGS-NPCS-NGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDP---CLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCLDRVKDYFCDCHNGYKGKNCEQDINECESNPCQYNGNCLE----------------RSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQ-RGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEKTTTLSMVATSLISVTTER 1095          

HSP 8 Score: 161.77 bits (408), Expect = 4.909e-39
Identity = 179/623 (28.73%), Postives = 262/623 (42.05%), Query Frame = 3
Query: 2679 EINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLK-RPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMD---WCRGNPCGDFGVCET--DLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQ-SGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKM-----ECQNGG-ICK----------------NVIGDFECN--------CPKGFAGKLCETDIN-ECKYNIAGNATNLISNP------------HGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKF---------------------RKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLN--VCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVN-----GFGKAI---------CHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDL---ECNKYACGFDGGECLHRV 4271
             + DN C    C+GHG C     G+EC+C   Y G NC+     PC  NPC N GSC+     +N+ G Y C C    +G  CE +++    C+ NPC + G C       +  C+C   Y G RCE+  T+ C S             + C+++G+C +     GF C C  +GY G+FC+ N+D+C   PC+NGG C D  G Y C+C  G+ G  C      C +  C N G C+D+   F C+CP   +G  C+ I   C +      EC  G  +CK                +++    C          P+    K CE  ++  C+ +    A+ L   P             G CS  GT          HC C   ++G  CE + + C                         +    PC N G C++        N ++ C C  G+ G  C  +  +C L+  +C  NGIC+    +++ S+KC C PG  G+ C+ D V+ECLS  C N  +C N      FGK           C C  G  GE CE+    C      N  T  D I++   N C      +ICD+   +C    C  +GG+C+ ++
Sbjct:  263 RLPDNFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCL-----ENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEV-DTDECAS-------------QPCQNNGSCID--RINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICD-RPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQ-IAPSCAQQCPIDSECVGGKCVCKPGSSASDMEPLTPLELDILDATLCPSEKKKRYISPEWLKRKRCELKLSYNCQTSTGDGASALALTPINCNATNGKCLNGGTCSMNGT----------HCYCAVGYSGDRCE-KAENCSPLNCQEPMVCVQNQCLCPENKVCNQCATQPCQNGGECVDL------PNGDYECKCTRGWTGRTCGNDVDECTLHPKIC-GNGICK----NEKGSYKCYCTPGFTGVHCDSD-VDECLSFPCLNGATCHNKLFFFKFGKHRILRQINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCN-CIPGMTGRICDIDIDDCVGDPC-LNGGQCIDQL 837          

HSP 9 Score: 149.443 bits (376), Expect = 3.185e-35
Identity = 123/352 (34.94%), Postives = 168/352 (47.73%), Query Frame = 3
Query:  786 QNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCEN-KRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCP-EGLTGKNCEINIDECTP--NPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELS 1823
            Q+ C  +G C   +D E  C C  G+ G+ C  DIDEC + E   C N GTCIN V ++ C+C+ GF G+ CE +I +C +  C NGG C D I SY C CP +Y G  C+  K+  CE +PC+NG  C++                                 GF  S    ++ C C  GFEG +C+  I  C+   C NGG C+       C C  G+ G  CE ++NECE+ PCQN  +C DL   Y CDC   G  G  CE +IDEC    + C    RC ++ G F C C + + G  C   +D C     C     C+     +  Y C CP+G   +NC   ++
Sbjct: 1819 QSDCKNDGFCQSPSD-EYACTCQPGFEGDDCGTDIDECLNTE---CLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQN---------------------------------GFNASTG-NNFTCTCVPGFEGPLCD--IPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNF-TDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPIT 2129          

HSP 10 Score: 139.428 bits (350), Expect = 2.952e-32
Identity = 98/301 (32.56%), Postives = 141/301 (46.84%), Query Frame = 3
Query: 2502 CDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKR-PCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTE---------------------TCKSYAVEKFKNESLINK------ICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGM---YFCKCQPGFQGVNC 3311
            C + +D + C C  GF G+ C  +I+EC +  C N+  CI+ +  + C CQ GF G++CE N ++C +  C   G C D +  + C C E+Y+G  C+ LK+  C++ PC N  +C N         + C C  GF GP C+I   +C   PC + G+C T      CKC+  Y G  CE    E                      C+    E  + E+ I++       C   G CFN P  G F+C CQ  Y G++C       A+  C NGG C +  G    Y+C+C  GF G NC
Sbjct: 1828 CQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIP--FCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKP--GSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNC 2124          

HSP 11 Score: 137.502 bits (345), Expect = 1.203e-31
Identity = 112/341 (32.84%), Postives = 158/341 (46.33%), Query Frame = 3
Query: 1938 CFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCIN-----TNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQ-SGFSGKNCEINDNDCTESS--CLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCD-SNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKM 2933
            CF + C++   CQ   ++Y C C PGF+G  C  +I+EC +  C  NG CI++V  F CQC   + G  C   +D C    C+N   C   +   SY C+C      Y G +C+                   VL     +  PC N + C N     T  +F C C   +EG  C+  +  C   PC NG  C        C+C  G+TG  CE +INEC+ NPC N  +C D +  Y+C CQ +GF G  CE + ++C      C G G+C +K   F+C C + Y G  C +   PC+ ++ C N G C+     +  P Y C C  GF G  C   +
Sbjct: 1817 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCT--DLIASYVCDCPE---DYMGPQCD-------------------VLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCD--IPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYC-NFTDPCNATDLCSNGGRCVESCGAK--PDYYCECPEGFAGKNCTAPI 2128          

HSP 12 Score: 135.191 bits (339), Expect = 5.654e-31
Identity = 112/331 (33.84%), Postives = 153/331 (46.22%), Query Frame = 3
Query: 1821 SKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTC-ANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCV-AGFTGERCEIEINEC--QHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNG---FECKCNENYIGTNC 2792
            S CKN    +G C   ++E  C C PGFEG  C  +I+EC N  C +   C +    + C C PGF+G+ CE NI+ECA  PC   G C D +  + C C   Y GP C   K   C    C N + C  G    + +    T +  +EG  C  D+  C                    +I PC N   C+ T    +CKCS  Y GR CE+ +N C +NPC+NG  C +L   + C C   GF G RCE +I+EC  + + C    +C +    +QCICQ  + G  C   D       C   G+CV+       + C+C E + G NC
Sbjct: 1820 SDCKN----DGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLC--DIPFC--------------------EITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNC 2124          

HSP 13 Score: 130.183 bits (326), Expect = 2.069e-29
Identity = 121/364 (33.24%), Postives = 162/364 (44.51%), Query Frame = 3
Query:  303 QAGFGIYLILILSVLQLKQEKQMKLSIGAAILILLFCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQN-PCGVNGKCI----LANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYF-GTNCENKRTLCELKPCKNGGICRDFDE--DYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFC-ESVNYQ-DYKCICQRGFEGKMCETSI 1358
            +A  G  L+   S+ +L     + +   A   +    P    +  C    CKN   CQS  + +Y C C  G++G  C      C  T C N GTC        CQC   + G+ CE +   CA  PC NGG C  L I  Y C CP++Y+G  C++      +N PC     C      +      C C  G+ G  C  DI  C   E   C+NGG C+ T     CKC  G+ G  CE DI +C ++ C+NGG C D +G Y C C    F G  CEN    C ++    GG+ R F++   +QCIC   + G  C+        + C N G C ES   + DY C C  GF GK C   I
Sbjct: 1773 EARVGDLLLPYFSMAELYSRTNVSVQQKAQFRLNATRPEEGCI-LCFQSDCKNDGFCQSPSD-EYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDL-IASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLC--DIPFC---EITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPI 2128          

HSP 14 Score: 126.716 bits (317), Expect = 2.352e-28
Identity = 111/354 (31.36%), Postives = 144/354 (40.68%), Query Frame = 3
Query: 2940 CRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSN-------SCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKY-FTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFC 3977
            C  + C + G C++  D + C C   + G+ C     E               +N  C ++G C N  +   F C CQ G+ G  CE NID+CA QPC NGG C D    Y C C   + G  C V       N       +C  G      NNF+C C  G  G  C+  + +C+   C NGG+C        C C  G+ G+LCE DINEC+ N              PC   G  +C D  G + C C+   F G  CE  ID C      G+  C   G C NK         +F CIC   Y G  C         ++C N G C       +  + CECP G  G  C
Sbjct: 1817 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDE--------------CLNTECLNNGTCIN--QVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCD--IPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESN--------------PCQNGG--QCKDLVGRYECDCQGTGFEGIRCENDIDEC---NMEGDY-CGGLGRCFNKPG-------SFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVE-SCGAKPDYYCECPEGFAGKNC 2124          

HSP 15 Score: 119.783 bits (299), Expect = 2.699e-26
Identity = 107/382 (28.01%), Postives = 153/382 (40.05%), Query Frame = 3
Query: 1494 CQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCING-QCVDVNNEEKCICIPGFEGRTCEI-EINECFNNPCQHGSQCQDLFN-----DYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDN---LADGFRCRCVAGFTGERCEIEINECQHNPCSND 2609
            C+N+  C   +++Y C C  G  G +C  +IDEC    CLN   C ++V  F CQC  GF G                                        Q+C++ + +C +  C NG  C D+     C C   + G  C++ +   C N PC++GS CQ+ FN     ++ C C+PGF+G  C+I    C   PC   G C+       C+C L Y+G  C   ++ C  N C N   C   +    Y C+C      +EG +CE D+DECN++       G                  +C N  GSF C C   Y G  C         + C NG  C         + C C  GF G+ C   I   +  P + D
Sbjct: 1822 CKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEG----------------------------------------QHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIPF--CEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQC--KDLVGRYECDCQGT--GFEGIRCENDIDECNMEGDYCGGLG------------------RCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPITAKEDGPSTTD 2139          

HSP 16 Score: 114.775 bits (286), Expect = 1.073e-24
Identity = 109/346 (31.50%), Postives = 158/346 (45.66%), Query Frame = 3
Query: 3111 CKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDY-CKKMECQNGGICKNVI-----GDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICP-NGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTK-CYNNGSCVNGFGKA---ICHCNKGSCGEKCEITGSA 4112
            CK+ G C +  +   + C+CQ G+ G  C  +ID+C +  C+N G C +    +FC+CQPGF+G +C+ N +EC    C N G C D I ++ C CP    G  C+ +    C+   C+NG  C+N        +F C C  GF G LC  DI  C+                PC   G   CL       C C   +TG+ CE  I+ CE      + PC N G C    ++ VGR   + C C   G+ G RC+ +  +C +      G+ R F  +   SF+C C     G +C  ++ + C +T  C N G CV   G      C C +G  G+ C    +A
Sbjct: 1822 CKNDGFCQSPSDE--YACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLC--DIPFCEIT--------------PCDNGGL--CLTTGAVPMCKCSLGYTGRLCEQDINECE------SNPCQNGGQC----KDLVGR---YECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCF--NKPGSFQCICQKPYCGAYC--NFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPITA 2130          

HSP 17 Score: 112.849 bits (281), Expect = 3.311e-24
Identity = 91/291 (31.27%), Postives = 127/291 (43.64%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQK-SNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEF--SSNCASSPCRNGGICK----SLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCK-AGFNGERCENDIVDC----------------------------------------TNDTCKNGGTCLDKIGS---YRCVCPNNYFGTNCENKRTLCELKP 1148
            ++ C N +C N  TC + +   + C+C  G++G +CEQ    C   PC NGG C  +  + VC C  +++G  C+      C + PCRNG  C+    +   + + C C   + G  C++P       PC   G C L       C C+ GYTG  C  DI+EC   E+  C+NGG C + VG Y+C C+  GF G RCENDI +C                                          D C NGG C++  G+   Y C CP  + G NC    T  E  P
Sbjct: 1852 IDECLNTECLNNGTCINQV-AAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIPFC--EITPCDNGGLC-LTTGAVPMCKCSLGYTGRLCEQDINEC---ESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPITAKEDGP 2135          

HSP 18 Score: 108.997 bits (271), Expect = 6.072e-23
Identity = 95/303 (31.35%), Postives = 133/303 (43.89%), Query Frame = 3
Query: 3216 CASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGT---FHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECP-PGVGGLFCEIDYVNEC--LSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEIT 4103
            C    C N G C   +  Y C CQPGF+G +C  + +EC +  C N G CI+Q+  F C C  G  G+ CE  +D C    C NGG C ++I  + C+CP+ + G  C+                 ++  + PC    T +      T   F C+C   F G  C+  I +CE        PC N G+CL      +       C C  GY G  C+ +  +C+ N C+N G C+    D    ++C+C   G  G+ CE D ++EC      C   G C N  G   C C K  CG  C  T
Sbjct: 1817 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCD-------------VLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCD--IPFCEI------TPCDNGGLCLTTGAVPM-------CKCSLGYTGRLCEQDINECESNPCQNGGQCK----DLVGRYECDCQGTGFEGIRCEND-IDECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNFT 2086          

HSP 19 Score: 96.6709 bits (239), Expect = 3.214e-19
Identity = 83/266 (31.20%), Postives = 111/266 (41.73%), Query Frame = 3
Query: 3330 CYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCN-KGSCGEKCEITGSACNL 4121
            C+ + C N G C    + ++C C  G  G  C T +D C   EC N G C N +  F C C  GF G+ CE +I+EC      N  N                C D   ++ C C + + G  C+       K     N PC N   C N +    G   NF+C C  G+ G  C I    C++  C N G+C    +       C+C  G  G  CE D +NEC S  C N G C +  G+  C C   G  G +CE     CN+
Sbjct: 1817 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGN----------------CTDLIASYVCDCPEDYMGPQCDVL-----KQMTCENEPCRNGSTCQNGFNASTGN--NFTCTCVPGFEGPLCDI--PFCEITPCDNGGLC----LTTGAVPMCKCSLGYTGRLCEQD-INECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNM 2052          

HSP 20 Score: 85.5001 bits (210), Expect = 6.794e-16
Identity = 106/404 (26.24%), Postives = 148/404 (36.63%), Query Frame = 3
Query: 3354 GKCIDQINNFSCVCPRGVSGRFCETI-VDYCKKMECQNGGIC-KNVIGDFECNCPKGFAGKLCETDIN---ECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICP-NGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCI 4547
            G C      + C C    SG+ C+      C K  C+NGG C +N  GD++C C    +G+ CET++N    C+ N              PC   G    +   G   C C K + G  CE   D C       + PC NNG C+++          FSC C   GY G  C+ N  +C  N C N G C     D    + C+C  G GG  C  D    C + +C N G+C++      C C     GE C+I  S      ID         S+C   KC  K  +   D+E                 P  +D  D ++      C   K +      W   KRC+        L   ++C  + G             DG   L    + C+   G C+
Sbjct:  278 GTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTN--------------PCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDEC------ASQPCQNNGSCIDRING-------FSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRC----FDTYGWYTCQCLDGWGGEIC--DRPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPID---------SECVGGKCVCKPGSSASDME--------------PLTPLELDILDATL------CPSEKKKRYISPEWLKRKRCE--------LKLSYNCQTSTG-------------DGASALALTPINCNATNGKCL 598          

HSP 21 Score: 80.8777 bits (198), Expect = 1.991e-14
Identity = 99/382 (25.92%), Postives = 142/382 (37.17%), Query Frame = 3
Query: 3441 CKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKI-NSKKCQLNVCKNNGICR-PFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKC--ASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-----PLQSFCDKHYADGQCQLE--CNTMECSFDGGDCIES 4553
            C + +C+N G C++   ++ C C  GF G  C TDI+EC               +  C   GT  C+++   F C C+  F G++CE  ID C       + PC N G C +   + V       C CP  Y G +C +     C+   C+N   C+  F      +F C C PG  G  C+I +   C  T C N G C+      +C C+ G  G  CE                   +I++CE N C    +  + +   EC+    GF+G  C          NDI                              +CN E       D    +G+C       Q  C K Y    C     CN  +   +GG C+ES
Sbjct: 1817 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECL--------------NTECLNNGT--CINQVAAFFCQCQPGFEGQHCEQNIDEC------ADQPCHNGGNCTDLIASYV-------CDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIPF---CEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCE------------------QDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRC---------ENDID-----------------------------ECNMEG------DYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVES 2104          
BLAST of Neurogenic locus notch protein vs. Ensembl Zebrafish
Match: notch3 (notch receptor 3 [Source:ZFIN;Acc:ZDB-GENE-000329-5])

HSP 1 Score: 1009.98 bits (2610), Expect = 0.000e+0
Identity = 700/2003 (34.95%), Postives = 1005/2003 (50.17%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCR-GNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKK-------MECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCV--NGFGKAICHCNKGSCGEKCE-ITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSN--------RKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRN-IEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKL----LQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQH 6332
            ++ C  HKC N   C   +N  Y C+C   + G YC +  N C + P  C NGGTC    G + C C+N W G+ C E   +CA++ C NG  C    +  + C+CP    G+ C L ++C S NPC     C     +G   C C  G+ G  C+ D+DEC+    P CE+ G C+NT GS+QC+C  G+ G RCE DI +C +  C+N  TCLD+IG + C+C   Y G  CE     CE  PC N GICRD    + C C   +TG  C  D+               +  N   Y+C C  GFEG++CE++IDNC+   C +G +C++ I    CNC PG+ G  CE  +NEC + PCQN  KC+DL N Y C C  G +G NCEIN D+C  NPC  G  C+D +  + C C  GF G +C+ + D C Q  PC+    C++  N   G+ C CP+G  +  C  ++ +C +  C++G C D  N  +C C PG+ G+ C+++ N+C  +PCQ+   C D  N + C C  GF+G  C++NINECA +PC   G C+D V  F C C  PYSGPTCA  L PC+PN C N A C+    Y  Y CNC      ++G  C  D++EC  +                    PC N   C NT G ++C C + Y G  CE  +N+C  NPC NG +C +  + FRC C+ GFTG RC  E+NECQ  PC N   C D++N Y C C+ GF+G  CE N  DCTESSC   G C D +NGF+C C   + G  C++    CDS PCLN G C +   +     Y C+C +G+TGPRC+  +DWCR  NPC + G C     SF C C   + G  C+I    +C+  A ++ +     +++C H G+C N   T    C C + Y GS+CE   D C  +PC+NG  C    G + C C PG++G NC+   NEC S+ C N G CID + ++ C CP G  G  CE   D C          +CQN G C + +G + CNCP GF G+ CE DINEC  N              PC+P+ +L+C+  P  + C CK  FTG+ C++R   CE      + PC N G+C     +  G    +SC C  GY G  C+  S  C+   C N G C    +  R + +C C  G GG  C+    + C S  C+N G C     +    C C  G  G++CE  TGS+  L             S C +  C SKA++ +CD ECN   C +DGG+C   V            +PW+ C   +     C   FNN +CD  CN   CLFD +DC++    C P+ +++C  HYADG C   CNT EC +DG DC       +   +++++ +   E + R +T  LQ L+ +L + +R   + NG  M   IR +         ++R KR L+    Q   G+ VYLE+DN  C   S  CF N++SAAE++ A    +  R P PI  V +      +K EP    +  +     L+++GV    L   +        +K   + +W+PEG     + +S  N +  V  +        +   ++LL  H+      +  +  + K+     + D G +++ S + T +                    L+  D+ M  PP       M L  P+   ++ C +      V+  G   F+P       +++       L+  VT  D++++ +     + +   + +   T R   +GET LHLAA+Y R +AA+ LL+AG+D N  +  GRS L  A+ A A  V    +  +    DL  +  +GST LI A + A   +++ L+        D+N  DE G++ALHWAA          LL  G N+D QD +E TPL+LA +EG  E  K+L+A+ AN +++DH+DRLPRD+A+      IV LL++Y N  +  Q H
Sbjct:  213 VDDCPGHKCMNNGICVDGVN-TYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGGHTCVCVNGWTGDDCSENIDDCATAVCFNGATCHD-RVASFFCECPVGKTGLLCHLDDACVS-NPCNEGAVCDTNPLNGRAICTCPAGFVGGACNQDMDECSIGANP-CEHFGKCVNTEGSFQCQCGRGYTGPRCEIDINECLSMPCQNDATCLDRIGEFTCICMPGYQGKYCEVDIDECESNPCVNDGICRDMVNGFTCTCQPGFTGTMCQIDIDECASTPCQNGAKCIDRPN--GYECRCAEGFEGRLCESNIDNCKPDPCHHG-TCVDGIASYTCNCEPGYTGYRCENQLNECHSNPCQNGGKCVDLVNKYICQCQHGTSGTNCEINFDDCASNPCDYGI-CKDGINRYECVCKPGFTGPQCKDEIDEC-QSNPCRNGGTCVDDEN---GFHCQCPEGFHDPYCYSQVDECASNPCLHGTCRDDPNGYRCDCEPGWVGKNCDLDRNDCLPSPCQNAGTCFDQLNGFTCKCRQGFRGNLCQVNINECASSPCLNQGTCVDGVASFTCLCEPPYSGPTCAELLTPCSPNPCANHASCVHTPDYLGYQCNCQPG---WQGHLCNNDINECTSN--------------------PCKNRGTCTNTLGGYVCSCRAGYTGPNCETDINDCSPNPCLNGGSCTDGVNSFRCSCLPGFTGARCATELNECQSVPCKNGGTCTDYVNSYTCTCKPGFTGLLCETNVPDCTESSCFNGGTCTDGINGFKCTCRTGFTGDYCQYEVNECDSQPCLNGGICQDAMES-----YRCSCPKGYTGPRCQYPVDWCRPSNPCKNGGRCRQKDASFTCDCLGGWSGRYCDIPGV-SCEVAARQRGRQ---TDELCLHGGHCVNTGNT--HYCKCPADYTGSYCESQFDHCEEKPCLNGATCRSYMGGFTCDCMPGYEGNNCEREVNECQSHPCQNGGTCIDLVGHYICSCPPGTLGVLCEINEDDCATPSWPRGMPKCQNNGTCVDRVGGYRCNCPPGFTGERCEGDINECLSN--------------PCNPSNSLDCIQLPNDYQCVCKPGFTGRGCQSRFSVCE------SQPCKNGGVCSLSGSSPPG----YSCTCQLGYAGSNCE-RSMNCKELPCYNGGSC---TLTTRGA-RCTCIQGFGGPLCQHRSNDGCSSKPCHNGGLCTEETSYPFFHCQCTNGWKGKRCEQKTGSSAPLP------------SPCPIADCFSKANDGVCDKECNSLDCRWDGGDCSLAV------------NPWARCADPR-----CWRLFNNSQCDEFCNNAECLFDNFDCINKEKVCNPIYEAYCTDHYADGLCDQGCNTEECGWDGLDCARKIPEDLAEDMLVIVVLLPPEELLRTQTAFLQKLSAILRTTLRFRLDRNGDYM---IRPYT------GRETRIKRELN---PQEVIGSIVYLEIDNRLCSQGSDDCFRNADSAAEYLGALSAREMLRFPYPIKEVTS------EKREP---SITEIPEWARLLLVGVASLFLLVILMVGMLIARRKREHSTLWFPEGFFLKKETSSNKNRREPVGQDSLGMKHMPKTVEESLLADHSDQWIDTDCPEAKRLKVEEPSILSD-GEDAVDSRQWTQHH-------------------LAAADIRM--PPS------MALTPPQGEFDSDCMD------VNVRGPDGFTP-------LMLASFCGGGLEPEVTEDDDSDESSANIISDLIYQGASLAAQTDR---TGETALHLAARYARADAAKRLLDAGADANAQDNTGRSPLHAAVAADAQGVFQILIRNR--ATDLDARMYDGSTALILAARLAVEGMVEELITCHA----DVNAVDEIGKSALHWAAAVNNVEATIALLKNGANKDMQDLKEETPLFLAAREGSCEAVKVLLAHFANREITDHMDRLPRDIAQERMHHDIVQLLDEY-NTVRSPQGH 2039          

HSP 2 Score: 575.089 bits (1481), Expect = 1.170e-166
Identity = 460/1489 (30.89%), Postives = 652/1489 (43.79%), Query Frame = 3
Query:  675 PCRNGG----------------ICKSLE--------------------IHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIG--SYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMI----------------------------EGGKCN-----------CLPGFXXXX--XXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCING-QCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCI---------------------NRKVNQNTP--------------GYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKM-ECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNI--AGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNY--NFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLS-------TKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSAC---------NLASIDNSQTY-------------QDEISDCELNKCASKADNKICDLECNKYAC----GFDGGECLHRVPKR----IDGNDISIASPWSNCEIIKS--------------ENIPCH-------------------NWFNNKRCDPQCNTEACLFDGWDCMDAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCIESRN 4559
            PC NGG                +C+ L+                    I +Y C C + + G +C L ++C + +PC    +C   N+    C C  GY G  C NDIDEC   +   C NGG C+NT GS++C+C  G++G  CE     C    C NGGTC  + G  +Y C C   + G NCE+    C    C N GIC D    Y C C  +WTG+ C +DV          +NG         + C+C  G+ G  C  +ID+C    CFNG +C + +                            EG  C+           C  GF G     +++       PC++  KC++    + C C  G TG  CEI+I+EC   PC N A C DR+G FTC C+ G+ G  CE   D C+   PC  + IC ++ N   G+ C C  G     C+ ++ +C +  C NG +C+D  N  +C C  GFEGR CE  I+ C  +PC HG+ C D    Y C C PG+ G +CE  +NEC  NPC   G+C+D V  + CQC    SG  C    D C  N C +  IC  G   + Y C C      + G +C+ ++DEC                    Q  PC N   C++    F C+C   +    C   ++ C +NPC +G TC +  +G+RC C  G+ G+ C+++ N+C  +PC N   C D +N + C C+ GF G  C++N N+C  S CL  G CVD V  F C C   Y G  C  L  PC  NPC N  SC+                     N  +N+ T               GY+C+CR G+TGP CE  ++ C  NPC + G C   ++SF+C C   + G RC  +  E C+S               CK+ G C +      + C+C+ G+ G  CE N+ DC    C NGG C DG   + C C+ GF G  CQ   NEC S  C N G C D + ++ C CP+G +G  C+  VD+C+    C+NGG C+     F C+C  G++G+ C+     C+      G  T+ +    G C  TG         T +C C   +TG YCE++ D+CE+       PC N   C         R+Y   F+C C  GY G  C+    +CQ + C+N G C    ID    + C CPPG  G+ CEI+  ++C +        KC NNG+CV+  G   C+C  G  GE+CE   + C         +L  I     Y             Q   S CE   C +     +       Y+C    G+ G  C   +  +     +G   ++ +  + C  I+                + PCH                   N +  KRC+ +  + A L            CP+   C     DG C  ECN+++C +DGGDC  + N
Sbjct:   30 PCENGGMCIDSRCLCRPGYIGSLCQHLDPCHRSPCLNAAACKSQVANSIPQYTCVCQRGFRGQDCSLVDACAT-SPCANGARCTNWNN-HYNCSCPPGYQGKNCRNDIDEC--RKPGKCLNGGICMNTHGSFRCECLTGYSGRTCEVPTQPCAPSQCLNGGTC-HQTGDHTYECACLPGFRGHNCEDNVDDCPGHKCMNNGICVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGGHTCVCVNGWTGDDCSENIDDCATAVCFNGATCHDRVASFFCECPVGKTGLLCHLDDACVSNPCNEGAVCDTNPLNGRAICTCPAGFVGGACNQDMDECSIGANPCEHFGKCVNTEGSFQCQCGRGYTGPRCEIDINECLSMPCQNDATCLDRIGEFTCICMPGYQGKYCEVDIDECES-NPCVNDGICRDMVN---GFTCTCQPGFTGTMCQIDIDECASTPCQNGAKCIDRPNGYECRCAEGFEGRLCESNIDNCKPDPCHHGT-CVDGIASYTCNCEPGYTGYRCENQLNECHSNPCQNGGKCVDLVNKYICQCQHGTSGTNCEINFDDCASNPC-DYGICKDG--INRYECVCKPG---FTGPQCKDEIDEC--------------------QSNPCRNGGTCVDDENGFHCQCPEGFHDPYCYSQVDECASNPCLHG-TCRDDPNGYRCDCEPGWVGKNCDLDRNDCLPSPCQNAGTCFDQLNGFTCKCRQGFRGNLCQVNINECASSPCLNQGTCVDGVASFTCLCEPPYSGPTCAELLTPCSPNPCANHASCVHTPDYLGYQCNCQPGWQGHLCNNDINECTSNPCKNRGTCTNTLGGYVCSCRAGYTGPNCETDINDCSPNPCLNGGSCTDGVNSFRCSCLPGFTGARCATELNE-CQSVP-------------CKNGGTCTD--YVNSYTCTCKPGFTGLLCETNVPDCTESSCFNGGTCTDGINGFKCTCRTGFTGDYCQYEVNECDSQPCLNGGICQDAMESYRCSCPKGYTGPRCQYPVDWCRPSNPCKNGGRCRQKDASFTCDCLGGWSGRYCDIPGVSCEVAARQRGRQTDELCLHGGHCVNTGN--------THYCKCPADYTGSYCESQFDHCEE------KPCLNGATC---------RSYMGGFTCDCMPGYEGNNCEREVNECQSHPCQNGGTC----IDLVGHYICSCPPGTLGVLCEINE-DDCATPSWPRGMPKCQNNGTCVDRVGGYRCNCPPGFTGERCEGDINECLSNPCNPSNSLDCIQLPNDYQCVCKPGFTGRGCQSRFSVCESQPCKNGGVCSLSGSSPPGYSCTCQLGYAGSNCERSMNCKELPCYNGGSCTLTTRGARCTCIQGFGGPLCQHRSNDGCSSKPCHNGGLCTEETSYPFFHCQCTNGWKGKRCEQKTGSSAPL---------PSPCPIAD-CFSKANDGVCDKECNSLDCRWDGGDCSLAVN 1427          

HSP 3 Score: 490.73 bits (1262), Expect = 1.193e-139
Identity = 365/1137 (32.10%), Postives = 523/1137 (46.00%), Query Frame = 3
Query: 1023 TNDTCKNGGTCLDK--------IGS-----------------------------YRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGG-KCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPE----------------------------------------GLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCK---NIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLA--LYGLAVLS---------------MSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQL-NVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTK---------CYNNGSCVNGFGKAICHCNKGSCGEKCE 4097
            T+  C+NGG C+D         IGS                             Y CVC   + G +C +    C   PC NG  C +++  Y C C   + GKNC +D+    K   C N G C +  +  ++C C  G+ G+ CE     C    C NGG+C    +   +C CLPGF G+NCE NV++C    C NN  C+D  N Y C CP                                         G TG +C  NID+C    C NGA C DRV  F C+C  G  GL C    D C    PC    +C + N       C CP G     C +++ +C    N     G+CV+     +C C  G+ G  CEI+INEC + PCQ+ + C D   ++ CIC+PG++GK CE++I+EC  NPC  +G C D V GF C C   ++G  C   +D C    C N A CI  ++ + Y C C+     +EG  CE ++D C  D       + G+A  +               ++     PC N  +C++    +IC+C     G  CE   ++C +NPC  G  C +  + + C C  GFTG +C+ EI+ECQ NPC N   C+D  N + C C  GF    C    ++C  + CL HG C D  NG+ C C   ++G NC+  +  C  +PC N G+C + ++N    G+ C CR+GF G  C++ ++ C  +PC + G C   + SF C C   Y G  C    T    +               C +H +C + P+  G++C+CQ G+ G  C  +I++C S PC N G C +  G Y C C+ G+ G NC+ + N+C  N C N G C D +N+F C C  G +G  C T ++ C+ + C+NGG C + +  + C C  GF G LCET++ +C  +   N               GT  C D    F C+C+  FTG YC+  ++ C+      + PC N GIC +  +       ++ C CP GY G RC+     C+  N CKN G CR        SF C+C  G  G +C+I  V+  ++ +         C + G CVN      C C     G  CE
Sbjct:   27 THRPCENGGMCIDSRCLCRPGYIGSLCQHLDPCHRSPCLNAAACKSQVANSIPQYTCVCQRGFRGQDC-SLVDACATSPCANGARCTNWNNHYNCSCPPGYQGKNCRNDIDECRKPGKCLNGGICMNT-HGSFRCECLTGYSGRTCEVPTQPCAPSQCLNGGTCHQTGDHTYECACLPGFRGHNCEDNVDDCPGHKCMNNGICVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGGHTCVCVNGWTGDDCSENIDDCATAVCFNGATCHDRVASFFCECPVGKTGLLCHLD-DACVS-NPCNEGAVC-DTNPLNGRAICTCPAGFVGGACNQDMDECSIGANPCEHFGKCVNTEGSFQCQCGRGYTGPRCEIDINECLSMPCQNDATCLDRIGEFTCICMPGYQGKYCEVDIDECESNPCVNDGICRDMVNGFTCTCQPGFTGTMCQIDIDECASTPCQNGAKCI--DRPNGYECRCAEG---FEGRLCESNIDNCKPDPCHHGTCVDGIASYTCNCEPGYTGYRCENQLNECHSNPCQNGGKCVDLVNKYICQCQHGTSGTNCEINFDDCASNPCDYG-ICKDGINRYECVCKPGFTGPQCKDEIDECQSNPCRNGGTCVDDENGFHCQCPEGFHDPYCYSQVDECASNPCL-HGTCRDDPNGYRCDCEPGWVGKNCDLDRNDCLPSPCQNAGTCFD-QLN----GFTCKCRQGFRGNLCQVNINECASSPCLNQGTCVDGVASFTCLCEPPYSGPTCAELLTPCSPN--------------PCANHASCVHTPDYLGYQCNCQPGWQGHLCNNDINECTSNPCKNRGTCTNTLGGYVCSCRAGYTGPNCETDINDCSPNPCLNGGSCTDGVNSFRCSCLPGFTGARCATELNECQSVPCKNGGTCTDYVNSYTCTCKPGFTGLLCETNVPDCTESSCFNG--------------GT--CTDGINGFKCTCRTGFTGDYCQYEVNECD------SQPCLNGGICQDAME-------SYRCSCPKGYTGPRCQYPVDWCRPSNPCKNGGRCR----QKDASFTCDCLGGWSGRYCDIPGVSCEVAARQRGRQTDELCLHGGHCVNTGNTHYCKCPADYTGSYCE 1099          

HSP 4 Score: 467.233 bits (1201), Expect = 2.874e-132
Identity = 348/1016 (34.25%), Postives = 482/1016 (47.44%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCE-QKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCE-LPNSCGSQNPCGVNGKCI-LANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNP-NACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESS-------CLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPC--LNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDS---FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDD-CASQPCINGGECGDGTGMYF--CKCQPGFQGVNCQVNTNEC--YSNSCNTGKCIDQINNFSC 3389
            + ++ CE++ C N   C+  +NG + C C  G+ GT C+     C  TPCQNG  C        C+C   + G  CE +  NC   PC +G       I  Y C C   Y G  CE   N C S NPC   GKC+ L N  +  C C  G +G  C  + D+CAS       + G C + +  Y+C CK GF G +C+++I +C ++ C+NGGTC+D    + C CP  +    C ++   C   PC + G CRD    Y+C C   W GKNCD  +N C  +PC+N G C       + C C++GF G +C+ +I+ C    C N G+C++ +    C C P + G  C   +  C   PC N+A C+   +   Y C+C  G  G  C  +I+ECT NPC N   C + +GG+ C C  G+ G  CET  + C    PC     C +  N+   ++C C  G     C  EL++C+++ C N G C D  N   C C PGF G  CE  + +C  + C +G  C D  N + C C  GF G  C+  +NEC   PC   G C D +  +RC C   Y+GP C   +D C P N C N   C    K  S+ C+C   LG + G  C+     C +   Q       +          CL+   C+NT  +  CKC + Y G  CE   ++C   PC NGATC +   GF C C+ G+ G  CE E+NECQ +PC N   CID +  Y C C  G  G  CEIN++DC   S       C  +G CVD+V G+ C C   + G  CE     C SNPC   N   CI    +     Y C C+ GFTG  C+ +   C   PC + GVC     S   + C C   Y G  CE  ++  CK                C + G+C     T G +C+C  G+GG  C+   +D C+S+PC NGG C + T   F  C+C  G++G  C+  T       + C    C  + N+  C
Sbjct:  444 VDIDECESNPCVNDGICRDMVNG-FTCTCQPGFTGTMCQIDIDECASTPCQNGAKCIDRPNGYECRCAEGFEGRLCESNIDNCKPDPCHHGTCVDG--IASYTCNCEPGYTGYRCENQLNECHS-NPCQNGGKCVDLVN--KYICQCQHGTSGTNCEINFDDCASNPC----DYGICKDGINRYECVCKPGFTGPQCKDEIDECQSNPCRNGGTCVDDENGFHCQCPEGFHDPYCYSQVDECASNPCLH-GTCRDDPNGYRCDCEPGWVGKNCDLDRNDCLPSPCQNAGTCFD-QLNGFTCKCRQGFRGNLCQVNINECASSPCLNQGTCVDGVASFTCLCEPPYSGPTCAELLTPCSPNPCANHASCVHTPDYLGYQCNCQPGWQGHLCNNDINECTSNPCKNRGTCTNTLGGYVCSCRAGYTGPNCETDINDCSP-NPCLNGGSCTDGVNS---FRCSCLPGFTGARCATELNECQSVPCKNGGTCTDYVNSYTCTCKPGFTGLLCETNVPDCTESSCFNGGTCTDGINGFKCTCRTGFTGDYCQYEVNECDSQPCLNGGICQDAMESYRCSCPKGYTGPRCQYPVDWCRPSNPCKNGGRCR--QKDASFTCDC---LGGWSGRYCDIPGVSCEVAARQRGRQTDEL----------CLHGGHCVNTGNTHYCKCPADYTGSYCESQFDHCEEKPCLNGATCRSYMGGFTCDCMPGYEGNNCEREVNECQSHPCQNGGTCIDLVGHYICSCPPGTLGVLCEINEDDCATPSWPRGMPKCQNNGTCVDRVGGYRCNCPPGFTGERCEGDINECLSNPCNPSNSLDCIQLPND-----YQCVCKPGFTGRGCQSRFSVCESQPCKNGGVCSLSGSSPPGYSCTCQLGYAGSNCE--RSMNCKELP-------------CYNGGSCTL--TTRGARCTCIQGFGGPLCQHRSNDGCSSKPCHNGGLCTEETSYPFFHCQCTNGWKGKRCEQKTGSSAPLPSPCPIADCFSKANDGVC 1406          

HSP 5 Score: 433.721 bits (1114), Expect = 6.671e-122
Identity = 346/1079 (32.07%), Postives = 487/1079 (45.13%), Query Frame = 3
Query: 1488 KPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGG----FTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNI-VCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQC-QDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPC--NPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNS-----QIGP----CLNDNQCIN-------------TNGSFICKCSSQYEGRQCEKXXXXXXXXXX--XXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYAC----GFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCD---PQCNTEACLFDGWDCMDAIGQCPLQSFCDKHYADGQCQL---ECNTMECSFDGG---DCIESRNSTIPGG 4577
            +PC+N   CID      C C  G  G  C+ ++D C  +PCLN A C+ +V      +TC C +GF G  C +  D C   +PC     C N NN    Y C CP G Q  NC+ ++ +C+    C+NG  C++ +   +C C+ G+ GRTCE+    C  + C +G  C Q   + Y C CLPGF+G  CE N+++C  + C  NG C+D V  + CQC   ++G  CA  ++ C   PNAC+N   C   N    + C C   +  + G  C +++D+C    T +   G        S      +G     C  D+ C++              NG  IC C + + G  C + ++ C        +   C N    F+C+C  G+TG RCEI+INEC   PC NDA C+D I ++ CIC  G+ GK CE++ ++C  + C+  G C D VNGF C C   + GT C+     C S PC N   CI+R       GY C C  GF G  CE  +D C+ +PC   G C   + S+ C C   Y G RCE +  E   +      K   L+NK                + C CQ G  G+ CE+N DDCAS PC + G C DG   Y C C+PGF G  C+   +EC SN C N G C+D  N F C CP G    +C + VD C    C + G C++    + C+C  G+ GK C+ D N+C  +              PC   GT  C D+   F C C++ F G  C+  I+ C       + PC N G C++          +F+C+C   Y G  C      C  N C N+  C      D + ++C C PG  G  C  D +NEC S  C N G+C N  G  +C C  G  G  CE                   +I+DC  N C +      C    N + C    GF G  C   +    +   +   +  +  + + S    C   F    C+   P C TE+  F+G  C D I     +  C   +    CQ    EC++  C  +GG   D +ES   + P G
Sbjct:   29 RPCENGGMCIDSR----CLCRPGYIGSLCQ-HLDPCHRSPCLNAAACKSQVANSIPQYTCVCQRGFRGQDC-SLVDACA-TSPCANGARCTNWNNH---YNCSCPPGYQGKNCRNDIDECRKPGKCLNGGICMNTHGSFRCECLTGYSGRTCEVPTQPCAPSQCLNGGTCHQTGDHTYECACLPGFRGHNCEDNVDDCPGHKCMNNGICVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCF--NTIGGHTCVC---VNGWTGDDCSENIDDC---ATAVCFNGATCHDRVASFFCECPVGKTGLLCHLDDACVSNPCNEGAVCDTNPLNGRAICTCPAGFVGGACNQDMDECSIGANPCEHFGKCVNTEGSFQCQCGRGYTGPRCEIDINECLSMPCQNDATCLDRIGEFTCICMPGYQGKYCEVDIDECESNPCVNDGICRDMVNGFTCTCQPGFTGTMCQIDIDECASTPCQNGAKCIDRPN-----GYECRCAEGFEGRLCESNIDNCKPDPC-HHGTCVDGIASYTCNCEPGYTGYRCENQLNECHSNPCQNGGKCVDLVNK----------------YICQCQHGTSGTNCEINFDDCASNPC-DYGICKDGINRYECVCKPGFTGPQCKDEIDECQSNPCRNGGTCVDDENGFHCQCPEGFHDPYCYSQVDECASNPCLH-GTCRDDPNGYRCDCEPGWVGKNCDLDRNDCLPS--------------PCQNAGT--CFDQLNGFTCKCRQGFRGNLCQVNINEC------ASSPCLNQGTCVDGVA-------SFTCLCEPPYSGPTCAELLTPCSPNPCANHASC--VHTPDYLGYQCNCQPGWQGHLCNND-INECTSNPCKNRGTCTNTLGGYVCSCRAGYTGPNCET------------------DINDCSPNPCLNGGS---CTDGVNSFRCSCLPGFTGARCATEL---NECQSVPCKNGGTCTDYVNSYTCTCKPGFTGLLCETNVPDC-TESSCFNGGTCTDGING--FKCTCRTGFTGDYCQYEVNECDSQPC-LNGGICQDAMESYRCSCPKG 1005          

HSP 6 Score: 223.402 bits (568), Expect = 1.364e-57
Identity = 183/574 (31.88%), Postives = 241/574 (41.99%), Query Frame = 3
Query:  420 AISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQK-SNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELP-NSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDEC-------ASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKIS-------CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPC--QNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCE---DRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINE-CFNNPCQHGSQCQD--LFNDYLCICLPGFKGKKCEININECAHNP 2066
            A  LN C++  CKNG TC   +N  Y C C  G+ G  CE    +C  + C NGGTC        C C   + G++C++  N C S PC NGGIC+   +  Y C CPK Y G  C+ P + C   NPC   G+C    D    C C  G++G  C      C             LC +GG C+NT  ++ CKC A + G  CE+    C    C NG TC   +G + C C   Y G NCE +   C+  PC+NGG C D                                           Y C C  G  G +CE + D+C   S       C N G+C++ + G +CNC PGF G  CE ++NEC + PC   N+  CI L NDY C C  G TG+ C+     C   PC NG  C        G++C C  G+ G  CE +S  CK+L PC                                         G C       +C CI GF G  C+   N+ C + PC +G  C +   +  + C C  G+KGK+CE      A  P
Sbjct:  898 ATELNECQSVPCKNGGTCTDYVN-SYTCTCKPGFTGLLCETNVPDCTESSCFNGGTCTDGINGFKCTCRTGFTGDYCQYEVNECDSQPCLNGGICQD-AMESYRCSCPKGYTGPRCQYPVDWCRPSNPCKNGGRC-RQKDASFTCDCLGGWSGRYCDIPGVSCEVAARQRGRQTDELCLHGGHCVNTGNTHYCKCPADYTGSYCESQFDHCEEKPCLNGATCRSYMGGFTCDCMPGYEGNNCEREVNECQSHPCQNGGTCIDL---------------------------------------VGHYICSCPPGTLGVLCEINEDDCATPSWPRGMPKCQNNGTCVDRVGGYRCNCPPGFTGERCEGDINECLSNPCNPSNSLDCIQLPNDYQCVCKPGFTGRGCQSRFSVCESQPCKNGGVCSLSGSSPPGYSCTCQLGYAGSNCE-RSMNCKEL-PCYN--------------------------------------GGSCTLTTRGARCTCIQGFGGPLCQHRSNDGCSSKPCHNGGLCTEETSYPFFHCQCTNGWKGKRCEQKTGSSAPLP 1389          

HSP 7 Score: 218.009 bits (554), Expect = 6.798e-56
Identity = 187/606 (30.86%), Postives = 267/606 (44.06%), Query Frame = 3
Query: 2589 HNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNG----FECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRG-NPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECY--SNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETD-----------------------INECKYNIAGNATNL----ISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSAC------NLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRI 4283
            H PC N   CID     +C+C+ G+ G  C+  D  C  S CL    C  +V      + C C   + G +C  L   C ++PC N   C N   +     Y C+C  G+ G  C   +D CR    C + G+C     SF+C+C + Y G  CE+  T+ C         ++ L    C   G+         ++C+C  G+ G  CE N+DDC    C+N G C DG   Y C+C P + G  C  + NEC    N+C N G C + I   +CVC  G +G  C   +D C    C NG  C + +  F C CP G  G LC  D                       I  C     G A N      S    PC   G  +C++  G+F C C + +TG  CE  I+ C       ++PC N+  CL++    +G    F+CIC  GY G+ C+++  +C+ N C N+GICR    D    F C C PG  G  C+ID ++EC ST C N   C++      C C +G  G  CE     C      +   +D   +Y     +CE      + +N++   EC+   C  +GG+C+  V K I
Sbjct:   28 HRPCENGGMCIDS----RCLCRPGYIGSLCQHLD-PCHRSPCLNAAACKSQVANSIPQYTCVCQRGFRGQDCS-LVDACATSPCANGARCTNWNNH-----YNCSCPPGYQGKNCRNDIDECRKPGKCLNGGICMNTHGSFRCECLTGYSGRTCEVP-TQPCA-------PSQCLNGGTCHQTGD-------HTYECACLPGFRGHNCEDNVDDCPGHKCMNNGICVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGGHTCVCVNGWTGDDCSENIDDCATAVCFNGATCHDRVASFFCECPVGKTGLLCHLDDACVSNPCNEGAVCDTNPLNGRAICTCPAGFVGGACNQDMDECSIGANPCEHFG--KCVNTEGSFQCQCGRGYTGPRCEIDINECL------SMPCQNDATCLDR----IGE---FTCICMPGYQGKYCEVDIDECESNPCVNDGICR----DMVNGFTCTCQPGFTGTMCQID-IDECASTPCQNGAKCIDRPNGYECRCAEGFEGRLCESNIDNCKPDPCHHGTCVDGIASY---TCNCEPGYTGYRCENQL--NECHSNPCQ-NGGKCVDLVNKYI 581          
BLAST of Neurogenic locus notch protein vs. Ensembl Zebrafish
Match: notch1a (notch receptor 1a [Source:NCBI gene;Acc:30718])

HSP 1 Score: 992.26 bits (2564), Expect = 0.000e+0
Identity = 687/2005 (34.26%), Postives = 978/2005 (48.78%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCK--------KMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSC--VNGFGKAICHCNKGSCGEKCEITG-SACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIP-GGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIF----SIRVFAENSNSDSSK-----SRQKRSLSNSVQQGK---------PGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMN----FPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGL-GEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDY 6302
            ++ C  H C+NG  C   IN  Y C C   + G YC E    C ++P  CQNGGTC    G   C C+N W G+ C E   +CAS+ C +G  C    +  + C+CP    G+ C L ++C S NPC     C      G+  C C  GYTG+ C+ DIDEC+    P CE+GG C+NT GS+QCKC  G+ G RCE D+ +C ++ C+N  TCLD+IG + C+C   Y G  C+     C  +PC N G C D    + C C   ++G  C  DV               +  N   Y C C  GF G  CE  I+ C    C  G  C + +    C+C PG+ G  CE N+NEC ++PC+N   C D  N Y C CP+G TG NCEINID+C   PC  G +C D++ G+ C C  G+ G  C    D C  L PC     C++  N+   + C+CPDG ++  C  + ++C +  CI+G C+D  N  +C+C  G+ GR C+I INEC +NPC +G  C+D+ + YLC C  GF G  C++NINECA NPC   G CID+V GF+C CMLPY+G  C N L PC+P  C N  +C     + S+ CNC      ++G  CE D++EC  +                    PC N   C N  G F C+C+  + G  CE  +++C  NPC NG  C +  +GF C C+AGF GERC  +I+EC   PC N   C D +N Y C C +GFSG NCEIN  DCTESSC   G CVD ++ F C C   + G  C+H    CDS PC N GSC      Q+  G Y C C  G+TG  C+  + WC  +PC + G C     SF C+C S + G  C++       S  V   +    +  +C+H G C +   T    C CQ+GY GS+C+  +D+C   PC NG  C D  G Y C+C PG+ G+NC    NEC S  C N G CID +N + C CPRG  G  CE  +D C         +  C NGG C + +G + C CP GF G+ CE D+NEC  +              PC P+G+  C+     F C C+  +TGK CET  + C+      + PC N G C      + G    + C C  GY G  C+ +S+ C    C+N   C    +   +S +C C PG  G  C+    + CL   CYN G+C  ++      C C     G  C I   S       D +   + EI  CE+ +C  +  N ICD +CN +ACG+DGG+C            ++   PW NC    S  + C  +FN+ +CD QC T  CL+DG+DC    GQC PL   +C  HYADG C   CN  EC +DG DC +     +  G ++L++ +   E   R  +  L+ L+ LLH+ V   R++NG+ +IF    S    +++  SD +       R +RSL++ ++             G+ VYLE+DN  C   S  CF ++   A F+ A     +   P  I +V +       +  PP       + +  L +  + +  +   +  K     +K    ++W+PEG K              VN  +K+ +  +       +   ++ +  S  S  D      +   T+ R      +I E + +          L   D+ +N     PP+  ++     +  R  + +    IA+   SG GL  E    E      ++   +       ++T++                         +GET LHLAA+Y R +AA+ LLE+ +D N  +  GR+ L  A+ A A  V    +  +    DL  +  +G+T LI A + A   +++ L+        D N  D+ G++ALHWAA         +LL  G N+D Q+N+E TPL+LA +EG  E  K+L+ + AN D++DHLD+LPRD+A       IV LLE+Y
Sbjct:  257 VDDCTQHACENGGRCIDGIN-TYNCHCDKHWTGQYCTEDVDECELSPNACQNGGTCHNTIGGFHCVCVNGWTGDDCSENIDDCASAACSHGATCHD-RVASFFCECPHGRTGLLCHLDDACIS-NPCQKGSNCDTNPVSGKAICTCPPGYTGSACNQDIDECSLGANP-CEHGGRCLNTKGSFQCKCLQGYEGPRCEMDVNECKSNPCQNDATCLDQIGGFHCICMPGYEGVFCQINSDDCASQPCLNSGKCIDKINSFHCECPKGFSGSLCQVDVDECASTPCKNGAKCTDGPN--KYTCECTPGFSGIHCELDINECASSPCHYG-VCRDGVASFTCDCRPGYTGRLCETNINECLSQPCRNGGTCQDRENAYICTCPKGTTGVNCEINIDDCKRKPCDYG-KCIDKINGYECVCEPGYSGSMCNINIDDCA-LNPCHNGGTCIDGVNS---FTCLCPDGFRDATCLSQHNECSSNPCIHGSCLDQINSYRCVCEAGWMGRNCDININECLSNPCVNGGTCKDMTSGYLCTCRAGFSGPNCQMNINECASNPCLNQGSCIDDVAGFKCNCMLPYTGEVCENVLAPCSPRPCKNGGVCRESEDFQSFSCNCPAG---WQGQTCEVDINECVRN--------------------PCTNGGVCENLRGGFQCRCNPGFTGALCENDIDDCEPNPCSNGGVCQDRVNGFVCVCLAGFRGERCAEDIDECVSAPCRNGGNCTDCVNSYTCSCPAGFSGINCEINTPDCTESSCFNGGTCVDGISSFSCVCLPGFTGNYCQHDVNECDSRPCQNGGSC------QDGYGTYKCTCPHGYTGLNCQSLVRWCDSSPCKNGGSCWQQGASFTCQCASGWTGIYCDVPSV----SCEVAARQQGVSVAVLCRHAGQCVDAGNT--HLCRCQAGYTGSYCQEQVDECQPNPCQNGATCTDYLGGYSCECVPGYHGMNCSKEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEIDIDDCSPSVDPLTGEPRCFNGGRCVDRVGGYGCVCPAGFVGERCEGDVNECLSD--------------PCDPSGSYNCVQLINDFRCECRTGYTGKRCETVFNGCK------DTPCKNGGTCAVASNTKHG----YICKCQPGYSGSSCEYDSQSCGSLRCRNGATC----VSGHLSPRCLCAPGFSGHECQTRMDSPCLVNPCYNGGTCQPISDAPFYRCSCPANFNGLLCHILDYSFSGGQGRDIAPPVEVEIR-CEIAQCEGRGGNAICDTQCNNHACGWDGGDC-----------SLNFDDPWQNC----SAALQCWRYFNDGKCDEQCATAGCLYDGFDCQRLEGQCNPLYDQYCRDHYADGHCDQGCNNAECEWDGLDCADDVPQKLAVGSLVLVVHIPPDELRNR-SSSFLRELSSLLHTNVVFRRDANGEALIFPYYGSEHELSKHKRSDWTDPGQLMQRARRSLTSFLKPRTRRELDHMEVKGSIVYLEIDNRQCFQQSDECFQSATDVAAFLGALASSGNLNVPYIIEAVTS-------EGGPPKTGEMYPMFLVLLALAVLALAAIGVVVSRK-----RKREHGQLWFPEGFK--------------VNEPKKKRREPV-----GEDSVGLKPLKNSDSSLMDEQLSEWAEDDTNKRFRFEGQSILEMSGQLDHRQWTQQHLDAADLRLNSMAPTPPQGEIENDCMDVNVRGPDGFTPLMIAS--CSGGGLENENGEAEEDPSADVITDFIYHGANLHNQTDR-------------------------TGETALHLAARYARSDAAKRLLESCADANVQDNMGRTPLHAAVAADAQGVFQILIRNR--ATDLDARMHDGTTPLILATRLAVEGMVEELINCHA----DPNAVDDSGKSALHWAAAVNNVDAAVVLLKNGANKDLQNNKEETPLFLAAREGSYETAKVLLDHLANRDIADHLDQLPRDIAHERMHHDIVRLLEEY 2105          

HSP 2 Score: 627.091 bits (1616), Expect = 0.000e+0
Identity = 438/1313 (33.36%), Postives = 633/1313 (48.21%), Query Frame = 3
Query:  453 CKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCK-LIAGNNV---CQCLNEWVGEFCEFSSN--CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIG-SYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCID--LNNDYTCDCPEGLTGKNCEINIDECT--PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAV--------------------LSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCE-KFRKSG---NIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRV 4271
            C+NG  C+   +G+  C C   + G  C+  + C  +PC+NGG C+  + GN V   C C+  +    C    N  C +SPCRNGG C  L +  + C+C   + G  C+L + C S NPC   G+C  A +    C C   + G TC  D++ECA   +P C NGGTCIN VGSY C+C   + G  C+     C    C++GGTC+     ++ C C   + G  CE+    C    C+NGG C D    Y C C   WTG+ C +DV           NG         + C+C  G+ G  C  +ID+C   +C +G +C + +    C C P           + C + PCQ  + C    ++    C CP G TG  C  +IDEC+   NPC +G RC +  G F C+CLQG+ G RCE   + CK   PC+ +  CL   +   G+ CIC  G +   C+     C +  C+N G+C+D  N   C C  GF G  C+++++EC + PC++G++C D  N Y C C PGF G  CE++INECA +PC   G C D V  F C C   Y+G  C   ++ C    C N   C   ++ ++Y C C        G  CE ++D+C   + +   YG  +                    +++ +  + PC N   CI+   SF C C   +    C    N C +NPC +G+  D + + +RC C AG+ G  C+I INEC  NPC N   C D  + Y C C++GFSG NC++N N+C  + CL  G C+D V GF+C C   Y G  CE++  PC   PC N G C   + +++   + CNC  G+ G  CE+ ++ C  NPC + GVCE     F+C+CN  + G  CE    + C+                C + G C +     GF C C +G+ G  C  +ID+C S PC NGG C D    Y C C  GF G+NC++NT +C  +SC N G C+D I++FSCVC  G +G +C+  V+ C    CQNGG C++  G ++C CP G+ G  C++ +  C  +              PC   G+  C  +  +F C C   +TG YC+     CE   R+ G    + C + G C++     +       C C  GY G  C+    +CQ N C+N   C     D    + CEC PG  G+ C  + +NECLS  C N G+C++      C C +G+ G  CEI                       +++ C+   D    +  C      F+GG C+ RV
Sbjct:   29 CQNGGICEYKPSGEASCRCPADFVGAQCQFPNPCNPSPCRNGGVCRPQMQGNEVGVKCDCVLGFSDRLCLTPVNHACMNSPCRNGGTCSLLTLDTFTCRCQPGWSGKTCQLADPCAS-NPCANGGQCS-AFESHYICTCPPNFHGQTCRQDVNECAVSPSP-CRNGGTCINEVGSYLCRCPPEYTGPHCQRLYQPCLPSPCRSGGTCVQTSDTTHTCSCLPGFTGQTCEHNVDDCTQHACENGGRCIDGINTYNCHCDKHWTGQYCTEDVDECELSPNACQNGGTCHNTIGGFHCVCVNGWTGDDCSENIDDCASAACSHGATCHDRVASFFCEC-PHGRTGLLCHLDDACISNPCQKGSNCDTNPVSGKAICTCPPGYTGSACNQDIDECSLGANPCEHGGRCLNTKGSFQCKCLQGYEGPRCEMDVNECKS-NPCQNDATCL---DQIGGFHCICMPGYEGVFCQINSDDCASQPCLNSGKCIDKINSFHCECPKGFSGSLCQVDVDECASTPCKNGAKCTDGPNKYTCECTPGFSGIHCELDINECASSPCHY-GVCRDGVASFTCDCRPGYTGRLCETNINECLSQPCRNGGTCQ--DRENAYICTCPKGT---TGVNCEINIDDC---KRKPCDYGKCIDKINGYECVCEPGYSGSMCNINIDDCALNPCHNGGTCIDGVNSFTCLCPDGFRDATCLSQHNECSSNPCIHGSCLDQI-NSYRCVCEAGWMGRNCDININECLSNPCVNGGTCKDMTSGYLCTCRAGFSGPNCQMNINECASNPCLNQGSCIDDVAGFKCNCMLPYTGEVCENVLAPCSPRPCKNGGVC---RESEDFQSFSCNCPAGWQGQTCEVDINECVRNPCTNGGVCENLRGGFQCRCNPGFTGALCE-NDIDDCEP-------------NPCSNGGVCQD--RVNGFVCVCLAGFRGERCAEDIDECVSAPCRNGGNCTDCVNSYTCSCPAGFSGINCEINTPDCTESSCFNGGTCVDGISSFSCVCLPGFTGNYCQHDVNECDSRPCQNGGSCQDGYGTYKCTCPHGYTGLNCQSLVRWCDSS--------------PCKNGGS--CWQQGASFTCQCASGWTGIYCDVPSVSCEVAARQQGVSVAVLCRHAGQCVDAGNTHL-------CRCQAGYTGSYCQEQVDECQPNPCQNGATC----TDYLGGYSCECVPGYHGMNCSKE-INECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEI-----------------------DIDDCSPSVDPLTGEPRC------FNGGRCVDRV 1247          

HSP 3 Score: 464.151 bits (1193), Expect = 2.072e-131
Identity = 341/1028 (33.17%), Postives = 499/1028 (48.54%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKS-NCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELP-NSCGSQNPCGVNGKCILANDG--EVKCHCNKGYTGNTCSNDIDECASYETPLCENGGT-------------------------------------CINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCT--------ESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGS--CINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDS---FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDD-CASQPCINGGECG--DGTGMYFCKCQPGFQGVNCQV 3317
            + +N C+++ C+N ATC   I G + C C  GY+G +C+  S +C   PC N G C     +  C+C   + G  C+   + CAS+PC+NG  C     +KY C+C   + G++CEL  N C S +PC       +  DG     C C  GYTG  C  +I+EC S     C NGGT                                     CI+ +  Y+C C+ G++G  C  +I DC  + C NGGTC+D + S+ C+CP+ +    C ++   C   PC +G  C D    Y+C+C   W G+NCD   N C  NPC N G C+ +    Y C C+ GF G  C+ +I+ C    C N GSCI+ + G KCNC+  + G  CE  +  C  +PC+N   C +  +   ++C+CP G  G+ CE++I+EC  NPC NG  CE+  GGF C+C  GF G  CE   D C+   PC    +C +  N   G+ C+C  G   + C +++ +C +  C N G C D  N   C C  GF G  CEI   +C  + C +G  C D  + + C+CLPGF G  C+ ++NEC   PC   G C D    ++C C   Y+G  C + +  C+ + C N   C    +  S+ C C++    + G  C+     C +   Q  +  +AVL         C +  QC++   + +C+C + Y G  C++ ++ C+ NPC+NGATC +   G+ C CV G+ G  C  EINEC   PC N   CID +N Y+C C  G  G +CEI+ +DC+        E  C   G+CVD+V G+ C C   ++G  CE     C S+PC   GS  C+     Q    + C CR G+TG RCE   + C+  PC + G C    ++   + CKC   Y G  CE              + ++S  +  C++   C +   +   +C C  G+ G  C+  +D  C   PC NGG C        Y C C   F G+ C +
Sbjct:  450 MDVNECKSNPCQNDATCLDQIGG-FHCICMPGYEGVFCQINSDDCASQPCLNSGKCIDKINSFHCECPKGFSGSLCQVDVDECASTPCKNGAKCTDGP-NKYTCECTPGFSGIHCELDINECAS-SPCHYG----VCRDGVASFTCDCRPGYTGRLCETNINECLSQP---CRNGGTCQDRENAYICTCPKGTTGVNCEINIDDCKRKPCDYGKCIDKINGYECVCEPGYSGSMCNINIDDCALNPCHNGGTCIDGVNSFTCLCPDGFRDATCLSQHNECSSNPCIHGS-CLDQINSYRCVCEAGWMGRNCDININECLSNPCVNGGTCKDMT-SGYLCTCRAGFSGPNCQMNINECASNPCLNQGSCIDDVAGFKCNCMLPYTGEVCENVLAPCSPRPCKNGGVCRESEDFQSFSCNCPAGWQGQTCEVDINECVRNPCTNGGVCENLRGGFQCRCNPGFTGALCENDIDDCEP-NPCSNGGVCQDRVN---GFVCVCLAGFRGERCAEDIDECVSAPCRNGGNCTDCVNSYTCSCPAGFSGINCEINTPDCTESSCFNGGTCVDGISSFSCVCLPGFTGNYCQHDVNECDSRPCQNGGSCQDGYGTYKCTCPHGYTGLNCQSLVRWCDSSPCKNGGSCW--QQGASFTCQCASG---WTGIYCDVPSVSCEVAARQQGV-SVAVL---------CRHAGQCVDAGNTHLCRCQAGYTGSYCQEQVDECQPNPCQNGATCTDYLGGYSCECVPGYHGMNCSKEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEIDIDDCSPSVDPLTGEPRCFNGGRCVDRVGGYGCVCPAGFVGERCEGDVNECLSDPCDPSGSYNCV-----QLINDFRCECRTGYTGKRCETVFNGCKDTPCKNGGTCAVASNTKHGYICKCQPGYSGSSCE--------------YDSQSCGSLRCRNGATCVSGHLSP--RCLCAPGFSGHECQTRMDSPCLVNPCYNGGTCQPISDAPFYRCSCPANFNGLLCHI 1425          
BLAST of Neurogenic locus notch protein vs. Ensembl Zebrafish
Match: notch1b (notch receptor 1b [Source:ZFIN;Acc:ZDB-GENE-990415-183])

HSP 1 Score: 971.844 bits (2511), Expect = 0.000e+0
Identity = 679/2025 (33.53%), Postives = 977/2025 (48.25%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKM--------ECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSC--VNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIF------------SIRVFAENSNSDSSK--SRQKRSLSNSVQQGK-----------PGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRK-AEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNAS------SELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQHRPL 6341
            ++ C +H+C NG TC   +N  Y C+C   + G +C +  N C + P  CQNGGTC    G   C C+N W G+ C E   +CA + C  G  C    +  + C+CP    G+ C L ++C S NPC     C     +G+  C C  GY G  C  D+DEC+    P CE+ G CINT GS+QCKC  G+ G RCE DI +C +  C+N  TCLD+IG + C+C   Y G  C+     C   PC N G C D   +YQC C   ++G  C  D+               +  N   Y C C  G+ G+ CET +D C    C  G +C + +    C C  GF G  CEIN+NEC ++PCQN   C D  N Y C CP+G  G NCEIN+D+C  NPC  G RC D++ G+ C C  G+ G  C    D C  + PC     C++  N   G+ C+C +G  +  C+ +L++C +  CI+G C D  N   CIC  G+ G  C+I  NEC +NPC +G  C+D+ + Y+C C  GF G  C+ NINECA NPC   G CID+V G++C C+LPY+G  C   L PC    C N  +C     Y+S+ C C      ++G  CE D++EC  +                    PC ND  C N+ GS+ C C + Y GR CE  +++C+ NPC NG  C +  + F C C+ GF G RCE +INEC+ NPC N A C D +N Y C C  GFSG +CE N  DCTESSC   G CVD +N F C C + + G  C+H    CDS PC+N G+C      Q++ G Y C C +G+ G  C+  ++WC+ +PC + G+C      + C+C + + G  C++    +C+  A ++  +   + ++C++ G C +   T    C CQ+GY GS+CE  +D+C   PC NG  C D  G Y C+C PG+ GVNC    NEC S  C N G CID IN + C CPRG  G  CE  +D C           +C N G C + +G + C CP G+ G+ CE D+NEC  N                 P GT  C+     + C C+  +TG++C+   D C+        PC N G C        G    F C CP G+ G  C+ ++  C    CKN G C    +    S KC C P   G  C+      C +  CYN G+C  +       C C     G  C I   +    +  +          CE+ +C  K  NKICD  CN YAC +DGG+C            ++   PW NC    S  + C  +FNN +CD QC+   CL+DG+DC     QC PL   +C  H+ADG C   CN  EC +DG DC       +  G+++++     + +       L+ L+ +LH+ V   R+S GQ+MI+            +I+   +  N  SS   S  K S+ N V +G             G+ VYLE+DN  C   +  CF ++N AA F+ A     S + P  I +V +        P P         V    V + +    L  F+        K+ R+  ++W+PEG K    + S+   +  V  +    + L NC + S      +E G  +Q    +  + +       +     + T   ++  +    ++A +               PP+  ++     +  R  + +    IA+   SG GL   +  E  D    V           D   + A+L N+ +                +GET LHLAA+Y R +AA+ LLEA +D N  +  GR+ L  A+ A A  V    +  +    DL  +  +G+T LI A + A   +++ L+        D+N  D++G++ALHWAA         +LL  G N+D Q+N+E TPL+LA +EG  E  K+L+ + AN +++DH+DRLPRD+A+      IV L+++Y  +        PL
Sbjct:  209 IDDCPDHRCLNGGTCVDGVN-TYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGWTGDDCSENIDDCADAACHTGATCHD-RVASFLCECPHGRTGLLCHLDDACIS-NPCQKGSNCDTNPVNGKAICTCPLGYVGPACDQDVDECSLGANP-CEHAGKCINTKGSFQCKCLQGYVGARCELDINECLSTPCQNDATCLDQIGGFHCICMPGYEGVFCQINTDECASMPCLNNGKCIDKINNYQCECPTGFSGSQCQFDIDECASTPCKNGAKCMDGPNM--YTCQCTEGYTGQHCETDVDECLSNPCHYG-TCKDGLASFTCVCRAGFMGRLCEININECLSQPCQNGGTCQDRENAYLCVCPKGTAGANCEINLDDCQSNPCDFG-RCIDKINGYECACEPGYTGKMCNINIDECA-INPCHNGGTCVDGVN---GFTCLCREGYHDTTCQSQLNECLSNPCIHGHCEDKVNGYNCICDSGWSGVNCDINNNECESNPCMNGGTCKDMTSGYVCTCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGENCETLLAPCGSKPCKNGGVCKESEDYESFSCVCPAG---WQGQTCEVDINECVKN--------------------PCRNDAICQNSIGSYKCSCKAGYTGRNCETDIDDCKPNPCSNGGFCKDAVNAFACTCLPGFRGGRCEEDINECESNPCKNGANCTDCVNSYTCTCPPGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPKGFTGNYCQHDINECDSRPCMNGGTC------QDSYGTYKCTCPQGYHGLNCQELVNWCKPSPCKNGGICRQSGTRYSCQCQTGWTGLYCDVPSV-SCEVAAKQQGVD---VVRLCRNSGQCLDAGNT--HYCHCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSDEINECLSQPCQNGGTCIDLINTYKCSCPRGTQGVHCEINIDDCTPFTDPITHEPKCFNQGRCVDRVGGYHCICPPGYVGERCEGDVNECLSN-----------------PCGTHSCIQLKNNYRCECRTGYTGQHCDKVFDGCK------GKPCRNGGTCAVASNTPHG----FICKCPPGFTGSTCEYDAHACGSLQCKNGGTC----VSGHKSPKCLCTPAFTGPECQDPSGGHCTTNPCYNGGTCEYITEEPYYHCICPTNFNGLFCHILDWSFPGGTGQDITPAPKVSVSCEIEQCKVKKGNKICDSACNNYACDWDGGDC-----------SLNFNDPWKNC----SAALQCWRYFNNGKCDEQCHNTGCLYDGFDCQRVEAQCNPLYDQYCKDHFADGYCDQGCNNAECEWDGLDCANDTPEKLAAGLLVVVVHIHPDQLRNNSFGFLRELSRVLHTNVVFRRDSKGQEMIYPYYGNEQELKKHNIKRSLDGWNDASSDVLSSMKNSIYNIVVEGGRKRRELEKIQVKGSVVYLEIDNRQCYQQTSECFQSANDAAAFLGALASSGSLKMPYVIEAVTSE----IDGPSP---------VELYPVYVVLAGLALLAFVAIGMVASRKRRREHGQLWFPEGFK--TSEPSKKKRREPVGEDSVGLRPLKNCSDISLMDDNQNEWGEEEQSDSKRFRSEEQAMLDLDDQPDHRQWTQQHLDAADLRIPSIAPT---------------PPQGEIENDCMDVNARGPDGFTPLMIAS--CSGGGLETGNSEEEEDASANVIN---------DFIYQGANLHNQTD---------------RTGETALHLAARYARSDAAKRLLEASADANIQDNMGRTPLHAAVAADAQGVFQILIRNR--ATDLDARMHDGTTPLILAARLAVEGMVEELINCHA----DVNAIDDFGKSALHWAAAVNNVDAAMVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLEHFANREITDHMDRLPRDIAQDRMHHDIVRLIDEYNLVRSPPMHSAPL 2078          

HSP 2 Score: 460.685 bits (1184), Expect = 2.871e-130
Identity = 354/1025 (34.54%), Postives = 486/1025 (47.41%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDG--EVKCHCNKGYTGNTCSNDIDECASYETPLCENGGT-------------------------------------CINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCT--------ESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDS---FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCE-VNIDDCASQPCINGGECGDGT--GMYFCKCQPGFQGVNCQV 3317
            + +N C +  C+N ATC   I G + C C  GY+G +C+  ++ C   PC N G C     N  C+C   + G  C+F    CAS+PC+NG  C     + Y CQC + Y G +CE        NPC   G C    DG     C C  G+ G  C  +I+EC S     C+NGGT                                     CI+ +  Y+C C+ G+ G+ C  +I +C  + C NGGTC+D +  + C+C   Y  T C+++   C   PC +G  C D    Y CIC + W+G NCD   N C+ NPC N G C+ +    Y C C+ GF G  C+T+I+ C    C N G+CI+ + G KCNCL  + G NCE  +  C +KPC+N   C +  +   ++C CP G  G+ CE++I+EC  NPC N A C++ +G + C C  G+ G  CET  D CK   PC     C +  N    + C C  G +   C++++++C++  C NG  C D  N   C C PGF G  CE    +C  + C +G  C D  N + C+C  GF G  C+ +INEC   PC   G C D    ++C C   Y G  C   ++ C P+ C N  IC        Y C C T    + G  C+     C +   Q    G+ V+ +       C N  QC++   +  C C + Y G  CE+ ++ C  NPC+NGATC +   G+ C CV G+ G  C  EINEC   PC N   CID IN Y+C C  G  G +CEIN +DCT        E  C   G+CVD+V G+ C C   Y+G  CE     C SNPC    SCI  K N     Y C CR G+TG  C+   D C+G PC + G C    ++   F CKC   + G  CE      C S               CK+ G C +  ++   KC C   + G  C+  +   C + PC NGG C   T    Y C C   F G+ C +
Sbjct:  402 LDINECLSTPCQNDATCLDQIGG-FHCICMPGYEGVFCQINTDECASMPCLNNGKCIDKINNYQCECPTGFSGSQCQFDIDECASTPCKNGAKCMDGP-NMYTCQCTEGYTGQHCETDVDECLSNPCHY-GTC---KDGLASFTCVCRAGFMGRLCEININECLSQP---CQNGGTCQDRENAYLCVCPKGTAGANCEINLDDCQSNPCDFGRCIDKINGYECACEPGYTGKMCNINIDECAINPCHNGGTCVDGVNGFTCLCREGYHDTTCQSQLNECLSNPCIHGH-CEDKVNGYNCICDSGWSGVNCDINNNECESNPCMNGGTCKDMT-SGYVCTCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGENCETLLAPCGSKPCKNGGVCKESEDYESFSCVCPAGWQGQTCEVDINECVKNPCRNDAICQNSIGSYKCSCKAGYTGRNCETDIDDCKP-NPCSNGGFCKDAVNA---FACTCLPGFRGGRCEEDINECESNPCKNGANCTDCVNSYTCTCPPGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPKGFTGNYCQHDINECDSRPCMNGGTCQDSYGTYKCTCPQGYHGLNCQELVNWCKPSPCKNGGICRQSGT--RYSCQCQTG---WTGLYCDVPSVSCEVAAKQ---QGVDVVRL-------CRNSGQCLDAGNTHYCHCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSDEINECLSQPCQNGGTCIDLINTYKCSCPRGTQGVHCEINIDDCTPFTDPITHEPKCFNQGRCVDRVGGYHCICPPGYVGERCEGDVNECLSNPC-GTHSCIQLKNN-----YRCECRTGYTGQHCDKVFDGCKGKPCRNGGTCAVASNTPHGFICKCPPGFTGSTCEY-DAHACGSLQ-------------CKNGGTCVSGHKSP--KCLCTPAFTGPECQDPSGGHCTTNPCYNGGTCEYITEEPYYHCICPTNFNGLFCHI 1374          

HSP 3 Score: 377.096 bits (967), Expect = 1.681e-104
Identity = 297/863 (34.41%), Postives = 412/863 (47.74%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCE-QKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELP-NSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFD--EDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCIN-------------------------------------------------GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNP--------NACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATC---DNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCE-INDNDCTESSCLGHGQC--VDKVNGFECKCNENYIGTNCEHL 2801
            I++N C +  C+NG TCQ D    Y+C C  G  G  CE    +C   PC  G     I G   C C   + G+ C  +   CA +PC NGG C    ++ + C C + Y    C+   N C S NPC ++G C    +G   C C+ G++G  C  + +EC   E+  C NGGTC +    Y C C+AGF+G  C+ +I +C ++ C N GTC+D +  Y+C C   Y G NCE     C  KPCKNGG+C++ +  E + C+C   W G+ C+   N C  NPC+N+  C++ +   YKC C+ G+ G+ CET ID+C+   C NGG C + +    C CLPGF G  CE ++NECE+ PC+N A C D  N YTC CP G +G +CE N  +CT + C NG  C D +  FTC C +GF G  C+   + C    PC     C +   T   YKC CP G    NC++ ++ CK   C N                                                 GQC+D  N   C C  G+ G  CE +++EC  NPCQ+G+ C D    Y C C+PG+ G  C   INEC   PC   G CID +  ++C C     G  C   +D C P          C+N   C+  ++   YHC C      Y G +CE DV+EC                +SN    PC   + CI    ++ C+C + Y G+ C+K  + C+  PCRNG TC    N   GF C+C  GFTG  CE + + C    C N   C+      +C+C   F+G  C+  +   CT + C   G C  + +   + C C  N+ G  C  L
Sbjct:  553 ININECLSQPCQNGGTCQ-DRENAYLCVCPKGTAGANCEINLDDCQSNPCDFGRCIDKINGYE-CACEPGYTGKMCNINIDECAINPCHNGGTCVD-GVNGFTCLCREGYHDTTCQSQLNECLS-NPC-IHGHCEDKVNG-YNCICDSGWSGVNCDINNNEC---ESNPCMNGGTCKDMTSGYVCTCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGENCETLLAPCGSKPCKNGGVCKESEDYESFSCVCPAGWQGQTCEVDINECVKNPCRNDAICQN-SIGSYKCSCKAGYTGRNCETDIDDCKPNPCSNGGFCKDAVNAFACTCLPGFRGGRCEEDINECESNPCKNGANCTDCVNSYTCTCPPGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPKGFTGNYCQHDINECDS-RPCMNGGTCQDSYGT---YKCTCPQGYHGLNCQELVNWCKPSPCKNGGICRQSGTRYSCQCQTGWTGLYCDVPSVSCEVAAKQQGVDVVRLCRNSGQCLDAGNTHYCHCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSDEINECLSQPCQNGGTCIDLINTYKCSCPRGTQGVHCEINIDDCTPFTDPITHEPKCFNQGRCV--DRVGGYHCICPPG---YVGERCEGDVNEC----------------LSN----PC-GTHSCIQLKNNYRCECRTGYTGQHCDKVFDGCKGKPCRNGGTCAVASNTPHGFICKCPPGFTGSTCEYDAHACGSLQCKNGGTCVSGHKSPKCLCTPAFTGPECQDPSGGHCTTNPCYNGGTCEYITEEPYYHCICPTNFNGLFCHIL 1375          

HSP 4 Score: 212.231 bits (539), Expect = 3.111e-54
Identity = 180/585 (30.77%), Postives = 243/585 (41.54%), Query Frame = 3
Query:  408 FCPIAISLNFCENHKCKNGATCQSDIN-----------------GKYVCECAYGYKGTYCEQKS-NCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNC-ELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYE-------TPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKIS--------CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC---EDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCE-IEINECFNNPCQHGSQCQDLFND--YLCICLPGFKGKKCEI 2039
            FC  A++   C       G  C+ DIN                   Y C C  G+ G +CE  + +C  + C NGGTC     +  C C   + G +C+   N C S PC NGG C+      Y+C CP+ Y G+NC EL N C   +PC   G C  +      C C  G+TG  C      C             LC N G C++   ++ C C+AG+ G  CE  + +C  + C+NG TC D +G Y C C   Y G NC ++   C  +PC+NGG C D    Y+C                                        C RG +G  CE +ID+C   +        CFN G C++ + G  C C PG+ G  CE +VNEC + PC  ++ CI L N+Y C+C  G TG++C+   D C   PC NG  C    +   GF C+C  GF G  CE  +  C  L                                   +CKN     G CV  +   KC+C P F G  C+      C  NPC +G  C+ +  +  Y CIC   F G  C I
Sbjct:  872 FCKDAVNAFACTCLPGFRGGRCEEDINECESNPCKNGANCTDCVNSYTCTCPPGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPKGFTGNYCQHDINECDSRPCMNGGTCQD-SYGTYKCTCPQGYHGLNCQELVNWC-KPSPCKNGGICRQSGT-RYSCQCQTGWTGLYCDVPSVSCEVAAKQQGVDVVRLCRNSGQCLDAGNTHYCHCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSDEINECLSQPCQNGGTCIDLINTYKC---------------------------------------SCPRGTQGVHCEINIDDCTPFTDPITHEPKCFNQGRCVDRVGGYHCICPPGYVGERCEGDVNECLSNPCGTHS-CIQLKNNYRCECRTGYTGQHCDKVFDGCKGKPCRNGGTCAVASNTPHGFICKCPPGFTGSTCEYDAHACGSL-----------------------------------QCKN----GGTCVSGHKSPKCLCTPAFTGPECQDPSGGHCTTNPCYNGGTCEYITEEPYYHCICPTNFNGLFCHI 1374          
BLAST of Neurogenic locus notch protein vs. Ensembl Zebrafish
Match: notch3 (notch receptor 3 [Source:ZFIN;Acc:ZDB-GENE-000329-5])

HSP 1 Score: 910.212 bits (2351), Expect = 0.000e+0
Identity = 687/2070 (33.19%), Postives = 982/2070 (47.44%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDG--EVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFG---------------------TNCENKRTLCE--------------------LKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLAD---------------------------GFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCR-GNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKM-------ECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCV--NGFGKAICHCNKGSCGEKCE-ITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSN--------RKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRN-IEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKL----LQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQH 6332
            ++ C    C NGA C ++ N  Y C C  GY+G  C    +    P  C NGG C    G+  C+CL  + G  CE  +  CA S C NGG C     H YEC C   + G NCE        + C  NG C+   DG     C C   +TG  C+ D++EC   +   C NGGTC NT+G + C C  G+ G+ C  +I DC    C NG TC D++ S+ C CP    G                     TN  N R +C                       PC++ G C + +  +QC CG  +TG  C+   N C   PC+N+  C      ++ CIC  G++GK CE  ID C+   C N G C +M+ G  C C PGF G  C+I+++EC + PCQN AKCID  N Y C C EG  G+ CE NID C P+PC +G  C D +  +TC C  G+ G RCE + + C    PC+    C+++ N    Y C C  G    NC+     C +  C  G C D  N  +C+C PGF G  C+ EI+EC +NPC++G  C D  N + C C  GF    C   ++ECA NPC L+G C D+  G+RC C   + G  C    + C P+ C N   C   ++ + + C C      + G+ C+ +++EC                       PCLN   C++   SF C C   Y G  C + L  C  NPC N A+C +  D                            FRC C+ GFTG RC  E+NECQ  PC N   C D++N Y C C+ GF+G  CE N  DCTESSC   G C D +NGF+C C   + G  C++    CDS PCLN G C +   +     Y C+C +G+TGPRC+  +DWCR  NPC + G C     SF C C   + G  C+I    +C+  A ++ +     +++C H G+C N   T    C C + Y GS+CE   D C  +PC+NG  C    G + C C PG++G NC+   NEC S+ C N G CID + ++ C CP G  G  CE   D C          +CQN G C + +G + CNCP GF G+ CE DINEC  N              PC+P+ +L+C+  P  + C CK  FTG+ C++R   CE      + PC N G+C     +  G    +SC C  GY G  C+  S  C+   C N G C    +  R + +C C  G GG  C+    + C S  C+N G C     +    C C  G  G++CE  TGS+  L S             C +  C SKA++ +CD ECN   C +DGG+C   V            +PW+ C   +     C   FNN +CD  CN   CLFD +DC++    C P+ +++C  HYADG C   CNT EC +DG DC       +   +++++ +   E + R +T  LQ L+ +L + +R   + NG  M   IR +         ++R KR L+    Q   G+ VYLE+DN  C   S  CF N++SAAE++ A    +  R P PI  V +      +K EP    +  +     L+++GV    L   +        +K   + +W+PEG     + +S  N +  V  +        +   ++LL  H+      +  +  + K+     + D G +++ S + T +                    L+  D+ M  PP       M L  P+   ++ C +      V+  G   F+P       +++       L+  VT  D++++ +     + +   + +   T R   +GET LHLAA+Y R +AA+ LL+AG+D N  +  GRS L  A+ A A  V    +  +    DL  +  +GST LI A + A   +++ L+        D+N  DE G++ALHWAA          LL  G N+D QD +E TPL+LA +EG  E  K+L+A+ AN +++DH+DRLPRD+A+      IV LL++Y N  +  Q H
Sbjct:   97 VDACATSPCANGARC-TNWNNHYNCSCPPGYQGKNCRNDIDECRKPGKCLNGGICMNTHGSFRCECLTGYSGRTCEVPTQPCAPSQCLNGGTCHQTGDHTYECACLPGFRGHNCEDNVDDCPGHKCMNNGICV---DGVNTYNCQCPPEWTGQYCAEDVNECL-MQPNACHNGGTCFNTIGGHTCVCVNGWTGDDCSENIDDCATAVCFNGATCHDRVASFFCECPVGKTGLLCHLDDACVSNPCNEGAVCDTNPLNGRAICTCPAGFVGGACNQDMDECSIGANPCEHFGKCVNTEGSFQCQCGRGYTGPRCEIDINECLSMPCQNDATCLD-RIGEFTCICMPGYQGKYCEVDIDECESNPCVNDGICRDMVNGFTCTCQPGFTGTMCQIDIDECASTPCQNGAKCIDRPNGYECRCAEGFEGRLCESNIDNCKPDPCHHGT-CVDGIASYTCNCEPGYTGYRCENQLNECHS-NPCQNGGKCVDLVNK---YICQCQHGTSGTNCEINFDDCASNPCDYGICKDGINRYECVCKPGFTGPQCKDEIDECQSNPCRNGGTCVDDENGFHCQCPEGFHDPYCYSQVDECASNPC-LHGTCRDDPNGYRCDCEPGWVGKNCDLDRNDCLPSPCQNAGTCF--DQLNGFTCKCRQG---FRGNLCQVNINEC--------------------ASSPCLNQGTCVDGVASFTCLCEPPYSGPTCAELLTPCSPNPCANHASCVHTPDYLGYQCNCQPGWQDPCLNGGSCTDGVNSFRCSCLPGFTGARCATELNECQSVPCKNGGTCTDYVNSYTCTCKPGFTGLLCETNVPDCTESSCFNGGTCTDGINGFKCTCRTGFTGDYCQYEVNECDSQPCLNGGICQDAMES-----YRCSCPKGYTGPRCQYPVDWCRPSNPCKNGGRCRQKDASFTCDCLGGWSGRYCDIPGV-SCEVAARQRGRQ---TDELCLHGGHCVNTGNT--HYCKCPADYTGSYCESQFDHCEEKPCLNGATCRSYMGGFTCDCMPGYEGNNCEREVNECQSHPCQNGGTCIDLVGHYICSCPPGTLGVLCEINEDDCATPSWPRGMPKCQNNGTCVDRVGGYRCNCPPGFTGERCEGDINECLSN--------------PCNPSNSLDCIQLPNDYQCVCKPGFTGRGCQSRFSVCE------SQPCKNGGVCSLSGSSPPG----YSCTCQLGYAGSNCE-RSMNCKELPCYNGGSC---TLTTRGA-RCTCIQGFGGPLCQHRSNDGCSSKPCHNGGLCTEETSYPFFHCQCTNGWKGKRCEQKTGSSAPLPS------------PCPIADCFSKANDGVCDKECNSLDCRWDGGDCSLAV------------NPWARCADPR-----CWRLFNNSQCDEFCNNAECLFDNFDCINKEKVCNPIYEAYCTDHYADGLCDQGCNTEECGWDGLDCARKIPEDLAEDMLVIVVLLPPEELLRTQTAFLQKLSAILRTTLRFRLDRNGDYM---IRPYT------GRETRIKRELN---PQEVIGSIVYLEIDNRLCSQGSDDCFRNADSAAEYLGALSAREMLRFPYPIKEVTS------EKREP---SITEIPEWARLLLVGVASLFLLVILMVGMLIARRKREHSTLWFPEGFFLKKETSSNKNRREPVGQDSLGMKHMPKTVEESLLADHSDQWIDTDCPEAKRLKVEEPSILSD-GEDAVDSRQWTQHH-------------------LAAADIRM--PPS------MALTPPQGEFDSDCMD------VNVRGPDGFTP-------LMLASFCGGGLEPEVTEDDDSDESSANIISDLIYQGASLAAQTDR---TGETALHLAARYARADAAKRLLDAGADANAQDNTGRSPLHAAVAADAQGVFQILIRNR--ATDLDARMYDGSTALILAARLAVEGMVEELITCHA----DVNAVDEIGKSALHWAAAVNNVEATIALLKNGANKDMQDLKEETPLFLAAREGSCEAVKVLLAHFANREITDHMDRLPRDIAQERMHHDIVQLLDEY-NTVRSPQGH 1988          

HSP 2 Score: 560.836 bits (1444), Expect = 3.173e-162
Identity = 450/1454 (30.95%), Postives = 640/1454 (44.02%), Query Frame = 3
Query:  675 PCRNGG----------------ICKSLE--------------------IHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIG--SYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMI----------------------------EGGKCN-----------CLPGFXXXX--XXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCING-QCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKM-ECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNI--AGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNY--NFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLS-------TKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSAC---------NLASIDNSQTY-------------QDEISDCELNKCASKADNKICDLECNKYAC----GFDGGECLHRVPKR----IDGNDISIASPWSNCEIIKS--------------ENIPCH-------------------NWFNNKRCDPQCNTEACLFDGWDCMDAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCIESRN 4559
            PC NGG                +C+ L+                    I +Y C C + + G +C L ++C + +PC    +C   N+    C C  GY G  C NDIDEC   +   C NGG C+NT GS++C+C  G++G  CE     C    C NGGTC  + G  +Y C C   + G NCE+    C    C N GIC D    Y C C  +WTG+ C +DV          +NG         + C+C  G+ G  C  +ID+C    CFNG +C + +                            EG  C+           C  GF G     +++       PC++  KC++    + C C  G TG  CEI+I+EC   PC N A C DR+G FTC C+ G+ G  CE   D C+   PC  + IC ++ N   G+ C C  G     C+ ++ +C +  C NG +C+D  N  +C C  GFEGR CE  I+ C  +PC HG+ C D    Y C C PG+ G +CE  +NEC  NPC   G+C+D V  + CQC    SG  C    D C  N C +  IC  G   + Y C C      + G +C+ ++DEC                    Q  PC N   C++    F C+C   +    C   ++ C +NPC +G TC +  +G+RC C  G+ G+ C+++ N+C  +PC N   C D +N + C C+ GF G  C++N N+C  S CL  G CVD V  F C C   Y G  C  L  PC  NPC N  SC++     +  GY CNC+ G+              +PC + G C   ++SF+C C   + G RC  +  E C+S               CK+ G C +      + C+C+ G+ G  CE N+ DC    C NGG C DG   + C C+ GF G  CQ   NEC S  C N G C D + ++ C CP+G +G  C+  VD+C+    C+NGG C+     F C+C  G++G+ C+     C+      G  T+ +    G C  TG         T +C C   +TG YCE++ D+CE+       PC N   C         R+Y   F+C C  GY G  C+    +CQ + C+N G C    ID    + C CPPG  G+ CEI+  ++C +        KC NNG+CV+  G   C+C  G  GE+CE   + C         +L  I     Y             Q   S CE   C +     +       Y+C    G+ G  C   +  +     +G   ++ +  + C  I+                + PCH                   N +  KRC+ +  + A L            CP+   C     DG C  ECN+++C +DGGDC  + N
Sbjct:   30 PCENGGMCIDSRCLCRPGYIGSLCQHLDPCHRSPCLNAAACKSQVANSIPQYTCVCQRGFRGQDCSLVDACAT-SPCANGARCTNWNN-HYNCSCPPGYQGKNCRNDIDEC--RKPGKCLNGGICMNTHGSFRCECLTGYSGRTCEVPTQPCAPSQCLNGGTC-HQTGDHTYECACLPGFRGHNCEDNVDDCPGHKCMNNGICVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGGHTCVCVNGWTGDDCSENIDDCATAVCFNGATCHDRVASFFCECPVGKTGLLCHLDDACVSNPCNEGAVCDTNPLNGRAICTCPAGFVGGACNQDMDECSIGANPCEHFGKCVNTEGSFQCQCGRGYTGPRCEIDINECLSMPCQNDATCLDRIGEFTCICMPGYQGKYCEVDIDECES-NPCVNDGICRDMVN---GFTCTCQPGFTGTMCQIDIDECASTPCQNGAKCIDRPNGYECRCAEGFEGRLCESNIDNCKPDPCHHGT-CVDGIASYTCNCEPGYTGYRCENQLNECHSNPCQNGGKCVDLVNKYICQCQHGTSGTNCEINFDDCASNPC-DYGICKDG--INRYECVCKPG---FTGPQCKDEIDEC--------------------QSNPCRNGGTCVDDENGFHCQCPEGFHDPYCYSQVDECASNPCLHG-TCRDDPNGYRCDCEPGWVGKNCDLDRNDCLPSPCQNAGTCFDQLNGFTCKCRQGFRGNLCQVNINECASSPCLNQGTCVDGVASFTCLCEPPYSGPTCAELLTPCSPNPCANHASCVH---TPDYLGYQCNCQPGWQ-------------DPCLNGGSCTDGVNSFRCSCLPGFTGARCATELNE-CQSVP-------------CKNGGTCTD--YVNSYTCTCKPGFTGLLCETNVPDCTESSCFNGGTCTDGINGFKCTCRTGFTGDYCQYEVNECDSQPCLNGGICQDAMESYRCSCPKGYTGPRCQYPVDWCRPSNPCKNGGRCRQKDASFTCDCLGGWSGRYCDIPGVSCEVAARQRGRQTDELCLHGGHCVNTGN--------THYCKCPADYTGSYCESQFDHCEE------KPCLNGATC---------RSYMGGFTCDCMPGYEGNNCEREVNECQSHPCQNGGTC----IDLVGHYICSCPPGTLGVLCEINE-DDCATPSWPRGMPKCQNNGTCVDRVGGYRCNCPPGFTGERCEGDINECLSNPCNPSNSLDCIQLPNDYQCVCKPGFTGRGCQSRFSVCESQPCKNGGVCSLSGSSPPGYSCTCQLGYAGSNCERSMNCKELPCYNGGSCTLTTRGARCTCIQGFGGPLCQHRSNDGCSSKPCHNGGLCTEETSYPFFHCQCTNGWKGKRCEQKTGSSAPL---------PSPCPIAD-CFSKANDGVCDKECNSLDCRWDGGDCSLAVN 1376          

HSP 3 Score: 446.817 bits (1148), Expect = 4.911e-126
Identity = 346/1122 (30.84%), Postives = 493/1122 (43.94%), Query Frame = 3
Query: 1098 YFGTNCENKRTLCELKPCKNGGICRDFD-------------------------------------EDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKIS-CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDL-NNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDIC-KQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCING---------------------------QCVD-------------VNNEEKCICIPGFEGRTCEIEINECF--NNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC----------------------------NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQL-NVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTK---------CYNNGSCVNGFGKAICHCNKGSCGEKCE 4097
            Y   N E    +   +PC+NGG+C D                                         Y C+C   + G++C  V + C  +PC N   C + N   Y C C  G++GK C   ID C+K   C NGG C+N     +C CL G+ G  CE+    C    C N   C    ++ Y C C  G  G NCE N+D+C  + C+N   C D V  + CQC   + G  C    + C  Q   C     C    NT  G+ C+C +G    +C + +  C   VC NG                            CV              +N    C C  GF G  C  +++EC    NPC+H  +C +    + C C  G+ G +CEI+INEC   PC  +  C+D +  F C CM  Y G  C   +D C  N C ND IC   +  + + C C      + G+ C+ D+DEC                       PC N  +CI+    + C+C+  +EGR CE  ++NC+ +PC +G   D +A  + C C  G+TG RCE ++NEC  NPC N  KC+D +N Y C CQ G SG NCEIN +DC  + C  +G C D +N +EC C   + G  C+     C SNPC N G+C++ +      G+ C C  GF  P C  ++D C  NPC   G C  D + ++C C   ++G+ C++ + +   S               C++ G CF+  +  GF C C+ G+ G+ C+VNI++CAS PC+N G C DG   + C C+P + G  C      C  N C                            N G C D +N+F C C  G +G  C T ++ C+ + C+NGG C + +  + C C  GF G LCET++ +C  +   N               GT  C D    F C+C+  FTG YC+  ++ C+      + PC N GIC +  +       ++ C CP GY G RC+     C+  N CKN G CR        SF C+C  G  G +C+I  V+  ++ +         C + G CVN      C C     G  CE
Sbjct:   14 YLVHNSEGLLCVDTHRPCENGGMCIDSRCLCRPGYIGSLCQHLDPCHRSPCLNAAACKSQVANSIPQYTCVCQRGFRGQDCSLV-DACATSPCANGARCTNWN-NHYNCSCPPGYQGKNCRNDIDECRKPGKCLNGGICMNTHGSFRCECLTGYSGRTCEVPTQPCAPSQCLNGGTCHQTGDHTYECACLPGFRGHNCEDNVDDCPGHKCMNNGICVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCF---NTIGGHTCVCVNGWTGDDCSENIDDCATAVCFNGATCHDRVASFFCECPVGKTGLLCHLDDACVSNPCNEGAVCDTNPLNGRAICTCPAGFVGGACNQDMDECSIGANPCEHFGKCVNTEGSFQCQCGRGYTGPRCEIDINECLSMPCQNDATCLDRIGEFTCICMPGYQGKYCEVDIDECESNPCVNDGICR--DMVNGFTCTCQPG---FTGTMCQIDIDEC--------------------ASTPCQNGAKCIDRPNGYECRCAEGFEGRLCESNIDNCKPDPCHHGTCVDGIAS-YTCNCEPGYTGYRCENQLNECHSNPCQNGGKCVDLVNKYICQCQHGTSGTNCEINFDDCASNPC-DYGICKDGINRYECVCKPGFTGPQCKDEIDECQSNPCRNGGTCVDDEN-----GFHCQCPEGFHDPYCYSQVDECASNPC-LHGTCRDDPNGYRCDCEPGWVGKNCDLDRNDCLPS--------------PCQNAGTCFD--QLNGFTCKCRQGFRGNLCQVNINECASSPCLNQGTCVDGVASFTCLCEPPYSGPTCAELLTPCSPNPCANHASCVHTPDYLGYQCNCQPGWQDPCLNGGSCTDGVNSFRCSCLPGFTGARCATELNECQSVPCKNGGTCTDYVNSYTCTCKPGFTGLLCETNVPDCTESSCFNG--------------GT--CTDGINGFKCTCRTGFTGDYCQYEVNECD------SQPCLNGGICQDAME-------SYRCSCPKGYTGPRCQYPVDWCRPSNPCKNGGRCR----QKDASFTCDCLGGWSGRYCDIPGVSCEVAARQRGRQTDELCLHGGHCVNTGNTHYCKCPADYTGSYCE 1048          

HSP 4 Score: 419.853 bits (1078), Expect = 1.191e-117
Identity = 315/997 (31.59%), Postives = 462/997 (46.34%), Query Frame = 3
Query: 1488 KPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGG----FTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNI-VCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQC-QDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPC--NPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVD----------------------ECNLDRTQL----------------------ALYGLAVLS-------------MSNSQIG--PCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNE-------------------------------------NYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNP-------------HGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSAC 4115
            +PC+N   CID      C C  G  G  C+ ++D C  +PCLN A C+ +V      +TC C +GF G  C +  D C   +PC     C N NN    Y C CP G Q  NC+ ++ +C+    C+NG  C++ +   +C C+ G+ GRTCE+    C  + C +G  C Q   + Y C CLPGF+G  CE N+++C  + C  NG C+D V  + CQC   ++G  CA  ++ C   PNAC+N   C   N    + C C   +  + G  C +++D                      EC + +T L                       L G A+ +             M    IG  PC +  +C+NT GSF C+C   Y G +CE  +N C + PC+N ATC +    F C C+ G+ G+ CE++I+EC+ NPC ND  C D +N + C CQ GF+G  C+I+ ++C  + C    +C+D+ NG+EC+C E                                      Y G  CE+    C SNPC N G C++  VN+    Y+C C+ G +G  CEI  D C  NPC D+G+C+  ++ ++C C   + G +C+  + + C+S               C++ G C +D    GF C C  G+   +C   +D+CAS PC++ G C D    Y C C+PG+ G NC ++ N+C  + C N G C DQ+N F+C C +G  G  C+  ++ C    C N G C + +  F C C   ++G  C   +  C  N   N  + +  P               PC   G+  C D   +F CSC   FTG  C T ++ C+      ++PC N G C + Y N      +++C C  G+ G  C+ N   C  + C N G C     D    FKC C  G  G +C+ + VNEC S  C N G C +      C C KG  G +C+     C
Sbjct:   29 RPCENGGMCIDSR----CLCRPGYIGSLCQ-HLDPCHRSPCLNAAACKSQVANSIPQYTCVCQRGFRGQDC-SLVDACA-TSPCANGARCTNWNNH---YNCSCPPGYQGKNCRNDIDECRKPGKCLNGGICMNTHGSFRCECLTGYSGRTCEVPTQPCAPSQCLNGGTCHQTGDHTYECACLPGFRGHNCEDNVDDCPGHKCMNNGICVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCF--NTIGGHTCVC---VNGWTGDDCSENIDDCATAVCFNGATCHDRVASFFCECPVGKTGLLCHLDDACVSNPCNEGAVCDTNPLNGRAICTCPAGFVGGACNQDMDECSIGANPCEHFGKCVNTEGSFQCQCGRGYTGPRCEIDINECLSMPCQNDATCLDRIGEFTCICMPGYQGKYCEVDIDECESNPCVNDGICRDMVNGFTCTCQPGFTGTMCQIDIDECASTPCQNGAKCIDRPNGYECRCAEGFEGRLCESNIDNCKPDPCHHGTCVDGIASYTCNCEPGYTGYRCENQLNECHSNPCQNGGKCVDL-VNK----YICQCQHGTSGTNCEINFDDCASNPC-DYGICKDGINRYECVCKPGFTGPQCK-DEIDECQS-------------NPCRNGGTCVDD--ENGFHCQCPEGFHDPYCYSQVDECASNPCLH-GTCRDDPNGYRCDCEPGWVGKNCDLDRNDCLPSPCQNAGTCFDQLNGFTCKCRQGFRGNLCQVNINECASSPCLNQGTCVDGVASFTCLCEPPYSGPTCAELLTPCSPNPCANHASCVHTPDYLGYQCNCQPGWQDPCLNGGS--CTDGVNSFRCSCLPGFTGARCATELNECQ------SVPCKNGGTCTD-YVN------SYTCTCKPGFTGLLCETNVPDCTESSCFNGGTC----TDGINGFKCTCRTGFTGDYCQYE-VNECDSQPCLNGGICQDAMESYRCSCPKGYTGPRCQYPVDWC 967          

HSP 5 Score: 405.216 bits (1040), Expect = 4.345e-113
Identity = 314/925 (33.95%), Postives = 428/925 (46.27%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCE-QKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCE-LPNSCGSQNPCGVNGKCI-LANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININEC-AHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNA----CYNDAICIPG----NKYDSYHCNCSTALGRYEGSKCEKDVDECNLD--------RTQLALYGLAVL----------SMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXG-------ATCDNLADGFRCRCVAGFTGERCEIEINECQHNPC--SNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCV---DKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKM-DWCRGNPCGDFGVC--ETDLDSFKCKCNSEYIGERCEIK 3044
            + ++ CE++ C N   C+  +NG + C C  G+ GT C+     C  TPCQNG  C        C+C   + G  CE +  NC   PC +G       I  Y C C   Y G  CE   N C S NPC   GKC+ L N  +  C C  G +G  C  + D+CAS       + G C + +  Y+C CK GF G +C+++I +C ++ C+NGGTC+D    + C CP  +    C ++   C   PC + G CRD    Y+C C   W GKNCD  +N C  +PC+N G C       + C C++GF G +C+ +I+ C    C N G+C++ +    C C P + G  C   +  C   PC N+A C+   +   Y C+C  G               +PCLNG  C D V  F C CL GF G RC T+ + C Q  PCK    C +  N+   Y C C  G     C+  +  C    C N G C D  N  KC C  GF G  C+ E+NEC + PC +G  CQD    Y C C  G+ G +C+  ++ C   NPC   G+C  +   F C C+  +SG  C      C   A       D +C+ G    N  ++++C C      Y GS CE   D C           R+ +  +    +           ++  Q  PC N   CI+  G +IC C     G  CE   ++C       G        TC +   G+RC C  GFTGERCE +INEC  NPC  SN   CI   NDYQC+C+ GF+G+ C+   + C    C   G C        G+ C C   Y G+NCE     C   PC N GSC        T G  C C +GF GP C+ +  D C   PC + G+C  ET    F C+C + + G+RCE K
Sbjct:  444 VDIDECESNPCVNDGICRDMVNG-FTCTCQPGFTGTMCQIDIDECASTPCQNGAKCIDRPNGYECRCAEGFEGRLCESNIDNCKPDPCHHGTCVDG--IASYTCNCEPGYTGYRCENQLNECHS-NPCQNGGKCVDLVN--KYICQCQHGTSGTNCEINFDDCASNPC----DYGICKDGINRYECVCKPGFTGPQCKDEIDECQSNPCRNGGTCVDDENGFHCQCPEGFHDPYCYSQVDECASNPCLH-GTCRDDPNGYRCDCEPGWVGKNCDLDRNDCLPSPCQNAGTCFD-QLNGFTCKCRQGFRGNLCQVNINECASSPCLNQGTCVDGVASFTCLCEPPYSGPTCAELLTPCSPNPCANHASCVHTPDYLGYQCNCQPGWQ-------------DPCLNGGSCTDGVNSFRCSCLPGFTGARCATELNEC-QSVPCKNGGTCTDYVNS---YTCTCKPGFTGLLCETNVPDCTESSCFNGGTCTDGINGFKCTCRTGFTGDYCQYEVNECDSQPCLNGGICQDAMESYRCSCPKGYTGPRCQYPVDWCRPSNPCKNGGRCRQKDASFTCDCLGGWSGRYCDIPGVSCEVAARQRGRQTDELCLHGGHCVNTGNTHYCKCP---ADYTGSYCESQFDHCEEKPCLNGATCRSYMGGFTCDCMPGYEGNNCEREVNECQSHPCQNGGTCIDLVGHYICSCPPGTLGVLCEINEDDCATPSWPRGMPKCQNNGTCVDRVGGYRCNCPPGFTGERCEGDINECLSNPCNPSNSLDCIQLPNDYQCVCKPGFTGRGCQSRFSVCESQPCKNGGVCSLSGSSPPGYSCTCQLGYAGSNCERSMN-CKELPCYNGGSCT-----LTTRGARCTCIQGFGGPLCQHRSNDGCSSKPCHNGGLCTEETSYPFFHCQCTNGWKGKRCEQK 1330          

HSP 6 Score: 223.402 bits (568), Expect = 1.486e-57
Identity = 183/574 (31.88%), Postives = 241/574 (41.99%), Query Frame = 3
Query:  420 AISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQK-SNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELP-NSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDEC-------ASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKIS-------CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPC--QNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCE---DRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINE-CFNNPCQHGSQCQD--LFNDYLCICLPGFKGKKCEININECAHNP 2066
            A  LN C++  CKNG TC   +N  Y C C  G+ G  CE    +C  + C NGGTC        C C   + G++C++  N C S PC NGGIC+   +  Y C CPK Y G  C+ P + C   NPC   G+C    D    C C  G++G  C      C             LC +GG C+NT  ++ CKC A + G  CE+    C    C NG TC   +G + C C   Y G NCE +   C+  PC+NGG C D                                           Y C C  G  G +CE + D+C   S       C N G+C++ + G +CNC PGF G  CE ++NEC + PC   N+  CI L NDY C C  G TG+ C+     C   PC NG  C        G++C C  G+ G  CE +S  CK+L PC                                         G C       +C CI GF G  C+   N+ C + PC +G  C +   +  + C C  G+KGK+CE      A  P
Sbjct:  847 ATELNECQSVPCKNGGTCTDYVN-SYTCTCKPGFTGLLCETNVPDCTESSCFNGGTCTDGINGFKCTCRTGFTGDYCQYEVNECDSQPCLNGGICQD-AMESYRCSCPKGYTGPRCQYPVDWCRPSNPCKNGGRC-RQKDASFTCDCLGGWSGRYCDIPGVSCEVAARQRGRQTDELCLHGGHCVNTGNTHYCKCPADYTGSYCESQFDHCEEKPCLNGATCRSYMGGFTCDCMPGYEGNNCEREVNECQSHPCQNGGTCIDL---------------------------------------VGHYICSCPPGTLGVLCEINEDDCATPSWPRGMPKCQNNGTCVDRVGGYRCNCPPGFTGERCEGDINECLSNPCNPSNSLDCIQLPNDYQCVCKPGFTGRGCQSRFSVCESQPCKNGGVCSLSGSSPPGYSCTCQLGYAGSNCE-RSMNCKEL-PCYN--------------------------------------GGSCTLTTRGARCTCIQGFGGPLCQHRSNDGCSSKPCHNGGLCTEETSYPFFHCQCTNGWKGKRCEQKTGSSAPLP 1338          

HSP 7 Score: 217.624 bits (553), Expect = 7.665e-56
Identity = 187/606 (30.86%), Postives = 266/606 (43.89%), Query Frame = 3
Query: 2589 HNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNG----FECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRG-NPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECY--SNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETD-----------------------INECKYNIAGNATNL----ISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLAS------IDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRI 4283
            H PC N   CID     +C+C+ G+ G  C+  D  C  S CL    C  +V      + C C   + G +C  L   C ++PC N   C N   +     Y C+C  G+ G  C   +D CR    C + G+C     SF+C+C + Y G  CE+  T+ C         ++ L    C   G+         ++C+C  G+ G  CE N+DDC    C+N G C DG   Y C+C P + G  C  + NEC    N+C N G C + I   +CVC  G +G  C   +D C    C NG  C + +  F C CP G  G LC  D                       I  C     G A N      S    PC   G  +C++  G+F C C + +TG  CE  I+ C       ++PC N+  CL++    +G    F+CIC  GY G+ C+++  +C+ N C N+GICR    D    F C C PG  G  C+ID ++EC ST C N   C++      C C +G  G  CE     C          +D   +Y     +CE      + +N++   EC+   C  +GG+C+  V K I
Sbjct:   28 HRPCENGGMCIDS----RCLCRPGYIGSLCQHLD-PCHRSPCLNAAACKSQVANSIPQYTCVCQRGFRGQDCS-LVDACATSPCANGARCTNWNNH-----YNCSCPPGYQGKNCRNDIDECRKPGKCLNGGICMNTHGSFRCECLTGYSGRTCEVP-TQPCA-------PSQCLNGGTCHQTGD-------HTYECACLPGFRGHNCEDNVDDCPGHKCMNNGICVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGGHTCVCVNGWTGDDCSENIDDCATAVCFNGATCHDRVASFFCECPVGKTGLLCHLDDACVSNPCNEGAVCDTNPLNGRAICTCPAGFVGGACNQDMDECSIGANPCEHFG--KCVNTEGSFQCQCGRGYTGPRCEIDINECL------SMPCQNDATCLDR----IGE---FTCICMPGYQGKYCEVDIDECESNPCVNDGICR----DMVNGFTCTCQPGFTGTMCQID-IDECASTPCQNGAKCIDRPNGYECRCAEGFEGRLCESNIDNCKPDPCHHGTCVDGIASY---TCNCEPGYTGYRCENQL--NECHSNPCQ-NGGKCVDLVNKYI 581          
BLAST of Neurogenic locus notch protein vs. Ensembl Zebrafish
Match: notch1b (notch receptor 1b [Source:ZFIN;Acc:ZDB-GENE-990415-183])

HSP 1 Score: 909.827 bits (2350), Expect = 0.000e+0
Identity = 675/2158 (31.28%), Postives = 977/2158 (45.27%), Query Frame = 3
Query:  432 NFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CAS--SPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNK-----------------------GYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDC--TNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWT-----------------GKNCDDVXXXXXXXXXXXXGFCESVNYQD-----------------------YKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCK-------------------TEEIC-LNVN--------------NTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGR--------------------------------------TCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKM--------ECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSC--VNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIF------------SIRVFAENSNSDSSK--SRQKRSLSNSVQQGK-----------PGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRK-AEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNAS------SELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQHRPL 6341
            N C    C+NG TC+      Y C+C  G+ G  C+Q   C   PC NGG C     + +C C   + G+ C+   N CA   SPC+NGG+C++  +  Y C CP  Y G +CE      + +PC   G C+   +   +C C                         G++G  C  +ID+C  +    C NGGTC++ V +Y C+CK  + G+ C  D+ +C    ++C+NGGTCL+  G Y CVC N + G +C      C    C  G  C D    + C C +  T                 G NCD      K       G+      QD                       ++C C +G+ G  CE  I+ C    C N  +C++ I G  C C+PG+EG  C+IN +EC + PC NN KCID  N+Y C+CP G +G  C+ +IDEC   PC NGA+C D    +TCQC +G+ G  CET  D C    PC                       +C +N+N              +  + Y C+CP G    NC+  L  C++  C  G+C+D  N  +C C PG+ G+                                      TC+ ++NEC +NPC HG  C+D  N Y CIC  G+ G  C+IN NEC  NPC   G C D   G+ C C   +SGP C   ++ C  N C N   CI  +    Y CNC   L  Y G  CE D++EC  +                    PC ND  C N+ GS+ C C + Y GR CE  +++C+ NPC NG  C +  + F C C+ GF G RCE +INEC+ NPC N A C D +N Y C C  GFSG +CE N  DCTESSC   G CVD +N F C C + + G  C+H    CDS PC+N G+C      Q++ G Y C C +G+ G  C+  ++WC+ +PC + G+C      + C+C + + G  C++    +C+  A ++  +   + ++C++ G C +   T    C CQ+GY GS+CE  +D+C   PC NG  C D  G Y C+C PG+ GVNC    NEC S  C N G CID IN + C CPRG  G  CE  +D C           +C N G C + +G + C CP G+ G+ CE D+NEC  N                 P GT  C+     + C C+  +TG++C+   D C+        PC N G C        G    F C CP G+ G  C+ ++  C    CKN G C    +    S KC C P   G  C+      C +  CYN G+C  +       C C     G  C I   +    +  +          CE+ +C  K  NKICD  CN YAC +DGG+C            ++   PW NC    S  + C  +FNN +CD QC+   CL+DG+DC     QC PL   +C  H+ADG C   CN  EC +DG DC       +  G+++++     + +       L+ L+ +LH+ V   R+S GQ+MI+            +I+   +  N  SS   S  K S+ N V +G             G+ VYLE+DN  C   +  CF ++N AA F+ A     S + P  I +V +        P P         V    V + +    L  F+        K+ R+  ++W+PEG K    + S+   +  V  +    + L NC + S      +E G  +Q    +  + +       +     + T   ++  +    ++A +               PP+  ++     +  R  + +    IA+   SG GL   +  E  D    V           D   + A+L N+ +                +GET LHLAA+Y R +AA+ LLEA +D N  +  GR+ L  A+ A A  V    +  +    DL  +  +G+T LI A + A   +++ L+        D+N  D++G++ALHWAA         +LL  G N+D Q+N+E TPL+LA +EG  E  K+L+ + AN +++DH+DRLPRD+A+      IV L+++Y  +        PL
Sbjct:  101 NVCLGAPCRNGGTCELTSIHNYRCKCPPGWSGKTCQQADPCASNPCANGGQCSPFDSDFLCHCTPYFSGQTCKQDVNECAQIPSPCKNGGVCEN-GVGTYHCNCPAEYTGKHCESLYQPCNPSPCLHGGTCVQKGETSYECSCLPGRQEFVLIMRKCLNDYFLMLVFIGFSGQNCEENIDDCPDHR---CLNGGTCVDGVNTYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGWTGDDCSENIDDCADAACHTGATCHDRVASFLCECPHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPLGYVGPACDQDVDECSLGANPCEHAGKCINTKGSFQCKCLQGYVGARCELDINECLSTPCQNDATCLDQIGGFHCICMPGYEGVFCQINTDECASMPCLNNGKCIDKINNYQCECPTGFSGSQCQFDIDECASTPCKNGAKCMDGPNMYTCQCTEGYTGQHCETDVDECLS-NPCHYGTCKDGLASFTCVCRAGFMGRLCEININECLSQPCQNGGTCQDRENAYLCVCPKGTAGANCEINLDDCQSNPCDFGRCIDKINGYECACEPGYTGKMCNINIDECAINPCHNGGTCVDGVNGFTCLCREGYHDTTCQSQLNECLSNPCIHG-HCEDKVNGYNCICDSGWSGVNCDINNNECESNPCMNGGTCKDMTSGYVCTCRAGFSGPNCQTNINECASNPCLNQGTCI--DDVAGYKCNC---LLPYTGQTCEVDINECVKN--------------------PCRNDAICQNSIGSYKCSCKAGYTGRNCETDIDDCKPNPCSNGGFCKDAVNAFACTCLPGFRGGRCEEDINECESNPCKNGANCTDCVNSYTCTCPPGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPKGFTGNYCQHDINECDSRPCMNGGTC------QDSYGTYKCTCPQGYHGLNCQELVNWCKPSPCKNGGICRQSGTRYSCQCQTGWTGLYCDVPSV-SCEVAAKQQGVD---VVRLCRNSGQCLDAGNT--HYCHCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSDEINECLSQPCQNGGTCIDLINTYKCSCPRGTQGVHCEINIDDCTPFTDPITHEPKCFNQGRCVDRVGGYHCICPPGYVGERCEGDVNECLSN-----------------PCGTHSCIQLKNNYRCECRTGYTGQHCDKVFDGCK------GKPCRNGGTCAVASNTPHG----FICKCPPGFTGSTCEYDAHACGSLQCKNGGTC----VSGHKSPKCLCTPAFTGPECQDPSGGHCTTNPCYNGGTCEYITEEPYYHCICPTNFNGLFCHILDWSFPGGTGQDITPAPKVSVSCEIEQCKVKKGNKICDSACNNYACDWDGGDC-----------SLNFNDPWKNC----SAALQCWRYFNNGKCDEQCHNTGCLYDGFDCQRVEAQCNPLYDQYCKDHFADGYCDQGCNNAECEWDGLDCANDTPEKLAAGLLVVVVHIHPDQLRNNSFGFLRELSRVLHTNVVFRRDSKGQEMIYPYYGNEQELKKHNIKRSLDGWNDASSDVLSSMKNSIYNIVVEGGRKRRELEKIQVKGSVVYLEIDNRQCYQQTSECFQSANDAAAFLGALASSGSLKMPYVIEAVTSE----IDGPSP---------VELYPVYVVLAGLALLAFVAIGMVASRKRRREHGQLWFPEGFK--TSEPSKKKRREPVGEDSVGLRPLKNCSDISLMDDNQNEWGEEEQSDSKRFRSEEQAMLDLDDQPDHRQWTQQHLDAADLRIPSIAPT---------------PPQGEIENDCMDVNARGPDGFTPLMIAS--CSGGGLETGNSEEEEDASANVIN---------DFIYQGANLHNQTD---------------RTGETALHLAARYARSDAAKRLLEASADANIQDNMGRTPLHAAVAADAQGVFQILIRNR--ATDLDARMHDGTTPLILAARLAVEGMVEELINCHA----DVNAIDDFGKSALHWAAAVNNVDAAMVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLEHFANREITDHMDRLPRDIAQDRMHHDIVRLIDEYNLVRSPPMHSAPL 2107          

HSP 2 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 441/1304 (33.82%), Postives = 636/1304 (48.77%), Query Frame = 3
Query:  396 LILLFCPIAISLNFCE-----NHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNN----VCQCLNEWVGEFCEFSSN--CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDK-IGSYRCV--------------CPNNYF---------GTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCID--LNNDYTCDCPEGLTGKNCEINIDECT--PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIP----CFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEIS 4163
            L  +   + ISLN        + KC+NG TC+   +G+  C+C   Y G  C+ ++ C  +PC+NGG C+LI   N    VC C   +    C   +N  C  +PCRNGG C+   IH Y C+CP  + G  C+  + C S NPC   G+C    D +  CHC   ++G TC  D++ECA   +P C+NGG C N VG+Y C C A + G+ CE+    C    C +GGTC+ K   SY C               C N+YF         G NCE     C    C NGG C D    Y C C  +WTG+ C +DV     +     NG         Y C+C  G+ G  C  +ID+C   +C  G +C + +    C C P           + C + PCQ  + C    +N    C CP G  G  C+ ++DEC+   NPC +  +C +  G F C+CLQG+VG RCE   + C   TPC+ +  CL   +   G+ CIC  G +   C+    +C ++ C+ NG+C+D  N  +C C  GF G  C+ +I+EC + PC++G++C D  N Y C C  G+ G+ CE +++EC  NPC   G C D +  F C C   + G  C   ++ C    C N   C   ++ ++Y C C        G+ CE ++D+C                    Q  PC +  +CI+    + C C   Y G+ C   ++ C  NPC NG TC +  +GF C C  G+    C+ ++NEC  NPC +   C D +N Y CIC SG+SG NC+IN+N+C  + C+  G C D  +G+ C C   + G NC+     C SNPCLN+G+CI+     +  GY CNC   +TG  CE+ ++ C  NPC +  +C+  + S+KC C + Y G  CE    + CK                C + G C +      F C+C  G+ G  CE +I++C S PC NG  C D    Y C C PGF G++C+ NT +C  +SC N G C+D IN+F+C+CP+G +G +C+  ++ C    C NGG C++  G ++C CP+G+ G  C+  +N CK +   N         G C  +GT         + C C+  +TG YC+     CE   K   +     C N+G CL+             C C  GY G  C+    +C  N C+N   C     D    + CEC PG  G+ C  D +NECLS  C N G+C++      C C +G+ G  CEI        +ID+   + D I+
Sbjct:    3 LFFVKLIVVISLNTLTQGLECSEKCQNGGTCEPTADGRGECKCLDLYAGPACQFRNPCFQSPCRNGGVCRLITSANKVDFVCNCSLGYTDRLCLTPTNNVCLGAPCRNGGTCELTSIHNYRCKCPPGWSGKTCQQADPCAS-NPCANGGQCS-PFDSDFLCHCTPYFSGQTCKQDVNECAQIPSP-CKNGGVCENGVGTYHCNCPAEYTGKHCESLYQPCNPSPCLHGGTCVQKGETSYECSCLPGRQEFVLIMRKCLNDYFLMLVFIGFSGQNCEENIDDCPDHRCLNGGTCVDGVNTYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGWTGDDCSENIDDCADAACHTGATCHDRVASFLCEC-PHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPLGYVGPACDQDVDECSLGANPCEHAGKCINTKGSFQCKCLQGYVGARCELDINECLS-TPCQNDATCL---DQIGGFHCICMPGYEGVFCQINTDECASMPCLNNGKCIDKINNYQCECPTGFSGSQCQFDIDECASTPCKNGAKCMDGPNMYTCQCTEGYTGQHCETDVDECLSNPCHY-GTCKDGLASFTCVCRAGFMGRLCEININECLSQPCQNGGTC--QDRENAYLCVCPKGTA---GANCEINLDDC--------------------QSNPC-DFGRCIDKINGYECACEPGYTGKMCNINIDECAINPCHNGGTCVDGVNGFTCLCREGYHDTTCQSQLNECLSNPCIH-GHCEDKVNGYNCICDSGWSGVNCDINNNECESNPCMNGGTCKDMTSGYVCTCRAGFSGPNCQTNINECASNPCLNQGTCID-----DVAGYKCNCLLPYTGQTCEVDINECVKNPCRNDAICQNSIGSYKCSCKAGYTGRNCET-DIDDCKP-------------NPCSNGGFCKD--AVNAFACTCLPGFRGGRCEEDINECESNPCKNGANCTDCVNSYTCTCPPGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPKGFTGNYCQHDINECDSRPCMNGGTCQDSYGTYKCTCPQGYHGLNCQELVNWCKPSPCKNG--------GICRQSGT--------RYSCQCQTGWTGLYCDVPSVSCEVAAKQQGVDVVRLCRNSGQCLDAGNTHY-------CHCQAGYTGSYCEEQVDECIPNPCQNGATC----TDYLGGYSCECVPGYHGVNCS-DEINECLSQPCQNGGTCIDLINTYKCSCPRGTQGVHCEI--------NIDDCTPFTDPIT 1213          

HSP 3 Score: 213.001 bits (541), Expect = 1.973e-54
Identity = 180/585 (30.77%), Postives = 243/585 (41.54%), Query Frame = 3
Query:  408 FCPIAISLNFCENHKCKNGATCQSDIN-----------------GKYVCECAYGYKGTYCEQKS-NCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNC-ELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYE-------TPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKIS--------CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC---EDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCE-IEINECFNNPCQHGSQCQDLFND--YLCICLPGFKGKKCEI 2039
            FC  A++   C       G  C+ DIN                   Y C C  G+ G +CE  + +C  + C NGGTC     +  C C   + G +C+   N C S PC NGG C+      Y+C CP+ Y G+NC EL N C   +PC   G C  +      C C  G+TG  C      C             LC N G C++   ++ C C+AG+ G  CE  + +C  + C+NG TC D +G Y C C   Y G NC ++   C  +PC+NGG C D    Y+C                                        C RG +G  CE +ID+C   +        CFN G C++ + G  C C PG+ G  CE +VNEC + PC  ++ CI L N+Y C+C  G TG++C+   D C   PC NG  C    +   GF C+C  GF G  CE  +  C  L                                   +CKN     G CV  +   KC+C P F G  C+      C  NPC +G  C+ +  +  Y CIC   F G  C I
Sbjct:  901 FCKDAVNAFACTCLPGFRGGRCEEDINECESNPCKNGANCTDCVNSYTCTCPPGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPKGFTGNYCQHDINECDSRPCMNGGTCQD-SYGTYKCTCPQGYHGLNCQELVNWC-KPSPCKNGGICRQSGT-RYSCQCQTGWTGLYCDVPSVSCEVAAKQQGVDVVRLCRNSGQCLDAGNTHYCHCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSDEINECLSQPCQNGGTCIDLINTYKC---------------------------------------SCPRGTQGVHCEINIDDCTPFTDPITHEPKCFNQGRCVDRVGGYHCICPPGYVGERCEGDVNECLSNPCGTHS-CIQLKNNYRCECRTGYTGQHCDKVFDGCKGKPCRNGGTCAVASNTPHGFICKCPPGFTGSTCEYDAHACGSL-----------------------------------QCKN----GGTCVSGHKSPKCLCTPAFTGPECQDPSGGHCTTNPCYNGGTCEYITEEPYYHCICPTNFNGLFCHI 1403          
BLAST of Neurogenic locus notch protein vs. Ensembl Xenopus
Match: fto (FTO alpha-ketoglutarate dependent dioxygenase [Source:Xenbase;Acc:XB-GENE-972564])

HSP 1 Score: 979.548 bits (2531), Expect = 0.000e+0
Identity = 697/2111 (33.02%), Postives = 1035/2111 (49.03%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGF--KCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKM----ECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKA--ICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSD-SSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNS-----AAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNF---PPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQHRPLMWGXXXXXXXXXXXXXHPVDLKTVLYSSPHSLQPMSCCVYPNSLPQDSIEFK-SKNMGFYNPAMSIQNQSNPSCFRSNQIGSFMNQPHESVKKRLTT----HTSPNLLSSDSKMR 6671
            ++ C +HKC+NG TC   +N  Y C C   + G +C E    C + P  CQNGGTC    G   C C+N W G+ C  +  +CA++ C NG  C    +  + C CP+  +G+ C   ++C S NPC +   C      G+  C C  GY G  C+ DIDEC+   +  CE+ G C+NT GS+ C+C  GF G RCE DI +C ++ C+N  TCLDKIG + C+C   Y G +CE +   C   PC N G C D    + CIC   +TG  C    + C   PC+N   C   +   Y CIC  GF G +CE +I+NC+   C  G +C + I+   C C PG+ G  C   ++EC + PC N  +C+DL N Y C+C  G +G  CE N+D+C  NPC  G  C D +  + C C  GF G +C+   D C    PC     C+N  N    ++CICP+G +  +C  ++ +C N  CI+G C D  N  KC+C PG+ G+ CE++ NEC +NPCQ+G  C +L N Y C C  GFKG  C+I+I+ECA NPC  +G C D + G+ C C LPY+G  C N L PC+P  C+N  IC     + S+ C C+T    + G +C  D+DEC  +                    PC N  +C NT G +IC C   + G  CE  +++C +NPC+NGA+C +  + F C C+AGF G++C+ +++EC  NPC N   C D++N Y C CQ GF G +C+ N ++CT++SC     CVD +N F C+C + + G  C      C S+PC+N G+C++         Y C C  G+ G  CE  +D C G PC + G+C+      KC C + + G  C+I       S  V   +    +  +C+H G C N     GF  +C C+ GY GS+CE  +D+CAS PC N   C D  G Y CKC PG+QGVNC+   +EC    C N G C+D +N F C CP G  G  CE  +D C        C NGG C + IG + C C  GFAG+ CE D+NEC  N              PCS  G+L+C+     + C CK  FTG++CET  D C         PC N G C        G    F+C CP G+ G +C+ ++  C    CK    C    I   +  +C CP G  G  C+      C S  C NNG C          C+C  G  G +CEI                   I  C L+ C  KA +  CD ECN + C +DGG+C            +++  PW+NC    S ++ C  +FN + CD  CNT  CLFD ++C +    C    +C+ HYA+G C   CNT EC +DG DC   +   +  G ++++ +   + + +     L+ L  +L + +RI RN +G  M+F    F E S++  S +S  +  +   +++   G+KV LE+DN  C   S  CF  ++S     AA  V   L+Y       P++SV      G +K  P           T + +L V++ ++   +        KK +   +W+PEG   L++ TS    +  V  +    +NL    +     GN+    ++   +    DD G     S       ++  ++  ++   ++  ++ ++  M  +    PP+    + +  +  R  +      +A+L +    + E           ++  L+      Q +T++                         +GET LHLAA+Y+R +AA+ LL+AG+D N  +  GR+ L  A+ A A  V    +  +  V DL  +  +G+T LI A + A   ++  L+        D+N  D++G++ALHWAA         +LL  G NRD QDN+E TPL+LA +EG  E  K+L+   AN +++DH+DRLPRD+AK      IV LL++Y N+    Q     M  +    +      +  ++LK    +   + +P +  V P SLP  + E K +KN          + Q + S    + + S +  PH +    +T+    HTSP  + + S ++
Sbjct:  257 IDDCPSHKCQNGGTCVDGVN-TYNCRCPPQWTGQFCTEDVDECQLQPNACQNGGTCTNSNGGYNCVCVNGWSGDDCSQNIDDCATAACANGSTCID-RVASFICVCPEGKIGLLCHKNDACFS-NPCHMGSLCDTNPLTGQAICTCPSGYKGTACTEDIDECSLVNSNPCEHAGKCVNTEGSFYCECSKGFTGPRCEMDINECLSEPCQNDATCLDKIGGFTCLCMPGYKGIHCEIEINECLSNPCVNNGECVDKVNRFVCICPPGFTGSVCQIDIDDCSSTPCQNGAKCVD-HPSGYDCICATGFTGVLCEENINNCEPPPCHYG-TCQDGIDSYTCICEPGYMGAICSDQIDECLSNPCLNEGRCVDLVNGYQCNCLPGTSGPRCEKNVDDCASNPCTYG-NCVDGINRYDCVCSPGFTGPQCKDDIDECAS-NPCHNGGTCVNEQNR---FRCICPEGFRQPSCFSQVDECVNNPCIHGNCTDDVNGYKCLCQPGWTGKKCEVDKNECLSNPCQNGGTCDNLVNGYRCSCKKGFKGYNCQIDIDECASNPCLNHGTCRDGINGYTCHCGLPYTGTNCQNILTPCSPEPCHNGGICQESEDFKSFSCLCATG---WHGQRCTIDIDECITN--------------------PCKNYGRCQNTKGGYICHCFEGFNGVNCENNIDDCLSNPCQNGASCVDGINTFSCNCLAGFHGDKCQKDVDECASNPCKNGGSCTDYVNSYTCKCQPGFDGIHCDNNIDECTDTSCFNGATCVDGINSFTCQCPQGFTGQFCLFEINECGSHPCINGGTCVDGMGT-----YHCTCPVGYRGKNCEELVDLCSGFPCKNRGICKQVKTEPKCICPTGWTGIYCDIPDV----SCEVAASQRGVAVQDLCQHAGICINT----GFSHRCQCRQGYIGSYCEGELDECASNPCQNSATCVDRHGGYECKCLPGYQGVNCEYEIDECQIQPCHNGGTCVDLVNQFRCSCPPGTRGPLCEENIDDCAPSSEGPHCFNGGRCLDKIGGYSCECLPGFAGERCEGDVNECLSN--------------PCSAKGSLDCIQLDNNYLCKCKPGFTGRHCETIQDLCPTR------PCLNGGTCAVAVNMPEG----FTCQCPPGFSGSKCQYSNNTCGHYKCKVGENC----IKTPLGPRCYCPTGPAGNACQSKL--GCTSQPCKNNGVCQRKDQPPYYTCNCPNGIVGLQCEIL-----------------LIDGCHLHHCPDKARDGYCDQECNTHECLWDGGDC-----------SLTMEDPWANC----SSSLKCWEYFNGQ-CDELCNTPECLFDNFECQEKESICKYDKYCEDHYANGHCDKSCNTKECGWDGLDCSTDKPENLAEGTLVIVVLMPPKELLKNSRNFLRELGSILRTNLRIKRNPDGSPMVFP--YFREKSSAQRSRRSLLELRVVRELEEQPIGSKVSLEIDNQQCVLDSDQCFKTTDSAAAMLAAHAVQGTLNY-------PLVSV------GVEKAPP--------SSQTLMYILPVILAIIIVILLLVVVLAKKKRKHGTLWFPEGF-LLHRDTSNQKRREPVGQDAVGMKNL----SVPIVDGNLLDSNQNDHWS----DDRGPQPKKSKSEGQALLSGGDDQVDSRQWTQQHLVAADIRMTPSLALTPPQAEQDMDVIDVNVRGPDGCTPLMLASLRMGSPHIEEDDEEAEDPSANVITDLIYQGACLQAQTDR-------------------------TGETALHLAARYSRADAAKRLLDAGADANSQDSMGRTPLHAAVSADAQGVFQILIRNR--VTDLDARMNDGTTPLILAARLAVEGMVADLINCQA----DVNAVDDHGKSALHWAAAVNNVEATIVLLKNGANRDMQDNKEETPLFLAAREGSFEAAKMLLDYFANREITDHMDRLPRDIAKDRMHHDIVRLLDEY-NLVHSPQGQPGTMLSNSLSPAVCGSNRSF-LNLKHAAQTK-KARRPSAKSVAPRSLPNLAKEPKDTKNRRRKKSDTDSKAQLSESSVTLSPVDS-LESPHATSSPTITSPGALHTSPGQMIAASTLQ 2191          

HSP 2 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 458/1307 (35.04%), Postives = 654/1307 (50.04%), Query Frame = 3
Query:  453 CKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIA--GNNVCQCLNEWVGEFCE--FSSNCA-SSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIG-SYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCID--LNNDYTCDCPEGLTGKNCEINIDECT---PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCE--TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQL----------NVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDL---ECNKYACG---FDGGECLHRV 4271
            C N   C ++ +G   C+C   + G YC+ ++ C  T C NGGTCK+ +     VC C   + GE C+   ++ C+ + PC NGG C+ L +  Y+C CP  + G +C+  ++C SQ PC  NG   + N+ +  C C  GYTG  C  D++EC      +C+NGGTC N  GSY+C+C  G+ G+RCE+  + C+   C NGGTC      +Y C C   + G NCE     C    C+NGG C D    Y C C  QWTG+ C +DV           NG   + +   Y C+C  G+ G  C  +ID+C   +C NG +CI+ +    C C P  +        + C + PC   + C    L     C CP G  G  C  +IDEC+    NPC +  +C +  G F C+C +GF G RCE   + C    PC+ +  CL   +   G+ C+C  G +  +C+ E+++C +  C+ NG+CVD  N   CIC PGF G  C+I+I++C + PCQ+G++C D  + Y CIC  GF G  CE NIN C   PC   G C D +  + C C   Y G  C++++D C  N C N+  C+  +  + Y CNC   L    G +CEK+VD+C  +                    PC   N C++    + C CS  + G QC+  ++ C +NPC NG TC N  + FRC C  GF    C  +++EC +NPC +   C D +N Y+C+CQ G++GK CE++ N+C  + C   G C + VNG+ C C + + G NC+     C SNPCLN G+C +  +N    GY C+C   +TG  C+  +  C   PC + G+C+   D  SF C C + + G+RC I   E               I   CK++G C N    GG+ C C  G+ G  CE NIDDC S PC NG  C DG   + C C  GF G  CQ + +EC SN C N G C D +N+++C C  G  G  C+  +D C    C NG  C + I  F C CP+GF G+ C  +INEC  +              PC   GT  C+D  GT+HC+C   + GK CE  +D C  F      PC N GIC  + + E        CICP G+ G  C I    C++          ++C++ GIC    I+   S +C+C  G  G +CE + ++EC S  C N+ +CV+  G   C C  G  G  CE     C +    N  T  D ++    + C       +C+    +C   + G   F+GG CL ++
Sbjct:   31 CLNEGKCITNDDGSAYCKCTDAFVGKYCQLQNPCQETICLNGGTCKVSSDLSKGVCTCAPGFGGENCKQPVANVCSLTQPCMNGGTCRLLTLELYDCICPFGWRGNDCKFIDACASQ-PC-ANGSTCIPNENQYTCSCQAGYTGLKCEVDVNECGP--PGMCKNGGTCENLPGSYRCQCHPGYTGQRCESPFIPCSPSPCMNGGTCRQTSEFAYECNCLPGFDGKNCETNIDDCPSHKCQNGGTCVDGVNTYNCRCPPQWTGQFCTEDVDECQLQPNACQNGGTCTNSNGGYNCVCVNGWSGDDCSQNIDDCATAACANGSTCIDRVASFICVC-PEGKIGLLCHKNDACFSNPCHMGSLCDTNPLTGQAICTCPSGYKGTACTEDIDECSLVNSNPCEHAGKCVNTEGSFYCECSKGFTGPRCEMDINECLS-EPCQNDATCL---DKIGGFTCLCMPGYKGIHCEIEINECLSNPCVNNGECVDKVNRFVCICPPGFTGSVCQIDIDDCSSTPCQNGAKCVDHPSGYDCICATGFTGVLCEENINNCEPPPCHY-GTCQDGIDSYTCICEPGYMGAICSDQIDECLSNPCLNEGRCV--DLVNGYQCNC---LPGTSGPRCEKNVDDCASN--------------------PCTYGN-CVDGINRYDCVCSPGFTGPQCKDDIDECASNPCHNGGTCVNEQNRFRCICPEGFRQPSCFSQVDECVNNPCIH-GNCTDDVNGYKCLCQPGWTGKKCEVDKNECLSNPCQNGGTCDNLVNGYRCSCKKGFKGYNCQIDIDECASNPCLNHGTCRD-GIN----GYTCHCGLPYTGTNCQNILTPCSPEPCHNGGICQESEDFKSFSCLCATGWHGQRCTIDIDE--------------CITNPCKNYGRCQN--TKGGYICHCFEGFNGVNCENNIDDCLSNPCQNGASCVDGINTFSCNCLAGFHGDKCQKDVDECASNPCKNGGSCTDYVNSYTCKCQPGFDGIHCDNNIDECTDTSCFNGATCVDGINSFTCQCPQGFTGQFCLFEINECGSH--------------PCINGGT--CVDGMGTYHCTCPVGYRGKNCEELVDLCSGF------PCKNRGIC-KQVKTEP------KCICPTGWTGIYCDIPDVSCEVAASQRGVAVQDLCQHAGIC----INTGFSHRCQCRQGYIGSYCEGE-LDECASNPCQNSATCVDRHGGYECKCLPGYQGVNCEYEIDECQIQPCHNGGTCVDLVNQFRCS-CPPGTRGPLCEENIDDCAPSSEGPHCFNGGRCLDKI 1244          
BLAST of Neurogenic locus notch protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 961.829 bits (2485), Expect = 0.000e+0
Identity = 684/2021 (33.84%), Postives = 987/2021 (48.84%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKM--------ECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAI--CHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSN-----------SVQQGK----------PGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRK--AEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNAS------SELGNIQQMTKSKISTTDSV--DDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQH 6332
            ++ C ++ C+NG TC   +N  Y C+C   + G YC E    C + P  CQNGGTC    G   C C+N W GE C E   +CA++ C +G  C    +  + C+CP    G+ C L N+C S NPC     C     +G+  C C  GYTG  C+ND+DEC+    P CE+GG C NT+GS+QC C  G+ G RCE D+ +C ++ C+N  TCLD+IG ++C+C   Y G  CE     C   PC + G C D   ++ C C   + G  C  DV               +  N   Y C C  GF G+ CE  I+ C    C  G +C + I    C C PG+ G  C+ ++NEC ++PCQN  +C D  N Y C CP+G TG NCE N+D+C  NPC  G +C D++ G+ C C  G+ G  C    D C    PC+    C +  N   G+ C+CPDG  +  C  E+++C +  CI+G C D  N  KC C  G+ G  C++  NEC +NPC +G  C+D+   Y+C C  GF G  C+ NINECA NPC   G CID+V G++C CMLPY+G  C   L PC+ + C N   C     Y+++ C C      ++G  CE D++EC ++R                   PC N   C NTNGS+ C C   Y GR CE  +++C+ NPC NG +C +  + F C C AGF G +CE +INEC  NPC N A C D +N Y C CQ GFSG +CE N  DCTESSC   G C+D +N F C+C   + G  C+H    CDS PCLN G+C      Q++ G Y C C +G+TG  C+  + WC  +PC + G C    + ++C+C S + G  C++    +C+  A ++  +   I  +C++ G C +   T    C CQ+GY GS+CE  +D+C+  PC NG  C D  G Y C+C  G+ GVNC    NEC S+ C N G CID IN + C CPRG  G  CE  VD C           +C N G C + +G + C CP GF G+ CE D+NEC  N              PC P GT  C+     + C C++ FTG+ C++ +D C+       +PC N G C      E G    F C CP G+ G  C+ +++ C    C+N G C    I    S KC C  G  G  C+   V+ C S  CYN G+C     +    C C     G  C I      +  +  + T  D    CE  +CA  ADNKIC+  CN +ACG+DGG+C            ++   PW NC    ++++ C  +FN+ +CD QCN   CL+DG+DC     QC PL   +C  H+ DG C   CN  EC +DG DC ++    +  G +L++ +   E +       L+ L+ +LH+ V   ++S G+  I+      E       K R   S S+           SV  G+           G+ VYLE+DN  C   S  CF ++   A F+ A   + +   P  I +V+        KP PP              +  +LV  L           +KK R+   ++W+PEG   + ++ S+   +  +  +    + L N  + S      +E G+ + +   +    + V   +   +     + T   ++  +    ++A +               PP+  +      +  R  +   F  +     SG GL   +  E  D                   N  +D   +           L ++   +GET LHLAA+Y R +AA+ LLE+ +D N  +  GR+ L  A+ A A  V    +  +    DL  +  +G+T LI A + A   +++ L+        D+N  DE+G++ALHWAA         +LL    N+D Q+N+E TPL+LA +EG  E  K+L+ + AN D++DH+DRLPRD+A+      IV LL+++ N+ K    H
Sbjct:  216 IDDCPSNNCRNGGTCVDGVN-TYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHD-RVASFFCECPHGRTGLLCHLDNACIS-NPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANP-CEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGYEGLYCETNIDECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCLDGPN--SYTCQCTEGFTGRHCEQDINECIPDPCHYG-TCKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNPCDYG-KCIDKIDGYECTCEPGYTGKMCNINIDECAS-NPCRNGGTCKDKIN---GFTCVCPDGYHDHMCLSEVNECNSNPCIHGTCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPG---WQGQTCEIDMNEC-VNR-------------------PCRNGAMCQNTNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGINMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTC------QDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECKSGWTGVYCDVPSV-SCEVAAKQQGVD---IAHLCRNSGMCVDTGNT--HFCRCQAGYTGSYCEEQVDECSPNPCQNGATCTDYLGGYSCECVAGYHGVNCSEEINECLSHPCHNGGTCIDLINTYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGGYNCICPPGFVGERCEGDVNECLSN--------------PCDPRGTQNCIQLVNDYRCECRQGFTGRRCDSVVDGCK------GLPCRNGGTCAVASNTERG----FICKCPPGFDGATCEYDARTCGNLRCQNGGTC----ISVLKSSKCVCSEGYTGATCQYPVVSPCASRPCYNGGTCQFSPEEPFFQCFCPTNFNGLFCHILDYG-FIGGLGKNITPPDNEEICENEQCAELADNKICNANCNNHACGWDGGDC-----------SLNFNDPWKNC----TQSLQCWKYFNDGKCDSQCNNSGCLYDGFDCQKVEVQCNPLYDQYCRDHFQDGHCDQGCNNAECEWDGLDC-DNMPENLAEGTLLIVVLMPPEKLKNNSVNFLRELSRVLHTNVVFKKDSKGEYKIYPYYGNEEELKKHHIKKRSAASWSDAPTAIFSTMKESVLPGRRRRELDQMEVRGSIVYLEIDNRQCYKSSSQCFTSATDVAAFLGALATHGNLNIPYKIEAVKIE----TAKPPPP-----------LYAMFSMLVIPLLIIFVIMVVIVNKKRRREHGQLWFPEGF--IPKEPSKKKRREPLGEDSVGLKPLKNLTDGSFMDDNQNEWGDEETLENKRFRFEEQVMLPELVDDQTDHRQWTQQHLDAADLRIPSMAPT---------------PPQGEIDADCMDVNVRGPDG--FTPLMIAACSGGGLETGNSEEEEDA----------------SANMISDFIGQG--------AQLHNQTDRTGETALHLAARYARADAAKRLLESSADANVPDNMGRTPLHAAVAADAQGVFQILIRNR--ATDLDARMCDGTTPLILAARLAVEGMVEELINAHA----DVNAVDEFGKSALHWAAAVNNVDAAAVLLKSSANKDMQNNKEETPLFLAAREGSYETAKVLLDHYANRDITDHMDRLPRDIAQERMHHDIVHLLDEH-NLVKSPTLH 2079          

HSP 2 Score: 598.586 bits (1542), Expect = 2.599e-174
Identity = 420/1228 (34.20%), Postives = 600/1228 (48.86%), Query Frame = 3
Query:  732 CPKNYLGMNCELPNSCGSQNPCGVNGKC---ILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTC--INTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKP--CQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCK---NIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLAL--YGLAVLS----------MSNSQIG-----PCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEI----------------KKTETCKSYAVE----------KFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISN--------PHG----------------PCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIP----CFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEIS 4163
            C  +Y G  C+ PN C  +N C   G C   +L N  +  CHC  G+T   C   +D  A    P C NGGTC  +++V  Y+C+C  G+ G+ C+     C ++ C NGG CL     Y C CP+ + G  C+     C   PC+NGG C +    Y+C C N++TG+NC++   PC  +PC N G C   +   Y+C C  GF G+ CE +ID+C   +C NGG+C++ +    C C P + G  C  +V+EC+  P  CQN   C +    Y C C  G TG++C  NID+C    C +GA C DRV  F C+C  G  GL C   +       PC     C + N       C CP G     C  ++ +C    N     G+C +     +C C  G+ G  CEI++NEC +NPCQ+ + C D   ++ CIC+PG++G  CE NI+ECA NPC  NG+C+D++  F C+C   ++G  C + +D C    C N A C+ G   +SY C C+     + G  CE+D++EC  D         G+A  +          + ++ I      PC N  QC +    +IC C     G  CE  L++C +NPC  G   D + DG+ C C  G+TG+ C I I+EC  NPC N   C D IN + C+C  G+    C    N+C  + C+ HG C D +NG++C C+  + G+NC+     C+SNPC+N G+C +      T  Y+C CR GF+GP C+  ++ C  NPC + G C  D+  +KC C   Y G  CE                 K++E  ++++ E          +      +N+ C++   C N    G +KC+C+ GY G  CE +IDDC   PC NGG C DG  M+FC C  GF+G  C+ + NEC SN C  G  C D +N+++C C  G SG  CE     C +  C NGG C + I  F C CP GF G  C+ DINEC      N      +        P G                PC   G  +C      + C CK  +TG YC+     CE   K   +     C N+G+C++        N +F C C  GY G  C+    +C  N C+N   C     D    + CEC  G  G+ C  + +NECLS  C+N G+C++      C C +G+ G  CEI        ++D+   + D +S
Sbjct:    6 CSSSYFGERCQYPNPCALKNQCMNFGTCEPVLLGNAIDFTCHCPVGFTDKVCLTPVDN-ACVNNP-CRNGGTCELLSSVSDYRCRCPPGWTGDSCQQ-ADPCASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCLNEFGSYRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPHGRTGLLCHLDNACISN--PCNEGSNC-DTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGYEGLYCETNIDECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCLDGP--NSYTCQCTEG---FTGRHCEQDINECIPDPCHYGTCKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNPCDYGKCIDKI-DGYECTCEPGYTGKMCNINIDECASNPCRNGGTCKDKINGFTCVCPDGYHDHMCLSEVNECNSNPCI-HGTCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDM-----TGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQN--TNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGINMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGG--KCWQTNNFYRCECKSGWTGVYCDVPSVSCEVAAKQQGVDIAHLCRNSGMCVDT------GNTHF-CRCQAGYTGSYCEEQVDECSPNPCQNGATC----TDYLGGYSCECVAGYHGVNCS-EEINECLSHPCHNGGTCIDLINTYKCSCPRGTQGVHCEI--------NVDDCTPFYDSVS 1191          

HSP 3 Score: 595.119 bits (1533), Expect = 3.395e-173
Identity = 439/1269 (34.59%), Postives = 611/1269 (48.15%), Query Frame = 3
Query:  381 IGAAILILLFCPIAISL--------NFCENHKCKNGATCQ--SDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDC--TNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCES--VNYQDYKCICQRGFEGKMCETSIDNCQKIS--CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQC--VDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEID-------YVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCE 4097
            +G AI     CP+  +         N C N+ C+NG TC+  S ++  Y C C  G+ G  C+Q   C   PC NGG C       +C+C + + G  C+   N C+ +PCRNGG C + E   Y C C   + G NCE P    + +PC   G C   +D   +C C  G++G  C  +ID+C S     C NGGTC++ V +Y C+C   + G+ C  D+ +C    + C+NGGTC +  G Y CVC N + G +C      C    C +G  C D    + C C +  TG  C  + N C  NPC     C++  VN +   C C  G+ G  C   +D C   +  C +GG C N +   +CNC  G+ G  CEI+VNEC + PCQN+A C+D   ++ C C  G  G  CE NIDEC  NPCL+  +C D++  F C+C  GF G  C+   D C   TPCK    CL+  N+   Y C C +G   ++C++++++C    C  G C D      C+C PG+ GR C+ +INEC + PCQ+G QC D  N Y+C C  G  G  CE N+++CA NPC   G+CID++ G+ C C   Y+G  C   +D C  N C N   C   +K + + C C      Y    C  +V+ECN +                    PC++   C +    + C C + + G  C+   N C +NPC NG TC ++   + C C AGF+G  C+  INEC  NPC N   CID +  Y+C C   ++G  CE     C+ S C   G+C   +    F C+C   + G  CE     C + PC N   C      QNT G Y CNC+ G+ G  CE  +D C+ NPC + G C   ++ F C C + + G +CE    E C S               CK+  NC +      + C+CQ G+ G  CE N  DC    C NGG C DG   + C+C PGF G  CQ + NEC S  C N G C D    + C CP+G +G  C+ +V +C    C+NGG C      + C C  G+ G  C+     C+        ++       C  +G   C+D   T  C C+  +TG YCE ++D C         PC N   C +           +SC C  GY G  C     +C  + C N G C    ID   ++KC CP G  G+ CEI+       Y +  L  KC+NNG C++  G   C C  G  GE+CE
Sbjct:   38 LGNAIDFTCHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVS-DYRCRCPPGWTGDSCQQADPCASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCLN-EFGSYRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNN---CRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPHGRTGLLC-HLDNACISNPCNEGSNCDTNPVNGKAI-CTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGYEGLYCETNIDECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECAS-TPCKNGAKCLDGPNS---YTCQCTEGFTGRHCEQDINECIPDPCHYGTCKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNPCDY-GKCIDKIDGYECTCEPGYTGKMCNINIDECASNPCRNGGTC--KDKINGFTCVCPDG---YHDHMCLSEVNECNSN--------------------PCIH-GTCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMC------QNTNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGINMFFCNCPAGFRGPKCEEDINE-CAS-------------NPCKNGANCTD--CVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECKSGWTGVYCDVPSVSCEVAAKQQGVDIAH----LCRNSGM--CVDTGNTHFCRCQAGYTGSYCEEQVDECSPN------PCQNGATCTDYLG-------GYSCECVAGYHGVNCSEEINECLSHPCHNGGTC----IDLINTYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGGYNCICPPGFVGERCE 1223          

HSP 4 Score: 80.1073 bits (196), Expect = 5.519e-14
Identity = 91/324 (28.09%), Postives = 128/324 (39.51%), Query Frame = 3
Query: 3384 SCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIG----DFECNCPKGFAGKLCETDI-NECKYNIA--GNATNLISN--------PHG---------------PCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKY-------QNE-VGRN------------------------YNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNEC--LSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEIS 4163
            S +C     G  C+       K +C N G C+ V+     DF C+CP GF  K+C T + N C  N    G    L+S+        P G               PC+  G  +CL     + C C   F G  C+  I+ C +       PC N G CLN++       QN   GRN                         ++ C C  G+ G+ C+ N   C  N C+N G C    +D   ++ C+CPP   G +C  D V+EC  +   C N G+C N +G   C C  G  GE C      C  A+  +  T  D ++
Sbjct:    3 SFLCSSSYFGERCQYPNPCALKNQCMNFGTCEPVLLGNAIDFTCHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVSDYRCRCPPGWTGDSCQQADPCASNPCANGG--KCLPFETQYICKCPSGFHGATCKQDINECSQN------PCRNGGQCLNEFGSYRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNNCRNGGTC----VDGVNTYNCQCPPDWTGQYCTED-VDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVA 313          
BLAST of Neurogenic locus notch protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 961.059 bits (2483), Expect = 0.000e+0
Identity = 684/2021 (33.84%), Postives = 987/2021 (48.84%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKM--------ECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAI--CHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSN-----------SVQQGK----------PGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRK--AEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNAS------SELGNIQQMTKSKISTTDSV--DDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQH 6332
            ++ C ++ C+NG TC   +N  Y C+C   + G YC E    C + P  CQNGGTC    G   C C+N W GE C E   +CA++ C +G  C    +  + C+CP    G+ C L N+C S NPC     C     +G+  C C  GYTG  C+ND+DEC+    P CE+GG C NT+GS+QC C  G+ G RCE D+ +C ++ C+N  TCLD+IG ++C+C   Y G  CE     C   PC + G C D   ++ C C   + G  C  DV               +  N   Y C C  GF G+ CE  I+ C    C  G +C + I    C C PG+ G  C+ ++NEC ++PCQN  +C D  N Y C CP+G TG NCE N+D+C  NPC  G +C D++ G+ C C  G+ G  C    D C    PC+    C +  N   G+ C+CPDG  +  C  E+++C +  CI+G C D  N  KC C  G+ G  C++  NEC +NPC +G  C+D+   Y+C C  GF G  C+ NINECA NPC   G CID+V G++C CMLPY+G  C   L PC+ + C N   C     Y+++ C C      ++G  CE D++EC ++R                   PC N   C NTNGS+ C C   Y GR CE  +++C+ NPC NG +C +  + F C C AGF G +CE +INEC  NPC N A C D +N Y C CQ GFSG +CE N  DCTESSC   G C+D +N F C+C   + G  C+H    CDS PCLN G+C      Q++ G Y C C +G+TG  C+  + WC  +PC + G C    + ++C+C S + G  C++    +C+  A ++  +   I  +C++ G C +   T    C CQ+GY GS+CE  +D+C+  PC NG  C D  G Y C+C  G+ GVNC    NEC S+ C N G CID IN + C CPRG  G  CE  VD C           +C N G C + +G + C CP GF G+ CE D+NEC  N              PC P GT  C+     + C C++ FTG+ C++ +D C+       +PC N G C      E G    F C CP G+ G  C+ +++ C    C+N G C    I    S KC C  G  G  C+   V+ C S  CYN G+C     +    C C     G  C I      +  +  + T  D    CE  +CA  ADNKIC+  CN +ACG+DGG+C            ++   PW NC    ++++ C  +FN+ +CD QCN   CL+DG+DC     QC PL   +C  H+ DG C   CN  EC +DG DC ++    +  G +L++ +   E +       L+ L+ +LH+ V   ++S G+  I+      E       K R   S S+           SV  G+           G+ VYLE+DN  C   S  CF ++   A F+ A   + +   P  I +V+        KP PP              +  +LV  L           +KK R+   ++W+PEG   + ++ S+   +  +  +    + L N  + S      +E G+ + +   +    + V   +   +     + T   ++  +    ++A +               PP+  +      +  R  +   F  +     SG GL   +  E  D                   N  +D   +           L ++   +GET LHLAA+Y R +AA+ LLE+ +D N  +  GR+ L  A+ A A  V    +  +    DL  +  +G+T LI A + A   +++ L+        D+N  DE+G++ALHWAA         +LL    N+D Q+N+E TPL+LA +EG  E  K+L+ + AN D++DH+DRLPRD+A+      IV LL+++ N+ K    H
Sbjct:  221 IDDCPSNNCRNGGTCVDGVN-TYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHD-RVASFFCECPHGRTGLLCHLDNACIS-NPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANP-CEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGYEGLYCETNIDECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCLDGPN--SYTCQCTEGFTGRHCEQDINECIPDPCHYG-TCKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNPCDYG-KCIDKIDGYECTCEPGYTGKMCNINIDECAS-NPCRNGGTCKDKIN---GFTCVCPDGYHDHMCLSEVNECNSNPCIHGTCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPG---WQGQTCEIDMNEC-VNR-------------------PCRNGAMCQNTNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGINMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTC------QDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECKSGWTGVYCDVPSV-SCEVAAKQQGVD---IAHLCRNSGMCVDTGNT--HFCRCQAGYTGSYCEEQVDECSPNPCQNGATCTDYLGGYSCECVAGYHGVNCSEEINECLSHPCHNGGTCIDLINTYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGGYNCICPPGFVGERCEGDVNECLSN--------------PCDPRGTQNCIQLVNDYRCECRQGFTGRRCDSVVDGCK------GLPCRNGGTCAVASNTERG----FICKCPPGFDGATCEYDARTCGNLRCQNGGTC----ISVLKSSKCVCSEGYTGATCQYPVVSPCASRPCYNGGTCQFSPEEPFFQCFCPTNFNGLFCHILDYG-FIGGLGKNITPPDNEEICENEQCAELADNKICNANCNNHACGWDGGDC-----------SLNFNDPWKNC----TQSLQCWKYFNDGKCDSQCNNSGCLYDGFDCQKVEVQCNPLYDQYCRDHFQDGHCDQGCNNAECEWDGLDC-DNMPENLAEGTLLIVVLMPPEKLKNNSVNFLRELSRVLHTNVVFKKDSKGEYKIYPYYGNEEELKKHHIKKRSAASWSDAPTAIFSTMKESVLPGRRRRELDQMEVRGSIVYLEIDNRQCYKSSSQCFTSATDVAAFLGALATHGNLNIPYKIEAVKIE----TAKPPPP-----------LYAMFSMLVIPLLIIFVIMVVIVNKKRRREHGQLWFPEGF--IPKEPSKKKRREPLGEDSVGLKPLKNLTDGSFMDDNQNEWGDEETLENKRFRFEEQVMLPELVDDQTDHRQWTQQHLDAADLRIPSMAPT---------------PPQGEIDADCMDVNVRGPDG--FTPLMIAACSGGGLETGNSEEEEDA----------------SANMISDFIGQG--------AQLHNQTDRTGETALHLAARYARADAAKRLLESSADANVPDNMGRTPLHAAVAADAQGVFQILIRNR--ATDLDARMCDGTTPLILAARLAVEGMVEELINAHA----DVNAVDEFGKSALHWAAAVNNVDAAAVLLKSSANKDMQNNKEETPLFLAAREGSYETAKVLLDHYANRDITDHMDRLPRDIAQERMHHDIVHLLDEH-NLVKSPTLH 2084          

HSP 2 Score: 599.356 bits (1544), Expect = 1.320e-174
Identity = 421/1230 (34.23%), Postives = 601/1230 (48.86%), Query Frame = 3
Query:  726 CQCPKNYLGMNCELPNSCGSQNPCGVNGKC---ILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTC--INTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKP--CQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCK---NIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLAL--YGLAVLS----------MSNSQIG-----PCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEI----------------KKTETCKSYAVE----------KFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISN--------PHG----------------PCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIP----CFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEIS 4163
            C C  +Y G  C+ PN C  +N C   G C   +L N  +  CHC  G+T   C   +D  A    P C NGGTC  +++V  Y+C+C  G+ G+ C+     C ++ C NGG CL     Y C CP+ + G  C+     C   PC+NGG C +    Y+C C N++TG+NC++   PC  +PC N G C   +   Y+C C  GF G+ CE +ID+C   +C NGG+C++ +    C C P + G  C  +V+EC+  P  CQN   C +    Y C C  G TG++C  NID+C    C +GA C DRV  F C+C  G  GL C   +       PC     C + N       C CP G     C  ++ +C    N     G+C +     +C C  G+ G  CEI++NEC +NPCQ+ + C D   ++ CIC+PG++G  CE NI+ECA NPC  NG+C+D++  F C+C   ++G  C + +D C    C N A C+ G   +SY C C+     + G  CE+D++EC  D         G+A  +          + ++ I      PC N  QC +    +IC C     G  CE  L++C +NPC  G   D + DG+ C C  G+TG+ C I I+EC  NPC N   C D IN + C+C  G+    C    N+C  + C+ HG C D +NG++C C+  + G+NC+     C+SNPC+N G+C +      T  Y+C CR GF+GP C+  ++ C  NPC + G C  D+  +KC C   Y G  CE                 K++E  ++++ E          +      +N+ C++   C N    G +KC+C+ GY G  CE +IDDC   PC NGG C DG  M+FC C  GF+G  C+ + NEC SN C  G  C D +N+++C C  G SG  CE     C +  C NGG C + I  F C CP GF G  C+ DINEC      N      +        P G                PC   G  +C      + C CK  +TG YC+     CE   K   +     C N+G+C++        N +F C C  GY G  C+    +C  N C+N   C     D    + CEC  G  G+ C  + +NECLS  C+N G+C++      C C +G+ G  CEI        ++D+   + D +S
Sbjct:    9 CLCSSSYFGERCQYPNPCALKNQCMNFGTCEPVLLGNAIDFTCHCPVGFTDKVCLTPVDN-ACVNNP-CRNGGTCELLSSVSDYRCRCPPGWTGDSCQQ-ADPCASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCLNEFGSYRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPHGRTGLLCHLDNACISN--PCNEGSNC-DTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGYEGLYCETNIDECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCLDGP--NSYTCQCTEG---FTGRHCEQDINECIPDPCHYGTCKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNPCDYGKCIDKI-DGYECTCEPGYTGKMCNINIDECASNPCRNGGTCKDKINGFTCVCPDGYHDHMCLSEVNECNSNPCI-HGTCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDM-----TGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQN--TNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGINMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGG--KCWQTNNFYRCECKSGWTGVYCDVPSVSCEVAAKQQGVDIAHLCRNSGMCVDT------GNTHF-CRCQAGYTGSYCEEQVDECSPNPCQNGATC----TDYLGGYSCECVAGYHGVNCS-EEINECLSHPCHNGGTCIDLINTYKCSCPRGTQGVHCEI--------NVDDCTPFYDSVS 1196          

HSP 3 Score: 594.349 bits (1531), Expect = 5.575e-173
Identity = 439/1269 (34.59%), Postives = 611/1269 (48.15%), Query Frame = 3
Query:  381 IGAAILILLFCPIAISL--------NFCENHKCKNGATCQ--SDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDC--TNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCES--VNYQDYKCICQRGFEGKMCETSIDNCQKIS--CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQC--VDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEID-------YVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCE 4097
            +G AI     CP+  +         N C N+ C+NG TC+  S ++  Y C C  G+ G  C+Q   C   PC NGG C       +C+C + + G  C+   N C+ +PCRNGG C + E   Y C C   + G NCE P    + +PC   G C   +D   +C C  G++G  C  +ID+C S     C NGGTC++ V +Y C+C   + G+ C  D+ +C    + C+NGGTC +  G Y CVC N + G +C      C    C +G  C D    + C C +  TG  C  + N C  NPC     C++  VN +   C C  G+ G  C   +D C   +  C +GG C N +   +CNC  G+ G  CEI+VNEC + PCQN+A C+D   ++ C C  G  G  CE NIDEC  NPCL+  +C D++  F C+C  GF G  C+   D C   TPCK    CL+  N+   Y C C +G   ++C++++++C    C  G C D      C+C PG+ GR C+ +INEC + PCQ+G QC D  N Y+C C  G  G  CE N+++CA NPC   G+CID++ G+ C C   Y+G  C   +D C  N C N   C   +K + + C C      Y    C  +V+ECN +                    PC++   C +    + C C + + G  C+   N C +NPC NG TC ++   + C C AGF+G  C+  INEC  NPC N   CID +  Y+C C   ++G  CE     C+ S C   G+C   +    F C+C   + G  CE     C + PC N   C      QNT G Y CNC+ G+ G  CE  +D C+ NPC + G C   ++ F C C + + G +CE    E C S               CK+  NC +      + C+CQ G+ G  CE N  DC    C NGG C DG   + C+C PGF G  CQ + NEC S  C N G C D    + C CP+G +G  C+ +V +C    C+NGG C      + C C  G+ G  C+     C+        ++       C  +G   C+D   T  C C+  +TG YCE ++D C         PC N   C +           +SC C  GY G  C     +C  + C N G C    ID   ++KC CP G  G+ CEI+       Y +  L  KC+NNG C++  G   C C  G  GE+CE
Sbjct:   43 LGNAIDFTCHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVS-DYRCRCPPGWTGDSCQQADPCASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCLN-EFGSYRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNN---CRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPHGRTGLLC-HLDNACISNPCNEGSNCDTNPVNGKAI-CTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGYEGLYCETNIDECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECAS-TPCKNGAKCLDGPNS---YTCQCTEGFTGRHCEQDINECIPDPCHYGTCKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNPCDY-GKCIDKIDGYECTCEPGYTGKMCNINIDECASNPCRNGGTC--KDKINGFTCVCPDG---YHDHMCLSEVNECNSN--------------------PCIH-GTCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMC------QNTNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGINMFFCNCPAGFRGPKCEEDINE-CAS-------------NPCKNGANCTD--CVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECKSGWTGVYCDVPSVSCEVAAKQQGVDIAH----LCRNSGM--CVDTGNTHFCRCQAGYTGSYCEEQVDECSPN------PCQNGATCTDYLG-------GYSCECVAGYHGVNCSEEINECLSHPCHNGGTC----IDLINTYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGGYNCICPPGFVGERCE 1228          
BLAST of Neurogenic locus notch protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 960.674 bits (2482), Expect = 0.000e+0
Identity = 683/2021 (33.80%), Postives = 987/2021 (48.84%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKM--------ECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAI--CHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSN-----------SVQQGK----------PGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRK--AEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNAS------SELGNIQQMTKSKISTTDSV--DDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQH 6332
            ++ C ++ C+NG TC   +N  Y C+C   + G YC E    C + P  CQNGGTC    G   C C+N W GE C E   +CA++ C +G  C    +  + C+CP    G+ C L N+C S NPC     C     +G+  C C  GYTG  C+ND+DEC+    P CE+GG C NT+GS+QC C  G+ G RCE D+ +C ++ C+N  TCLD+IG ++C+C   Y G  CE     C   PC + G C D   ++ C C   + G  C  DV               +  N   Y C C  GF G+ CE  I+ C    C  G +C + I    C C PG+ G  C+ ++NEC ++PCQN  +C D  N Y C CP+G TG NCE N+D+C  NPC  G +C D++ G+ C C  G+ G  C    D C    PC+    C +  N   G+ C+CPDG  +  C  E+++C +  CI+G C D  N  KC C  G+ G  C++  NEC +NPC +G  C+D+   Y+C C  GF G  C+ NINECA NPC   G CID+V G++C CMLPY+G  C   L PC+ + C N   C     Y+++ C C      ++G  CE D++EC ++R                   PC N   C NTNGS+ C C   Y GR CE  +++C+ NPC NG +C +  + F C C AGF G +CE +INEC  NPC N A C D +N Y C CQ GFSG +CE N  DCTESSC   G C+D +N F C+C   + G  C+H    CDS PCLN G+C      Q++ G Y C C +G+TG  C+  + WC  +PC + G C    + ++C+C S + G  C++    +C+  A ++  +   I  +C++ G C +   T    C CQ+GY GS+CE  +D+C+  PC NG  C D  G Y C+C  G+ GVNC    NEC S+ C N G CID IN + C CPRG  G  CE  VD C           +C N G C + +G + C CP GF G+ CE D+NEC  N              PC P GT  C+     + C C++ FTG+ C++ +D C+       +PC N G C      E G    F C CP G+ G  C+ +++ C    C+N G C    I    S KC C  G  G  C+   V+ C S  CYN G+C     +    C C     G  C I      +  +  + T  D    CE  +CA  ADNKIC+  CN +ACG+DGG+C            ++   PW NC    ++++ C  +FN+ +CD QCN   CL+DG+DC     QC PL   +C  H+ DG C   CN  EC +DG DC ++    +  G +L++ +   E +       L+ L+ +LH+ V   ++S G+  I+      E       K R   S S+           SV  G+           G+ VYLE+DN  C   S  CF ++   A F+ A   + +   P  I +V++      K P P               +  +LV  L           +KK R+   ++W+PEG   + ++ S+   +  +  +    + L N  + S      +E G+ + +   +    + V   +   +     + T   ++  +    ++A +               PP+  +      +  R  +   F  +     SG GL   +  E  D                   N  +D   +           L ++   +GET LHLAA+Y R +AA+ LLE+ +D N  +  GR+ L  A+ A A  V    +  +    DL  +  +G+T LI A + A   +++ L+        D+N  DE+G++ALHWAA         +LL    N+D Q+N+E TPL+LA +EG  E  K+L+ + AN D++DH+DRLPRD+A+      IV LL+++ N+ K    H
Sbjct:  270 IDDCPSNNCRNGGTCVDGVN-TYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHD-RVASFFCECPHGRTGLLCHLDNACIS-NPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANP-CEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGYEGLYCETNIDECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCLDGPN--SYTCQCTEGFTGRHCEQDINECIPDPCHYG-TCKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNPCDYG-KCIDKIDGYECTCEPGYTGKMCNINIDECAS-NPCRNGGTCKDKIN---GFTCVCPDGYHDHMCLSEVNECNSNPCIHGTCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPG---WQGQTCEIDMNEC-VNR-------------------PCRNGAMCQNTNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGINMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTC------QDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECKSGWTGVYCDVPSV-SCEVAAKQQGVD---IAHLCRNSGMCVDTGNT--HFCRCQAGYTGSYCEEQVDECSPNPCQNGATCTDYLGGYSCECVAGYHGVNCSEEINECLSHPCHNGGTCIDLINTYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGGYNCICPPGFVGERCEGDVNECLSN--------------PCDPRGTQNCIQLVNDYRCECRQGFTGRRCDSVVDGCK------GLPCRNGGTCAVASNTERG----FICKCPPGFDGATCEYDARTCGNLRCQNGGTC----ISVLKSSKCVCSEGYTGATCQYPVVSPCASRPCYNGGTCQFSPEEPFFQCFCPTNFNGLFCHILDYG-FIGGLGKNITPPDNEEICENEQCAELADNKICNANCNNHACGWDGGDC-----------SLNFNDPWKNC----TQSLQCWKYFNDGKCDSQCNNSGCLYDGFDCQKVEVQCNPLYDQYCRDHFQDGHCDQGCNNAECEWDGLDC-DNMPENLAEGTLLIVVLMPPEKLKNNSVNFLRELSRVLHTNVVFKKDSKGEYKIYPYYGNEEELKKHHIKKRSAASWSDAPTAIFSTMKESVLPGRRRRELDQMEVRGSIVYLEIDNRQCYKSSSQCFTSATDVAAFLGALATHGNLNIPYKIEAVKSEIVETAKPPPP------------LYAMFSMLVIPLLIIFVIMVVIVNKKRRREHGQLWFPEGF--IPKEPSKKKRREPLGEDSVGLKPLKNLTDGSFMDDNQNEWGDEETLENKRFRFEEQVMLPELVDDQTDHRQWTQQHLDAADLRIPSMAPT---------------PPQGEIDADCMDVNVRGPDG--FTPLMIAACSGGGLETGNSEEEEDA----------------SANMISDFIGQG--------AQLHNQTDRTGETALHLAARYARADAAKRLLESSADANVPDNMGRTPLHAAVAADAQGVFQILIRNR--ATDLDARMCDGTTPLILAARLAVEGMVEELINAHA----DVNAVDEFGKSALHWAAAVNNVDAAAVLLKSSANKDMQNNKEETPLFLAAREGSYETAKVLLDHYANRDITDHMDRLPRDIAQERMHHDIVHLLDEH-NLVKSPTLH 2136          

HSP 2 Score: 610.912 bits (1574), Expect = 2.973e-178
Identity = 444/1324 (33.53%), Postives = 628/1324 (47.43%), Query Frame = 3
Query:  387 AAILILL------FCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPI-TPCQNGGTCK-LIAGNNV---CQCLNEWVGEFC--EFSSNCASSPCRNGGICKSL-EIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIG-SYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMI----------------------------EGGKCN-----------CLPGFXXXX--XXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCING-QCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIP----CFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEIS 4163
            A+IL L       FCP            C NG  C+    G  VC C+  Y G  C+  + C +   C N GTC+ ++ GN +   C C   +  + C     + C ++PCRNGG C+ L  +  Y C+CP  + G +C+  + C S NPC   GKC L  + +  C C  G+ G TC  DI+EC+  + P C NGG C+N  GSY+C C+  F G  CE   V C    C NGGTC      SY C C   + G NCE     C    C+NGG C D    Y C C   WTG+ C +DV     +     NG      Y  Y C+C  G+ G+ C  +ID+C   +C +G +C + +                            EG  C+           C PG+ G     +++       PC++  +C +    + C+CP+G  G  CEI+++EC  NPC N A C D++G F C C+ G+ GL CET  D C    PC     C++  N    + C CP G     C+ ++ +C +  C NG +C+D  N   C C  GF GR CE +INEC  +PC +G+ C+D    + C+C PG+ G+ C+ +INEC   PC   GQC D   G+ C C    +G  C   LD C  N C +   CI  +K D Y C C      Y G  C  ++DEC  +                    PC N   C +    F C C   Y    C   +N C +NPC +G TC +  +G++C C AG++G  C++  NEC+ NPC N   C D    Y C C++GFSG NC+ N N+C  + CL  G C+D V G++C C   Y G  CE +  PC  +PC N G C   K +++   + C C  G+ G  CEI M+ C   PC +  +C+    S+KC C   Y G  CE    + C+                C + G+C +      F C+C +G+ G  CE +I++CAS PC NG  C D    Y C CQPGF G++C+ NT +C  +SC N G CID IN FSC CP G +G +C+  ++ C    C NGG C++  G ++C CP+G+ G  C+  +  C  +              PC   G  +C      + C CK  +TG YC+     CE   K   +     C N+G+C++        N +F C C  GY G  C+    +C  N C+N   C     D    + CEC  G  G+ C  + +NECLS  C+N G+C++      C C +G+ G  CEI        ++D+   + D +S
Sbjct:   14 ASILTLQLTFFPPFCPFQGLRCTQTAEMCLNGGRCEMTPGGTGVCLCSSSYFGERCQYPNPCALKNQCMNFGTCEPVLLGNAIDFTCHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVSDYRCRCPPGWTGDSCQQADPCAS-NPCANGGKC-LPFETQYICKCPSGFHGATCKQDINECS--QNP-CRNGGQCLNEFGSYRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGYEGLYCETNIDECAS-NPCLHNGKCVDKINE---FHCECPTGFNGNLCQHDVDECASTPCKNGAKCLDGPNSYTCQCTEGFTGRHCEQDINECIPDPCHYGT-CKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNPC-DYGKCI--DKIDGYECTCEPG---YTGKMCNINIDECASN--------------------PCRNGGTCKDKINGFTCVCPDGYHDHMCLSEVNECNSNPCIHG-TCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRC---KESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNTNGSYKCNCKPGYAGRHCET-DIDDCQP-------------NPCHNGGSCSDG--INMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSS--------------PCKNGG--KCWQTNNFYRCECKSGWTGVYCDVPSVSCEVAAKQQGVDIAHLCRNSGMCVDT------GNTHF-CRCQAGYTGSYCEEQVDECSPNPCQNGATC----TDYLGGYSCECVAGYHGVNCS-EEINECLSHPCHNGGTCIDLINTYKCSCPRGTQGVHCEI--------NVDDCTPFYDSVS 1245          

HSP 3 Score: 594.349 bits (1531), Expect = 9.507e-173
Identity = 439/1269 (34.59%), Postives = 611/1269 (48.15%), Query Frame = 3
Query:  381 IGAAILILLFCPIAISL--------NFCENHKCKNGATCQ--SDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDC--TNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCES--VNYQDYKCICQRGFEGKMCETSIDNCQKIS--CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQC--VDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEID-------YVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCE 4097
            +G AI     CP+  +         N C N+ C+NG TC+  S ++  Y C C  G+ G  C+Q   C   PC NGG C       +C+C + + G  C+   N C+ +PCRNGG C + E   Y C C   + G NCE P    + +PC   G C   +D   +C C  G++G  C  +ID+C S     C NGGTC++ V +Y C+C   + G+ C  D+ +C    + C+NGGTC +  G Y CVC N + G +C      C    C +G  C D    + C C +  TG  C  + N C  NPC     C++  VN +   C C  G+ G  C   +D C   +  C +GG C N +   +CNC  G+ G  CEI+VNEC + PCQN+A C+D   ++ C C  G  G  CE NIDEC  NPCL+  +C D++  F C+C  GF G  C+   D C   TPCK    CL+  N+   Y C C +G   ++C++++++C    C  G C D      C+C PG+ GR C+ +INEC + PCQ+G QC D  N Y+C C  G  G  CE N+++CA NPC   G+CID++ G+ C C   Y+G  C   +D C  N C N   C   +K + + C C      Y    C  +V+ECN +                    PC++   C +    + C C + + G  C+   N C +NPC NG TC ++   + C C AGF+G  C+  INEC  NPC N   CID +  Y+C C   ++G  CE     C+ S C   G+C   +    F C+C   + G  CE     C + PC N   C      QNT G Y CNC+ G+ G  CE  +D C+ NPC + G C   ++ F C C + + G +CE    E C S               CK+  NC +      + C+CQ G+ G  CE N  DC    C NGG C DG   + C+C PGF G  CQ + NEC S  C N G C D    + C CP+G +G  C+ +V +C    C+NGG C      + C C  G+ G  C+     C+        ++       C  +G   C+D   T  C C+  +TG YCE ++D C         PC N   C +           +SC C  GY G  C     +C  + C N G C    ID   ++KC CP G  G+ CEI+       Y +  L  KC+NNG C++  G   C C  G  GE+CE
Sbjct:   92 LGNAIDFTCHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVS-DYRCRCPPGWTGDSCQQADPCASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCLN-EFGSYRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNN---CRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPHGRTGLLC-HLDNACISNPCNEGSNCDTNPVNGKAI-CTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGYEGLYCETNIDECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECAS-TPCKNGAKCLDGPNS---YTCQCTEGFTGRHCEQDINECIPDPCHYGTCKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNPCDY-GKCIDKIDGYECTCEPGYTGKMCNINIDECASNPCRNGGTC--KDKINGFTCVCPDG---YHDHMCLSEVNECNSN--------------------PCIH-GTCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMC------QNTNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGINMFFCNCPAGFRGPKCEEDINE-CAS-------------NPCKNGANCTD--CVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECKSGWTGVYCDVPSVSCEVAAKQQGVDIAH----LCRNSGM--CVDTGNTHFCRCQAGYTGSYCEEQVDECSPN------PCQNGATCTDYLG-------GYSCECVAGYHGVNCSEEINECLSHPCHNGGTC----IDLINTYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGGYNCICPPGFVGERCE 1277          
BLAST of Neurogenic locus notch protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 960.288 bits (2481), Expect = 0.000e+0
Identity = 683/2021 (33.80%), Postives = 987/2021 (48.84%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKM--------ECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAI--CHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSN-----------SVQQGK----------PGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRK--AEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNAS------SELGNIQQMTKSKISTTDSV--DDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQH 6332
            ++ C ++ C+NG TC   +N  Y C+C   + G YC E    C + P  CQNGGTC    G   C C+N W GE C E   +CA++ C +G  C    +  + C+CP    G+ C L N+C S NPC     C     +G+  C C  GYTG  C+ND+DEC+    P CE+GG C NT+GS+QC C  G+ G RCE D+ +C ++ C+N  TCLD+IG ++C+C   Y G  CE     C   PC + G C D   ++ C C   + G  C  DV               +  N   Y C C  GF G+ CE  I+ C    C  G +C + I    C C PG+ G  C+ ++NEC ++PCQN  +C D  N Y C CP+G TG NCE N+D+C  NPC  G +C D++ G+ C C  G+ G  C    D C    PC+    C +  N   G+ C+CPDG  +  C  E+++C +  CI+G C D  N  KC C  G+ G  C++  NEC +NPC +G  C+D+   Y+C C  GF G  C+ NINECA NPC   G CID+V G++C CMLPY+G  C   L PC+ + C N   C     Y+++ C C      ++G  CE D++EC ++R                   PC N   C NTNGS+ C C   Y GR CE  +++C+ NPC NG +C +  + F C C AGF G +CE +INEC  NPC N A C D +N Y C CQ GFSG +CE N  DCTESSC   G C+D +N F C+C   + G  C+H    CDS PCLN G+C      Q++ G Y C C +G+TG  C+  + WC  +PC + G C    + ++C+C S + G  C++    +C+  A ++  +   I  +C++ G C +   T    C CQ+GY GS+CE  +D+C+  PC NG  C D  G Y C+C  G+ GVNC    NEC S+ C N G CID IN + C CPRG  G  CE  VD C           +C N G C + +G + C CP GF G+ CE D+NEC  N              PC P GT  C+     + C C++ FTG+ C++ +D C+       +PC N G C      E G    F C CP G+ G  C+ +++ C    C+N G C    I    S KC C  G  G  C+   V+ C S  CYN G+C     +    C C     G  C I      +  +  + T  D    CE  +CA  ADNKIC+  CN +ACG+DGG+C            ++   PW NC    ++++ C  +FN+ +CD QCN   CL+DG+DC     QC PL   +C  H+ DG C   CN  EC +DG DC ++    +  G +L++ +   E +       L+ L+ +LH+ V   ++S G+  I+      E       K R   S S+           SV  G+           G+ VYLE+DN  C   S  CF ++   A F+ A   + +   P  I +V++      K P P               +  +LV  L           +KK R+   ++W+PEG   + ++ S+   +  +  +    + L N  + S      +E G+ + +   +    + V   +   +     + T   ++  +    ++A +               PP+  +      +  R  +   F  +     SG GL   +  E  D                   N  +D   +           L ++   +GET LHLAA+Y R +AA+ LLE+ +D N  +  GR+ L  A+ A A  V    +  +    DL  +  +G+T LI A + A   +++ L+        D+N  DE+G++ALHWAA         +LL    N+D Q+N+E TPL+LA +EG  E  K+L+ + AN D++DH+DRLPRD+A+      IV LL+++ N+ K    H
Sbjct:  257 IDDCPSNNCRNGGTCVDGVN-TYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHD-RVASFFCECPHGRTGLLCHLDNACIS-NPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANP-CEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGYEGLYCETNIDECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCLDGPN--SYTCQCTEGFTGRHCEQDINECIPDPCHYG-TCKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNPCDYG-KCIDKIDGYECTCEPGYTGKMCNINIDECAS-NPCRNGGTCKDKIN---GFTCVCPDGYHDHMCLSEVNECNSNPCIHGTCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPG---WQGQTCEIDMNEC-VNR-------------------PCRNGAMCQNTNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGINMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTC------QDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECKSGWTGVYCDVPSV-SCEVAAKQQGVD---IAHLCRNSGMCVDTGNT--HFCRCQAGYTGSYCEEQVDECSPNPCQNGATCTDYLGGYSCECVAGYHGVNCSEEINECLSHPCHNGGTCIDLINTYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGGYNCICPPGFVGERCEGDVNECLSN--------------PCDPRGTQNCIQLVNDYRCECRQGFTGRRCDSVVDGCK------GLPCRNGGTCAVASNTERG----FICKCPPGFDGATCEYDARTCGNLRCQNGGTC----ISVLKSSKCVCSEGYTGATCQYPVVSPCASRPCYNGGTCQFSPEEPFFQCFCPTNFNGLFCHILDYG-FIGGLGKNITPPDNEEICENEQCAELADNKICNANCNNHACGWDGGDC-----------SLNFNDPWKNC----TQSLQCWKYFNDGKCDSQCNNSGCLYDGFDCQKVEVQCNPLYDQYCRDHFQDGHCDQGCNNAECEWDGLDC-DNMPENLAEGTLLIVVLMPPEKLKNNSVNFLRELSRVLHTNVVFKKDSKGEYKIYPYYGNEEELKKHHIKKRSAASWSDAPTAIFSTMKESVLPGRRRRELDQMEVRGSIVYLEIDNRQCYKSSSQCFTSATDVAAFLGALATHGNLNIPYKIEAVKSEIVETAKPPPP------------LYAMFSMLVIPLLIIFVIMVVIVNKKRRREHGQLWFPEGF--IPKEPSKKKRREPLGEDSVGLKPLKNLTDGSFMDDNQNEWGDEETLENKRFRFEEQVMLPELVDDQTDHRQWTQQHLDAADLRIPSMAPT---------------PPQGEIDADCMDVNVRGPDG--FTPLMIAACSGGGLETGNSEEEEDA----------------SANMISDFIGQG--------AQLHNQTDRTGETALHLAARYARADAAKRLLESSADANVPDNMGRTPLHAAVAADAQGVFQILIRNR--ATDLDARMCDGTTPLILAARLAVEGMVEELINAHA----DVNAVDEFGKSALHWAAAVNNVDAAAVLLKSSANKDMQNNKEETPLFLAAREGSYETAKVLLDHYANRDITDHMDRLPRDIAQERMHHDIVHLLDEH-NLVKSPTLH 2123          

HSP 2 Score: 613.609 bits (1581), Expect = 3.275e-179
Identity = 443/1321 (33.54%), Postives = 630/1321 (47.69%), Query Frame = 3
Query:  381 IGAAILILLFCPIAISLNFCENHK-CKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPI-TPCQNGGTCK-LIAGNNV---CQCLNEWVGEFC--EFSSNCASSPCRNGGICKSL-EIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIG-SYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMI----------------------------EGGKCN-----------CLPGFXXXX--XXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCING-QCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIP----CFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEIS 4163
            IG  +LI     +A  L   +  + C NG  C+    G  VC C+  Y G  C+  + C +   C N GTC+ ++ GN +   C C   +  + C     + C ++PCRNGG C+ L  +  Y C+CP  + G +C+  + C S NPC   GKC L  + +  C C  G+ G TC  DI+EC+  + P C NGG C+N  GSY+C C+  F G  CE   V C    C NGGTC      SY C C   + G NCE     C    C+NGG C D    Y C C   WTG+ C +DV     +     NG      Y  Y C+C  G+ G+ C  +ID+C   +C +G +C + +                            EG  C+           C PG+ G     +++       PC++  +C +    + C+CP+G  G  CEI+++EC  NPC N A C D++G F C C+ G+ GL CET  D C    PC     C++  N    + C CP G     C+ ++ +C +  C NG +C+D  N   C C  GF GR CE +INEC  +PC +G+ C+D    + C+C PG+ G+ C+ +INEC   PC   GQC D   G+ C C    +G  C   LD C  N C +   CI  +K D Y C C      Y G  C  ++DEC  +                    PC N   C +    F C C   Y    C   +N C +NPC +G TC +  +G++C C AG++G  C++  NEC+ NPC N   C D    Y C C++GFSG NC+ N N+C  + CL  G C+D V G++C C   Y G  CE +  PC  +PC N G C   K +++   + C C  G+ G  CEI M+ C   PC +  +C+    S+KC C   Y G  CE    + C+                C + G+C +      F C+C +G+ G  CE +I++CAS PC NG  C D    Y C CQPGF G++C+ NT +C  +SC N G CID IN FSC CP G +G +C+  ++ C    C NGG C++  G ++C CP+G+ G  C+  +  C  +              PC   G  +C      + C CK  +TG YC+     CE   K   +     C N+G+C++        N +F C C  GY G  C+    +C  N C+N   C     D    + CEC  G  G+ C  + +NECLS  C+N G+C++      C C +G+ G  CEI        ++D+   + D +S
Sbjct:    4 IGLLVLIWSLLGLAQGLRCTQTAEMCLNGGRCEMTPGGTGVCLCSSSYFGERCQYPNPCALKNQCMNFGTCEPVLLGNAIDFTCHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVSDYRCRCPPGWTGDSCQQADPCAS-NPCANGGKC-LPFETQYICKCPSGFHGATCKQDINECS--QNP-CRNGGQCLNEFGSYRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGYEGLYCETNIDECAS-NPCLHNGKCVDKINE---FHCECPTGFNGNLCQHDVDECASTPCKNGAKCLDGPNSYTCQCTEGFTGRHCEQDINECIPDPCHYGT-CKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNPC-DYGKCI--DKIDGYECTCEPG---YTGKMCNINIDECASN--------------------PCRNGGTCKDKINGFTCVCPDGYHDHMCLSEVNECNSNPCIHG-TCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRC---KESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNTNGSYKCNCKPGYAGRHCET-DIDDCQP-------------NPCHNGGSCSDG--INMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSS--------------PCKNGG--KCWQTNNFYRCECKSGWTGVYCDVPSVSCEVAAKQQGVDIAHLCRNSGMCVDT------GNTHF-CRCQAGYTGSYCEEQVDECSPNPCQNGATC----TDYLGGYSCECVAGYHGVNCS-EEINECLSHPCHNGGTCIDLINTYKCSCPRGTQGVHCEI--------NVDDCTPFYDSVS 1232          

HSP 3 Score: 594.349 bits (1531), Expect = 9.072e-173
Identity = 439/1269 (34.59%), Postives = 611/1269 (48.15%), Query Frame = 3
Query:  381 IGAAILILLFCPIAISL--------NFCENHKCKNGATCQ--SDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDC--TNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCES--VNYQDYKCICQRGFEGKMCETSIDNCQKIS--CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQC--VDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEID-------YVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCE 4097
            +G AI     CP+  +         N C N+ C+NG TC+  S ++  Y C C  G+ G  C+Q   C   PC NGG C       +C+C + + G  C+   N C+ +PCRNGG C + E   Y C C   + G NCE P    + +PC   G C   +D   +C C  G++G  C  +ID+C S     C NGGTC++ V +Y C+C   + G+ C  D+ +C    + C+NGGTC +  G Y CVC N + G +C      C    C +G  C D    + C C +  TG  C  + N C  NPC     C++  VN +   C C  G+ G  C   +D C   +  C +GG C N +   +CNC  G+ G  CEI+VNEC + PCQN+A C+D   ++ C C  G  G  CE NIDEC  NPCL+  +C D++  F C+C  GF G  C+   D C   TPCK    CL+  N+   Y C C +G   ++C++++++C    C  G C D      C+C PG+ GR C+ +INEC + PCQ+G QC D  N Y+C C  G  G  CE N+++CA NPC   G+CID++ G+ C C   Y+G  C   +D C  N C N   C   +K + + C C      Y    C  +V+ECN +                    PC++   C +    + C C + + G  C+   N C +NPC NG TC ++   + C C AGF+G  C+  INEC  NPC N   CID +  Y+C C   ++G  CE     C+ S C   G+C   +    F C+C   + G  CE     C + PC N   C      QNT G Y CNC+ G+ G  CE  +D C+ NPC + G C   ++ F C C + + G +CE    E C S               CK+  NC +      + C+CQ G+ G  CE N  DC    C NGG C DG   + C+C PGF G  CQ + NEC S  C N G C D    + C CP+G +G  C+ +V +C    C+NGG C      + C C  G+ G  C+     C+        ++       C  +G   C+D   T  C C+  +TG YCE ++D C         PC N   C +           +SC C  GY G  C     +C  + C N G C    ID   ++KC CP G  G+ CEI+       Y +  L  KC+NNG C++  G   C C  G  GE+CE
Sbjct:   79 LGNAIDFTCHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVS-DYRCRCPPGWTGDSCQQADPCASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCLN-EFGSYRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNN---CRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPHGRTGLLC-HLDNACISNPCNEGSNCDTNPVNGKAI-CTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGYEGLYCETNIDECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECAS-TPCKNGAKCLDGPNS---YTCQCTEGFTGRHCEQDINECIPDPCHYGTCKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENGYICTCPKGTTGVNCETNLDDCASNPCDY-GKCIDKIDGYECTCEPGYTGKMCNINIDECASNPCRNGGTC--KDKINGFTCVCPDG---YHDHMCLSEVNECNSN--------------------PCIH-GTCHDGINGYKCDCDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMC------QNTNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGINMFFCNCPAGFRGPKCEEDINE-CAS-------------NPCKNGANCTD--CVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECKSGWTGVYCDVPSVSCEVAAKQQGVDIAH----LCRNSGM--CVDTGNTHFCRCQAGYTGSYCEEQVDECSPN------PCQNGATCTDYLG-------GYSCECVAGYHGVNCSEEINECLSHPCHNGGTC----IDLINTYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGGYNCICPPGFVGERCE 1264          
BLAST of Neurogenic locus notch protein vs. Ensembl Mouse
Match: Notch1 (notch 1 [Source:MGI Symbol;Acc:MGI:97363])

HSP 1 Score: 982.245 bits (2538), Expect = 0.000e+0
Identity = 684/2023 (33.81%), Postives = 987/2023 (48.79%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYC--------KKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECL-STKCYNNGSC----VNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTK--------------VYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNAS------SELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNF----PPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQHRPLMWG 6350
            ++ C  + CKNG  C   +N  Y C C   + G YC E    C + P  CQNGGTC    G   C C+N W GE C E   +CAS+ C  G  C    +  + C+CP    G+ C L ++C S NPC     C     +G+  C C  GYTG  CS D+DECA    P CE+ G C+NT+GS++C+C  G+ G RCE D+ +C ++ C+N  TCLD+IG ++C+C   Y G  CE     C   PC + G C D   ++QC C   + G  C  DV               +  N   Y C+C  G+ G  CE  ID C    C  G SC + +    C C PG+ G++CE N+NEC ++PC++   C D +N Y C C +G TG NCEIN+D+C  NPC +G  C D++ G+ C C  G+ G  C    D C   +PC     C    +  +G+ C CP+G  +  C  E+++C +  CI+G C D  N  KC C PG+ G  C+I  NEC +NPC +G  C+D+ + Y+C C  GF G  C+ NINECA NPC   G CID+V G++C C LPY+G TC   L PC  + C N  +C     Y+S+ C C T    ++G  CE D++EC                       PC +   C NTNGS+ C C + Y GR CE  +++CR NPC NG +C +  +   C C+ GF G  CE +INEC  NPC N A C D ++ Y C C  GF+G +CE N  DCTESSC   G CVD +N F C C   + G+ C++    CDS PCL+ G+C      Q++ G Y C C +G+TG  C+  + WC   PC + G C      + C+C S + G  C++    +C+  A ++  + +L   +C+H G C +  E     C CQ+GY GS+CE  +D+C+  PC NG  C D  G + CKC  G+ G NC    NEC S  C N G CID  N++ C CPRG  G  CE  VD C        +  +C N G C + +G + C CP GF G+ CE D+NEC  N              PC P GT  C+ R   FHC C+   TG+ CE+ I+ C         PC N G+C        G    F C CP G+ G  C+ +++ C    C N G C    I    S  C C     G  C+    + C+ S  CYN G+C     N F + +C       G  C I   +    +  +    Q E + CEL +C   A NK+C+L+CN +ACG+DGG+C            ++   PW NC    ++++ C  +F++  CD QCN+  CLFDG+DC    GQC PL   +C  H++DG C   CN+ EC +DG DC E     +  G ++L+ +   + +       L+ L+H+LH+ V   R++ GQQMIF      E       K       ++S+  G  G +              VYLE+DN  C   S  CF ++   A F+ A     S   P  I +V++      +  EPP      L+ +     + +        +  K     ++ +  ++W+PEG K    + S+   +  +  +    + L N  + +      +E G+    TK K    + V     +  T  R  + +                   L   D+ M+     PP+  +      +  R  + +    IA+   SG GL   +  E  D   ++   +    +  ++T++                         +GET LHLAA+Y+R +AA+ LLEA +D N  +  GR+ L  A+ A A  V    L  +    DL  +  +G+T LI A + A   +++ L+        D+N  D+ G++ALHWAA         +LL  G N+D Q+N+E TPL+LA +EG  E  K+L+ + AN D++DH+DRLPRD+A+      IV LL++Y N+ +  Q H   + G
Sbjct:  258 VDDCPGNNCKNGGACVDGVN-TYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHD-RVASFYCECPHGRTGLLCHLNDACIS-NPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANP-CEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLDGPNT--YTCVCTEGYTGTHCEVDIDECDPDPCHYG-SCKDGVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCLKGTTGPNCEINLDDCASNPCDSGT-CLDKIDGYECACEPGYTGSMCNVNIDECAG-SPCHNGGTC---EDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTG---WQGQTCEVDINEC--------------------VKSPCRHGASCQNTNGSYRCLCQAGYTGRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTC------QDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQYHCECRSGWTGVNCDVLSV-SCEVAAQKRGIDVTL---LCQHGGLCVD--EGDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSN--------------PCDPRGTQNCVQRVNDFHCECRAGHTGRRCESVINGCR------GKPCKNGGVCAVASNTARG----FICRCPAGFEGATCENDARTCGSLRCLNGGTC----ISGPRSPTCLCLGSFTGPECQFPASSPCVGSNPCYNQGTCEPTSENPFYRCLCPAKFN--GLLCHILDYSFTGGAGRDIPPPQIEEA-CELPECQVDAGNKVCNLQCNNHACGWDGGDC-----------SLNFNDPWKNC----TQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQLTEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVLVVLLPPDQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQMIFPYYGHEEELRKHPIKRSTVGWATSSLLPGTSGGRQRRELDPMDIRGSIVYLEIDNRQCVQSSSQCFQSATDVAAFLGALASLGSLNIPYKIEAVKS------EPVEPPLPSQLHLMYVAAAAFVLLFFVGCGVLLSRK-----RRRQHGQLWFPEGFKV--SEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQNEWGDEDLETK-KFRFEEPVVLPDLSDQTDHRQWTQQH------------------LDAADLRMSAMAPTPPQGEVDADCMDVNVRGPDGFTPLMIAS--CSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDR-------------------------TGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILLRNR--ATDLDARMHDGTTPLILAARLAVEGMLEDLINSHA----DVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEY-NLVRSPQLHGTALGG 2121          

HSP 2 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 431/1242 (34.70%), Postives = 612/1242 (49.28%), Query Frame = 3
Query:  453 CKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLI-AGNNV---CQCLNEWVGEFC--EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDK-IGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCI--DLNNDYTCDCPEGLTGKNCEINIDECT--PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCE--TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLN----------VCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKC 4094
            C NG  C+   NG   C C+  + G  C+  + C  TPC+N GTC ++  G  V   C C   + G  C     + C ++PCRNGG C  L + +Y+C+CP  + G +C+  + C S NPC   G+C L  +    C C  G+ G TC  D++EC S    LC +GGTC N +GSY+C C+A   G  CE   V C+   C+NGGTC      ++ C C   + G NCE     C    CKNGG C D    Y C C  +WTG+ C +DV     +     NG      +  Y C+C  G+ G+ C  +ID+C   +CF G +C + +    C C P           + C + PC   + C    +N    C CP G TG  C  ++DEC    NPC +  +C + +G F CQCLQG+ G RCE   + C    PC+ +  CL   +    ++CIC  G +   C+    +C +  C+ NG C+D  NE +C C  GF G  C+ +++EC + PC++G++C D  N Y C+C  G+ G  CE++I+EC  +PC   G C D V  F C C   Y+G  C   ++ C+   C +   C   ++ +SY C C   L    G  CE ++D+C  +                    PC +   C++    + C C   Y G  C   ++ C  +PC NG TC++   GF CRC  G+    C  E+NEC  NPC + A C D +N Y+C C  G+SG NC+IN+N+C  + C+  G C D  +G+ C C E + G NC+     C SNPCLN+G+CI+     +  GY CNC   +TG  CE+ +  C  +PC + GVC+   D +SF C C + + G+ CE+   E  KS               C+H  +C N    G ++C CQ+GY G  CE +IDDC   PC NGG C DG    FC C PGFQG  C+ + NEC SN C  G  C D +++++C CP G +G  CE     C +  C NGG C + I  F C CP GF G  C+ D+NEC                 PC   GT  C D  GT+ C+C + +TG  C+  + +C+      + PC N G C          N  + C C +G+ G  C + S  C++           +C++ G+C    +D+     C C  G  G +CE D V+EC    C N  +C +  G   C C  G  G  C
Sbjct:   31 CLNGGRCEV-ANGTEACVCSGAFVGQRCQDSNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCAS-NPCANGGQC-LPFESSYICRCPPGFHGPTCRQDVNEC-SQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCEC-PHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECIS-NPCQNDATCL---DQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHY-GSCKDGVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQ--DRDNSYLCLC---LKGTTGPNCEINLDDCASN--------------------PC-DSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGA-CRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCID-----DVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKS--------------PCRHGASCQN--TNGSYRCLCQAGYTGRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSR--------------PCLHGGT--CQDSYGTYKCTCPQGYTGLNCQNLVRWCD------SAPCKNGGRCWQT-------NTQYHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLC----VDEGDKHYCHCQAGYTGSYCE-DEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNC 1180          

HSP 3 Score: 473.781 bits (1218), Expect = 2.855e-134
Identity = 376/1113 (33.78%), Postives = 519/1113 (46.63%), Query Frame = 3
Query: 1032 TCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDE----DYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKP--CQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFT---CQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNI--VCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLP--YSGPTCANKLDPC--NPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTE----------TCKSYAV-------EKFKNESLINKICK------HHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNV--IGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNP--HGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGI-----------CLNKYQ--------NEVGRNY------------NFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDN 4136
            TC NGG C    G+  CVC   + G  C++    C   PCKN G C   D     DY C C   ++G  C   + N C  NPC+N G C+ +   +YKC C  G+ GK C+ + D C    C NGG C+       C C PGF G  C  +VNEC   P  C++   C +    Y C C    TG +CE+    C+P+PC NG  C  R  G T   C CL GF G  CE   D C     CK    C++  NT   Y C CP     Q C +++ +C+ +   C N G C + +    C+C+ G+ G  C   I++C +  C  G+ C D    + C C  G  G  C +N + C  NPC     C       +  C  P  Y+GP C+  +D C    N C +   C+  N   S+ C C   L  Y G +CE DV+EC                +SN    PC ND  C++  G F C C   YEG  CE   + C ++PC +   C +  + F+C+C  GF G  C+ +++EC   PC N AKC+D  N Y C+C  G++G +CE++ ++C    C  +G C D V  F C C   Y G +CE     C S PC + G+C +R  +     YLC C +G TGP CEI +D C  NPC D G C   +D ++C C   Y G  C +   E          TC+           E + + + ++++ +       HG C +     G+KC C  G+ G+ C++N ++C S PC+NGG C D T  Y C C+ GF G NCQ N NEC SN C N G CID +  + C CP   +G  CE ++  C    C+N G+CK       F C CP G+ G+ CE DINEC           + +P  HG         C +  G++ C C+  +TG+ CE+ ID C         PC N G            CL  +Q        NE   N             +++C CP G+ G  C+ N+  C  + C N G C    +D   SF C CPPG  G +C+ D VNEC S  C + G+C + +G   C C +G  G  C+     C+ A   N
Sbjct:   30 TCLNGGRCEVANGTEACVCSGAFVGQRCQDSNP-CLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQA-DPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTC--RPTGDTTHECACLPGFAGQNCEENVDDCPGNN-CKNGGACVDGVNT---YNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPHGRTGLLCHLN-DACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCL--NTLGSFECQC---LQGYTGPRCEIDVNEC----------------ISN----PCQNDATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCH-YGSCKDGVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNS-----YLCLCLKGTTGPNCEINLDDCASNPC-DSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDG--LNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINEC-----------VKSPCRHG-------ASCQNTNGSYRCLCQAGYTGRNCESDIDDCRPN------PCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTC----VDGINSFTCLCPPGFTGSYCQYD-VNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKN 1070          

HSP 4 Score: 441.425 bits (1134), Expect = 3.922e-124
Identity = 343/1027 (33.40%), Postives = 480/1027 (46.74%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELP--------------------------------------NSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDC--------TESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGS--CINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDS---FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDD--CASQPCINGGECGDGT--GMYFCKCQPGFQGVNCQV 3317
            I +N C ++ C+N ATC   I G++ C C  GY+G YCE  ++ C  +PC + G C        CQC   + G  C++  + CAS+PC+NG  C     + Y C C + Y G +CE+                                       N C SQ PC   G C    D    C C KG TG  C  ++D+CAS       + GTC++ +  Y+C C+ G+ G  C  +I +C    C NGGTC D I  + C CP  Y    C ++   C   PC +G  CRD    Y+C C   W+G NCD   N C+ NPC N G C+ +    Y C C+ GF G  C+T+I+ C    C N G+CI+ + G KCNC   + G  CE+ +  C   PC+N+  C +  +   ++C CP G  G+ CE++I+EC  +PC +GA C++  G + C C  G+ G  CE+  D C+   PC     C +  NT     C C  G Q   C++++++C +  C NG  C D  +   C C  GF G  CE    +C  + C +G  C D  N + C+C PGF G  C+ ++NEC   PC   G C D    ++C C   Y+G  C N +  C+   C N   C   N    YHC C +    + G  C+     C +   +    G+ V  +       C +   C++      C C + Y G  CE  ++ C  NPC+NGATC +   GF C+CVAG+ G  C  EINEC   PC N   CID  N Y+C C  G  G +CEIN +DC            C  +G CVD+V G+ C C   ++G  CE     C SNPC  +G+  C+ R VN     + C CR G TG RCE  ++ CRG PC + GVC    ++   F C+C + + G  CE     TC S               C + G C + P +    C C   + G  C+         S PC N G C   +    Y C C   F G+ C +
Sbjct:  451 IDVNECISNPCQNDATCLDQI-GEFQCICMPGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLD-GPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCQPGYTGHHCETNINECHSQ-PCRHGGTC-QDRDNSYLCLCLKGTTGPNCEINLDDCASNPC----DSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGA-CRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMT-SGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQAGYTGRNCESDIDDCRP-NPCHNGGSCTDGINTAF---CDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNT--QYHCECRSG---WTGVNCDVLSVSCEVAAQK---RGIDVTLL-------CQHGGLCVDEGDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSNPCDPRGTQNCVQR-VND----FHCECRAGHTGRRCESVINGCRGKPCKNGGVCAVASNTARGFICRCPAGFEGATCE-NDARTCGSLR-------------CLNGGTCISGPRSP--TCLCLGSFTGPECQFPASSPCVGSNPCYNQGTCEPTSENPFYRCLCPAKFNGLLCHI 1427          

HSP 5 Score: 269.626 bits (688), Expect = 1.515e-71
Identity = 218/723 (30.15%), Postives = 311/723 (43.02%), Query Frame = 3
Query: 2364 GPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXG------------------------------------------ATCDNLA-DGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESS--CLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQ--INNFS-CVCPRGVSGRFCETIVDYCK--KMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDL---ECNKYACGFDGGECLHRVPKRIDGNDISIASPWS----NCEIIKSENIPCHN 4361
            G CLN  +C   NG+  C CS  + G++C+             G                                           TCD L    ++CRC  G++G+ C+ + + C  NPC+N  +C+   + Y C C  GF G  C  + N+C+++   C   G C +++  + C C   + G +CE    PC  +PC N G+C  R     T  + C C  GF G  CE  +D C GN C + G C   ++++ C+C  E+ G+            Y  E      L+   C++ G C N    GG+ C C +G+ G  C  NIDDCAS  C  G  C D    ++C+C  G  G+ C +N + C SN CN G   D   +N  + C CP G +G  C   VD C      C++ G C N +G FEC C +G+ G  CE D+NEC           ISN   PC    T  CLD+ G F C C   + G YCE   D C       + PC +NG C++K          F C CP G+ G  C+ +  +C    CKN   C    +D   ++ C C  G  G  CE+D ++EC    C+  GSC +G     C C  G  G  CE   + C+     +  T QD   +  L  C        C++   +C    C  D G CL     +IDG + +    ++    N  I +    PCHN
Sbjct:   29 GTCLNGGRCEVANGTEACVCSGAFVGQRCQDSNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQ-QADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTC--RPTGDTT--HECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQ------------YCTEDVDECQLMPNACQNGGTCHN--THGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPHGRTGLLCHLN-DACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNEC-----------ISN---PCQNDAT--CLDQIGEFQCICMPGYEGVYCEINTDEC------ASSPCLHNGHCMDKIN-------EFQCQCPKGFNGHLCQYDVDECASTPCKNGAKC----LDGPNTYTCVCTEGYTGTHCEVD-IDECDPDPCH-YGSCKDGVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDR-DNSYLCLCLKGTTGPNCEINLDDCASNPC--DSGTCL----DKIDGYECACEPGYTGSMCNVNIDECAGSPCHN 689          

HSP 6 Score: 207.994 bits (528), Expect = 6.839e-53
Identity = 173/587 (29.47%), Postives = 246/587 (41.91%), Query Frame = 3
Query:  411 CPIAISLNFCENHKCKNGATCQSDIN-----------------GKYVCECAYGYKGTYCEQKS-NCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCE-LPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYE-------TPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNC--------QKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPC--QNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC---EDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINE--CFNNPCQHGSQCQDLFND--YLCICLPGFKGKKCEI 2039
            C   I+  FC+      GA C+ DIN                   Y C C  G+ G +CE  + +C  + C NGGTC     +  C C   + G +C++  N C S PC +GG C+      Y+C CP+ Y G+NC+ L   C S  PC   G+C   N  +  C C  G+TG  C      C           T LC++GG C++    + C C+AG+ G  CE+++ +C+ + C+NG TC D +G + C C   Y G+NC  +   C  +PC+NGG C D    Y+C                                        C RG +G  CE ++D+C        +   CFN G+C++ + G  C C PGF G  CE +VNEC + PC  +    C+   ND+ C+C  G TG+ CE  I+ C   PC NG  C    +   GF C+C  GF G  CE  +  C  L        CLN                                 G C+       C+C+  F G  C+   +     +NPC +   C+    +  Y C+C   F G  C I
Sbjct:  922 CTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQD-SYGTYKCTCPQGYTGLNCQNLVRWCDSA-PCKNGGRCWQTNT-QYHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKC---------------------------------------SCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECRAGHTGRRCESVINGCRGKPCKNGGVCAVASNTARGFICRCPAGFEGATCENDARTCGSLR-------CLN--------------------------------GGTCISGPRSPTCLCLGSFTGPECQFPASSPCVGSNPCYNQGTCEPTSENPFYRCLCPAKFNGLLCHI 1427          

HSP 7 Score: 117.087 bits (292), Expect = 2.691e-25
Identity = 107/350 (30.57%), Postives = 145/350 (41.43%), Query Frame = 3
Query: 3222 SQP---CINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKC--IDQ--INNFSCVCPRGVSGRFCETIVD-YCKKMECQNGGICKNV-IGDFECNCPKGFAGKLCETDINECKYNIAGNATNLI-----------SNPHGPCSPTGTLECLDRP-------------GTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNEC--LSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEIS 4163
            SQP   C+NGG C    G   C C   F G  CQ ++N C S  C N G C  +D     +++C CP G SG  C T +D  C    C+NGG C  + + +++C CP G++GK C+   + C  N   N    +              HGP       EC   P             G++ C+C+   TG +CE     C         PC N G C          +    C C  G+ G+ C+ N   C  N CKN G C    +D   ++ C CPP   G +C  D V+EC  +   C N G+C N  G   C C  G  GE C      C  A+     T  D ++
Sbjct:   25 SQPSGTCLNGGRCEVANGTEACVCSGAFVGQRCQ-DSNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQ-QADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSP------SPCQNGGTC------RPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGAC----VDGVNTYNCRCPPEWTGQYCTED-VDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVA 355          
BLAST of Neurogenic locus notch protein vs. Ensembl Mouse
Match: Notch2 (notch 2 [Source:MGI Symbol;Acc:MGI:97364])

HSP 1 Score: 970.689 bits (2508), Expect = 0.000e+0
Identity = 678/2000 (33.90%), Postives = 986/2000 (49.30%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKK-MECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKP--GTKVYLEVDNNNCKTISKLCFDNSN-----SAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKR--LKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKF---------ADLFNKNELSNNSLITILT----------SRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNIT 6314
            ++ C NHKC+NG  C   +N  Y C C   + G +C E    C + P  CQNGGTC    G   C C+N W G+ C E   +CA + C  G  C    +  + C CP+   G+ C L ++C S NPC     C     +G+  C C +GY G  C+ D+DECA   +  CE+ G C+NT G++ C+C  G+ G RCE DI +C +D C+N  TCLDKIG + C+C   + G +CE +   C+  PC N G C D    +QC+C   +TG  C  D+ +             +  N   Y+C C  GF G +C+ +IDNC    C +G  C + I+   C C PG+ G  C   ++EC + PC N+ +CIDL N Y C+C  G +G NCEIN D+C  NPC++G  C D +  ++C C  GF G RC    D C    PC+    C+N  N   G++CICP+G  +  C  ++++C +  CI+G C    +  KC+C  G+ G  CE++ NEC +NPCQ+G  C +L N Y C C  GFKG  C++NI+ECA NPC   G C D+V G+ C CMLPY+G  C   L PC+PN C N A+C     ++S+ C C+     ++G +C  DVDEC                       PC+N+  C NT GS++C+C   + G  CE+ +N+C  NPC+NG +C +  + F C+C  GF G++C+ ++NEC   PC N   C D++N Y C C +GF G +CE N ++CTESSC   G CVD +N F C C   + G  C H    C SNPCLN G+C++         Y C C  G+TG  C+  ++ C  +PC + G C  +     C C   + G  C++    +CK+ A++K      +  +C+H G C N   T    C C  GY GS+CE  +D+CAS PC +G  C D  G Y C+C PG+QGVNC+   +EC +  C N G CID +N+F C CP G  G  CE  +D C     C NGG C + IG + C C  GFAG+ CE DINEC  N              PCS  G+L+C+     ++C C+  FTG++CET +D C +       PC N G C        G    F C CP G+ G RC+     C    C+    C    I      +C C           D  + C S  C + G+C              SC       GS C L +   S       + C+   CA KA + ICD  CN +AC +DGG+C            +++  PW+NC    +  + C  + NN+ CD QCNT  CLFD ++C      C    +C  H+ D  C   CN+ EC +DG DC   +   +  G ++++ +   E + +     L++L  LLH+ +RI ++S G  M++    F E S +   +   +RSL    +Q +   G+K++LE+DN  C   S  CF N++      A+  +   L Y       P++SV +     R                  L +L V V ++  F+        +K +   +W PEG   L + +S  NHKR         Q+ +   N S ++     +     ++   VDD G                        A +E+  LLS  D     P ++R   + H++  + R+  +                     T  + +Q +   +L + V   D              +DL +++E + +S   I+T          ++   +GE  LHLAA+Y+R +AA+ LL+AG+D N  +  GR  L  A+ A A  V    +  +  V DL  +  +G+T LI A + A   ++  L+        D+N  D++G++ALHWAA         LLL  G NRD QDN+E TPL+LA +EG  E  KIL+ + AN D++DH+DRLPRDVA+      IV LL++Y N+T
Sbjct:  261 IDDCPNHKCQNGGVCVDGVN-TYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAYASCTPGSTCID-RVASFSCLCPEGKAGLLCHLDDACIS-NPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPN--GYECQCATGFTGILCDENIDNCDPDPCHHG-QCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLNCEINFDDCASNPCMHGV-CVDGINRYSCVCSPGFTGQRCNIDIDECAS-NPCRKGATCINDVN---GFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDKNECLSNPCQNGGTCNNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTGKNCQTVLAPCSPNPCENAAVCKEAPNFESFSCLCAPG---WQGKRCTVDVDECISK--------------------PCMNNGVCHNTQGSYVCECPPGFSGMDCEEDINDCLANPCQNGGSCVDHVNTFSCQCHPGFIGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCTCPAGFHGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDINECSSNPCLNAGTCVD-----GLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCVQEKARPHCLCPPGWDGAYCDVLNV-SCKAAALQK---GVPVEHLCQHSGICINAGNT--HHCQCPLGYTGSYCEEQLDECASNPCQHGATCNDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDECAGGPHCLNGGQCVDRIGGYTCRCLPGFAGERCEGDINECLSN--------------PCSSEGSLDCVQLKNNYNCICRSAFTGRHCETFLDVCPQ------KPCLNGGTCAVASNMPDG----FICRCPPGFSGARCQ---SSCGQVKCRRGEQC----IHTDSGPRCFC-------LNPKDCESGCASNPCQHGGTCYPQRQPP-----HYSCRCPPSFGGSHCELYTAPTST----PPATCQSQYCADKARDGICDEACNSHACQWDGGDC-----------SLTMEDPWANC----TSTLRCWEYINNQ-CDEQCNTAECLFDNFECQRNSKTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCASDQPENLAEGTLIIVVLLPPEQLLQDSRSFLRALGTLLHTNLRIKQDSQGALMVYPY--FGEKSAAMKKQKMTRRSLPEEQEQEQEVIGSKIFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSY-------PLVSVFSELESPRNA--------------QLLYLLAVAVVIILFFILLGVIMAKRKRKHGFLWLPEGFT-LRRDSS--NHKR----REPVGQDAVGLKNLSVQVSEANLIGSG--TSEHWVDDEGPQP-------------------KKAKAEDEALLSEDD-----PIDRRPWTQQHLEAADIRHTPSLAL------------------TPPQAEQEV--DVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIITDLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQILIRNR--VTDLDARMNDGTTPLILAARLAVEGMVAELINCQA----DVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEY-NVT 2069          

HSP 2 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 445/1305 (34.10%), Postives = 649/1305 (49.73%), Query Frame = 3
Query:  453 CKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTC--KLIAGNNVCQCLNEWVGEFCEFSSN---CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETP-LCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIG-SYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCI--DLNNDYTCDCPEGLTGKNCEINIDECT---PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCE--TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQL----------NVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACG---FDGGECLHRV 4271
            C N  TC +  NG   C C  G+ G YC+ +  C    CQNGGTC  + + G   C+C   + GE C++S++     S PC+NGG C  L    YEC C   + G  C+  ++C S +PC  NG    +   +  C C  G TG  C  DI+EC   + P  C++GGTC+N  GSY+C+C  GF G+ C++  V C    C NGGTC      ++ C C   + G+ CE     C    C+NGG+C D    Y C C  QWTG+ C +DV           NG   +     Y C+C  G+ G  C  +ID+C   SC  G +CI+ +    C C P  +        + C + PC   A C    LN  Y C CP+G  G +C  ++DEC     NPC +  +C +  G F C+CL+G+ G RCE   + C    PC+ +  CL   +   G+ C+C  G +  +C+ E+++C++  C+ NGQCVD  N  +C+C PGF G  C+I+I++C + PC +G++C D  N Y C C  GF G  C+ NI+ C  +PC  +GQC D +  + C C   Y G  C++++D C  + C ND  CI  +  + Y CNC        G  CE + D+C  +                    PC++   C++    + C CS  + G++C   ++ C +NPCR GATC N  +GFRC C  G     C  ++NEC  NPC +   C   ++ Y+C+C +G+ G NCE++ N+C  + C   G C + VNG+ C C + + G NC+     C SNPCLN+G+C +     +  GY C+C   +TG  C+  +  C  NPC +  VC+   + +SF C C   + G+RC +   E               I+K C ++G C N    G + C C  G+ G  CE +I+DC + PC NGG C D    + C+C PGF G  CQ + NEC S  C N G C D +N+++C CP G  G  CE  +D C +  C NGG C + I  F C CP GF G  C  DINEC  N              PC   GT  C+D  GT+ C C   +TGK C+T ++ C +       PC N G C+     E  R +   C+CP G+ G  C + +  C+           ++C+++GIC    I+   +  C+CP G  G +CE + ++EC S  C +  +C +  G   C C  G  G  CE     C      N  T  D ++  + + C       +C+   ++ A G    +GG+C+ R+
Sbjct:   35 CVNEGTCVTYHNGTGFCRCPEGFLGEYCQHRDPCEKNRCQNGGTCVPQGMLGKATCRCAPGFTGEDCQYSTSHPCFVSRPCQNGGTCHMLSRDTYECTCQVGFTGKQCQWTDACLS-HPC-ENGSTCTSVASQFSCKCPAGLTGQKCEADINEC---DIPGRCQHGGTCLNLPGSYRCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAYASCTPGSTCIDRVASFSCLC-PEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHS-DPCQNDATCL---DKIGGFTCLCMPGFKGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGILCDENIDNCDPDPC-HHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCI--DLVNGYQCNCQPGT---SGLNCEINFDDCASN--------------------PCMH-GVCVDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQVNECLSNPCIH-GNCTGGLSGYKCLCDAGWVGVNCEVDKNECLSNPCQNGGTCNNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFD-----DVSGYTCHCMLPYTGKNCQTVLAPCSPNPCENAAVCKEAPNFESFSCLCAPGWQGKRCTVDVDE--------------CISKPCMNNGVCHN--TQGSYVCECPPGFSGMDCEEDINDCLANPCQNGGSCVDHVNTFSCQCHPGFIGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCTCPAGFHGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDINECSSN--------------PCLNAGT--CVDGLGTYRCICPLGYTGKNCQTLVNLCSRS------PCKNKGTCV----QEKARPH---CLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGIC----INAGNTHHCQCPLGYTGSYCE-EQLDECASNPCQHGATCNDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCS-CPPGTRGLLCEENIDECAGGPHCLNGGQCVDRI 1245          

HSP 3 Score: 627.091 bits (1616), Expect = 0.000e+0
Identity = 462/1384 (33.38%), Postives = 659/1384 (47.62%), Query Frame = 3
Query:  438 CENHKCKNGATC-QSDINGKYVCECAYGYKGTYCEQKSNCP---ITPCQNGGTCKLIAGNNV-CQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELP-NSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVG-SYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKP--CKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGK--CNCLPGFXXXXXXXXX---XXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCING-QCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLI---SNPHGPCSP---------------TGTLE--------------CLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECL-STKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYAC----GFDGGEC---LHRVPKR--IDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEAC 4409
            CE ++C+NG TC    + GK  C CA G+ G  C+  ++ P     PCQNGGTC +++ +   C C   + G+ C+++  C S PC NG  C S+   ++ C+CP    G  CE   N C     C   G C L   G  +C C +G+TG  C +    CA      C NGGTC  T   +++C C  GF G  CE +I DC N  C+NGG C+D + +Y C CP  + G  C      C L+P  C+NGG C + +  Y C+C N W+G +C +  + C    C     C       + C+C  G  G +C    D C    C  G  C      G+  C C  G++G +C  +V       + PC++  KC++ +  + C+C +G  G  CE++I+EC  +PC N A C D++GGFTC C+ GF G+ CE + + C Q  PC     C++  N    ++C+CP G     C+ ++  C +  C+NG +C+D  N  +C C  GF G  C+  I+ C  +PC HG QCQD  + Y CIC PG+ G  C   I+EC  +PC  +G+CID V G++C C    SG  C    D C  N C +  +C+ G   + Y C CS     + G +C  D+DEC  +                    PC     CIN    F C C        C   +N C +NPC +G  C     G++C C AG+ G  CE++ NEC  NPC N   C + +N Y+C C+ GF G NC++N ++C  + CL  G C D V+G+ C C   Y G NC+ +  PC  NPC N   C   K   N   + C C  G+ G RC + +D C   PC + GVC     S+ C+C   + G  C             E+  N+ L N  C++ G+C +   T  F C C  G+ G  C+ ++++C S+PC NGG C D    Y C C  GF GV+C+ N +EC  +SC N G C+D IN+FSC+CP G +G FC   ++ C    C N G C + +G + C CP G+ GK C+T +N C  +   N    +   + PH  C P                  L+              C++   T HC C   +TG YCE ++D C       + PC +   C     + +G    + C C  GY G  C+    +CQ   C+N G C    ID    FKC CPPG  GL CE + ++EC     C N G CV+  G   C C  G  GE+CE                   +I++C  N C+S+       L+ N Y C     F G  C   L   P++  ++G   ++AS   +  I +     C   F+  RC   C    C
Sbjct:   68 CEKNRCQNGGTCVPQGMLGKATCRCAPGFTGEDCQYSTSHPCFVSRPCQNGGTCHMLSRDTYECTCQVGFTGKQCQWTDACLSHPCENGSTCTSV-ASQFSCKCPAGLTGQKCEADINECDIPGRCQHGGTC-LNLPGSYRCQCPQGFTGQHCDSPYVPCAPSP---CVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAYASCTPGSTCID-RVASFSCLCPEGKAGLLCHLD-DACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEVNEC-QSNPCVNNGQCVDKVNR---FQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGILCDENIDNCDPDPCHHG-QCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLNCEINFDDCASNPCMH-GVCVDG--INRYSCVCSPG---FTGQRCNIDIDECASN--------------------PCRKGATCINDVNGFRCICPEGPHHPSCYSQVNECLSNPCIHG-NCTGGLSGYKCLCDAGWVGVNCEVDKNECLSNPCQNGGTCNNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTGKNCQTVLAPCSPNPCENAAVC---KEAPNFESFSCLCAPGWQGKRCTVDVDECISKPCMNNGVCHNTQGSYVCECPPGFSGMDC-------------EEDINDCLANP-CQNGGSCVDHVNT--FSCQCHPGFIGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCTCPAGFHGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDINECSSNPCLNAGTCVDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCVQEKARPHCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNTHHCQCPLGYTGSYCEEQLDEC------ASNPCQHGATC----NDFIG---GYRCECVPGYQGVNCEYEVDECQNQPCQNGGTC----IDLVNHFKCSCPPGTRGLLCE-ENIDECAGGPHCLNGGQCVDRIGGYTCRCLPGFAGERCE------------------GDINECLSNPCSSEGSLDCVQLK-NNYNCICRSAFTGRHCETFLDVCPQKPCLNGGTCAVASNMPDGFICR-----CPPGFSGARCQSSCGQVKC 1351          

HSP 4 Score: 541.191 bits (1393), Expect = 1.080e-155
Identity = 390/1173 (33.25%), Postives = 555/1173 (47.31%), Query Frame = 3
Query:  408 FCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIH-KYECQCPKNYLGMNC-ELPNSC--GSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDE--VYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQN---TPGY----------------------------------------LCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQP-CINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTG---KCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGIC---KNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPH---------------GPCSPTGTLECLDRPGTFHCSCKKYFTGKYCE 3701
            FC   +     + + C+NG TC ++ NG Y C C  G+ G  C E   +C    C  G TC     +  C C     G  C     C S+PC  G +C +  ++ +Y C CP+ Y G +C E  + C   + NPC   GKC+   DG   C C KGY G  C  DI+EC S     C+N  TC++ +G + C C  GF G  CE ++ +C ++ C N G C+DK+  ++C+CP  + G  C+     C   PC NG  C D    Y+C C   +TG  CD+           ++G C+      Y CIC  G+ G +C   ID C    C N G CI+++ G +CNC PG  G NCEIN ++C + PC +   C+D  N Y+C C  G TG+ C I+IDEC  NPC  GA C + V GF C C +G     C ++ + C    PC    I  N     SGYKC+C  G    NC+ + ++C +  C N G C ++ N  +C C  GF+G  C++ I+EC +NPC +   C D  + Y C C+  + GK C+  +  C+ NPC     C +      F C C   + G  C   +D C    C N+ +C   N   SY C C      + G  CE+D+++C                ++N    PC N   C++   +F C+C   + G +C+  +N C + PC+NG TC +  + + C C AGF G  CE  I+EC  + C N   C+D IN + C+C  GF+G  C  + N+C+ + CL  G CVD +  + C C   Y G NC+ L   C  +PC NKG+C+  K   +    PG+                                         C C  G+TG  CE ++D C  NPC     C   +  ++C+C   Y G  CE         Y V++ +N+      C++ G C +      FKCSC  G  G  CE NID+CA  P C+NGG+C D  G Y C+C PGF G  C+ + NEC SN C++     C+   NN++C+C    +GR CET +D C +  C NGG C    N+   F C CP GF+G  C++   + K        +  S P                 PC   GT     +P  + C C   F G +CE
Sbjct:  294 FCTEDVDECLLQPNACQNGGTC-TNRNGGYGCVCVNGWSGDDCSENIDDCAYASCTPGSTCIDRVASFSCLCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCV-NTDGAFHCECLKGYAGPRCEMDINECHSDP---CQNDATCLDKIGGFTCLCMPGFKGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGILCDE-NIDNCDPDPCHHGQCQD-GIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLNCEINFDDCASNPCMHGV-CVDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQVNECLS-NPC----IHGNCTGGLSGYKCLCDAGWVGVNCEVDKNECLSNPCQNGGTCNNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTGKNCQTVLAPCSPNPCENAAVCKEAPNFESFSCLCAPGWQGKRCTVDVDECISKPCMNNGVC--HNTQGSYVCECPPG---FSGMDCEEDINDC----------------LAN----PCQNGGSCVDHVNTFSCQCHPGFIGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCTCPAGFHGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDINECSSNPCLNAGTCVDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCVQEKARPHCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNTHHCQCPLGYTGSYCEEQLDECASNPCQHGATCNDFIGGYRCECVPGYQGVNCE---------YEVDECQNQP-----CQNGGTCID--LVNHFKCSCPPGTRGLLCEENIDECAGGPHCLNGGQCVDRIGGYTCRCLPGFAGERCEGDINECLSNPCSSEGSLDCVQLKNNYNCICRSAFTGRHCETFLDVCPQKPCLNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCIHTDSGPRCFCLNPKDCESGCASNPCQHGGTCYPQRQPPHYSCRCPPSFGGSHCE 1412          
BLAST of Neurogenic locus notch protein vs. Ensembl Mouse
Match: Notch3 (notch 3 [Source:MGI Symbol;Acc:MGI:99460])

HSP 1 Score: 858.981 bits (2218), Expect = 0.000e+0
Identity = 652/2061 (31.64%), Postives = 938/2061 (45.51%), Query Frame = 3
Query:  438 CENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQ-----KSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSS-NCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDG--EVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFG---------------------TNCENKRTLCELKPCKNGGIC-RDFDE-------------------DYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKL-------DPCNPNA-CYNDAI-----CIPGNKYDSYHCN----CSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIG--PCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYC-------KKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGT-FHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVN-------ECLSTKCYNNGSC--VNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCM----DAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISK--LCFDNSNSAAEFVTAALHYKSYRPPVPILSV--QTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQH 6332
            C +  C +GA C    +G++ C C  GY+G  C+      +S    T C++GGTC    G+  CQC   + G  CE     CA SPCRNGG C+      Y+C C   + G NCE+       + C   G C+   DG     C C   +TG  C+ D+DEC   +   C NGGTC N +G + C C  G+ GE C  +I DC    C +G TC D++ S+ C CP    G                     TN  + R +C   P   GG C +D DE                    + C CG  +TG  C+   N C   PC+N   C     Q + CIC  GF G  CE  ID CQ   C NGG C + + G  C C  GF G+ C+++V+EC + PC+N AKC+D  + Y C C EG  G  CE N+D+C+P+PC +G RC D +  F+C C  G+ G+RCE++ D C+   PC+    CL++ +    Y C CP G    NC+  +  C +  C  G C D  N   C+C PGF G  C +EINEC ++PC  G  C D  N + C+C PG     C    + CAH PC  +G C D   GFRC C   +SGP C+  L        PC     C +D I     C PG  +  + C     C+ +L  + G  CE D D   +        G       +   G  PC     C N  G+F C C   Y G  C++ +++C  NPC +G +C +    F C C+ GF G RC  +++EC  +PC     C DH+  + C C  G+ G +CEI+  DC+ SSC   G CVD V+ F C C   Y GT+C++   PC S PCL+ G C     N   PG+ C CR GFTG +C+  +DWC   PC + G C        C C   + G  C+I+     ++ A    +    + ++C+  G C +   +    C C  G  GS CE  +D C +QPC +GG C    G Y C+C  G+ G +C+ N +EC S  C N G CID +  + C CP G  G  CE   D C         ++C + G C +++G F CNCP G+ G  CE DINEC+               G C    T +CL  PG  F C C   FTG  C+  +  CE      + PC + G C  ++    G    F+C C   + G RC+  ++ C+   C     C+          +C CPPG+ G  C +   +        C S  C + GSC  V       C C  G  G +CE   +A  +           E   C    C +K  ++ CD ECN   CG+DGG+C            +++  PW  CE ++     C   FNN RCDP C++ ACL+D +DC     D       + +C  H+ADG+C   CNT EC +DG DC     + +  G+++L  +   E + R     LQ L+ +L + +R   ++ GQ M+F       +  S  S+SR +R L   V     G+ V LE+DN  C   ++   CF ++ SAA+++ A    +    P P+  V  +    P +  P  P              +L      L            +K   + +W+PEG            HK +   ++ R + +         LG ++ M K +    + V D     L  +     +    E         E+C   +    H     + R+     L  P+            + V+  G   F+P             L+     +DE +  +     + +   + +   T R   +GET LHLAA+Y R +AA+ LL+AG+D N  + +GR+ L TA+ A A  V    +  ++   DL  +  +GST LI A + A   +++ L+        D+N  DE G++ALHWAA          LL  G N+D QD++E TPL+LA +EG  E  K+L+ + AN +++DHLDRLPRDVA+      IV LL+        +  H
Sbjct:  124 CVSRPCVHGAPCSVGPDGRFACACPPGYQGQSCQSDIDECRSG---TTCRHGGTCLNTPGSFRCQCPLGYTGLLCENPVVPCAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCV---DGVNTYNCQCPPEWTGQFCTEDVDEC-QLQPNACHNGGTCFNLLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCHEDAICDTNPVSGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQ-FTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFSGSMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGTLCERNVDDCSPDPCHHG-RCVDGIASFSCACAPGYTGIRCESQVDECRS-QPCRYGGKCLDLVDK---YLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENGFHCLCPPGSLPPLCLPANHPCAHKPCS-HGVCHDAPGGFRCVCEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFRCTCAPG--FQGHQCEVLSPCTPSLCEH-GGHCESDPDRLTVCSCPPGWQGPRCQQDVDECAGASPCGPHGTCTNLPGNFRCICHRGYTGPFCDQDIDDCDPNPCLHGGSCQDGVGSFSCSCLDGFAGPRCARDVDECLSSPC-GPGTCTDHVASFTCACPPGYGGFHCEIDLPDCSPSSCFNGGTCVDGVSSFSCLCRPGYTGTHCQYEADPCFSRPCLHGGIC-----NPTHPGFECTCREGFTGSQCQNPVDWCSQAPCQNGGRCVQT--GAYCICPPGWSGRLCDIQSLPCTEAAAQMGVR----LEQLCQEGGKCIDKGRS--HYCVCPEGRTGSHCEHEVDPCTAQPCQHGGTCRGYMGGYVCECPAGYAGDSCEDNIDECASQPCQNGGSCIDLVARYLCSCPPGTLGVLCEINEDDCDLGPSLDSGVQCLHNGTCVDLVGGFRCNCPPGYTGLHCEADINECR--------------PGACHAAHTRDCLQDPGGHFRCVCHPGFTGPRCQIALSPCE------SQPCQHGGQC--RHSLGRGGGLTFTCHCVPPFWGLRCERVARSCRELQCPVGIPCQ----QTARGPRCACPPGLSGPSCRVSRASPSGATNASCASAPCLHGGSCLPVQSVPFFRCVCAPGWGGPRCETPSAAPEVP----------EEPRCPRAACQAKRGDQNCDRECNTPGCGWDGGDC-----------SLNVDDPWRQCEALQ-----CWRLFNNSRCDPACSSPACLYDNFDCYSGGRDRTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDARGQAMVFPY-----HRPSPGSESRVRRELGPEVI----GSVVMLEIDNRLCLQSAENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEAPEQSVPLLP--------------LLVAGAVFLLIIFILGVMVARRKREHSTLWFPEGFAL---------HKDIAAGHKGRREPV-----GQDALG-MKNMAKGESLMGEVVTD-----LNDSECPEAKRLKVEEPGMGAEEPEDCRQWTQ---HHLVAADIRVAPATALTPPQGDA-----DADGVDVNVRGPDGFTPLMLAS---FCGGALEPMPAEEDEADDTSASIISDLICQGAQLGARTDR---TGETALHLAARYARADAAKRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRS--TDLDARMADGSTALILAARLAVEGMVEELIASHA----DVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAAREGSYEAAKLLLDHLANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPSGPH 2038          

HSP 2 Score: 442.965 bits (1138), Expect = 7.095e-125
Identity = 323/977 (33.06%), Postives = 456/977 (46.67%), Query Frame = 3
Query: 1302 DYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGG----KCNCLPGFXXXXXXXXXXXXXXKPCQNNAKC-IDLNNDYTCDCPEGLTGKNCEINIDEC-TPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCING-QCVDVNNEEKCICIPGFEGRTCEIEINECFNNP--CQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIV--DYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPH--------------------------GPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSAC 4115
            +  C+C  G+ G+ C+   D C    C   G C + +  G     C CL GF+G +C         +PC + A C +  +  + C CP G  G++C+ +IDEC +   C +G  C +  G F CQC  G+ GL CE     C   +PC+    C   ++    Y C C  G   QNC+  +  C    C+NG  CVD  N   C C P + G+ C  +++EC   P  C +G  C +L   + C+C+ G+ G+ C  NI++CA   C     C D V  F C C +  +G  C +  D C  N C+ DAIC          C C      + G  C++DVDEC++                     PC +  +C+NT GSF+C+C   Y G +CE  +N C + PCRN ATC +    F C C+AGFTG  CE++I+ECQ +PC N   C D +N + C C SGFSG  C+++ ++C  + C    +CVD+ +G+EC+C E + GT CE     C  +PC + G C++   +     + C C  G+TG RCE ++D CR  PC   G C   +D + C+C     G  CE+   + C S           IN+                + C CQ G+ G  C V I++CAS PC  GG C DG   + C C PG     C    + C    C+ G C D    F CVC  G SG  C   +  D C+   CQ GG C +    F C C  GF G  CE  ++ C  ++  +  +  S+P                            PC P GT  C + PG F C C + +TG +C+  ID C+        PC + G C    Q+ VG   +FSC C +G+ G RC  +  +C  + C   G C     D   SF C CPPG GG  CEID + +C  + C+N G+CV+G     C C  G  G  C+     C
Sbjct:   63 EAACLCLPGWVGERCQLE-DPCHSGPCAGRGVCQSSVVAGTARFSCRCLRGFQGPDCSQPDPCVS-RPCVHGAPCSVGPDGRFACACPPGYQGQSCQSDIDECRSGTTCRHGGTCLNTPGSFRCQCPLGYTGLLCENPVVPCAP-SPCRNGGTCRQSSDVT--YDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLC-HLDDACVSNPCHEDAICDTNPVSGRAICTCPPG---FTGGACDQDVDECSIGAN------------------PCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFSGSMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGTLCERNVDDCSPDPC-HHGRCVDGIAS-----FSCACAPGYTGIRCESQVDECRSQPCRYGGKCLDLVDKYLCRCPPGTTGVNCEV-NIDDCASNPCTFGVCRDGINR----------------YDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENGFHCLCPPGSLPPLCLPANHPCAHKPCSHGVCHDAPGGFRCVCEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFRCTCAPGFQGHQCEV-LSPCTPSLCEHGGHCESDPDRLTVCSCPPGWQGPRCQQDVDECAGASPCGPHGT--CTNLPGNFRCICHRGYTGPFCDQDIDDCDPN------PCLHGGSC----QDGVG---SFSCSCLDGFAGPRCARDVDECLSSPC-GPGTC----TDHVASFTCACPPGYGGFHCEID-LPDCSPSSCFNGGTCVDGVSSFSCLCRPGYTGTHCQYEADPC 967          
BLAST of Neurogenic locus notch protein vs. Ensembl Mouse
Match: Notch4 (notch 4 [Source:MGI Symbol;Acc:MGI:107471])

HSP 1 Score: 593.964 bits (1530), Expect = 2.316e-175
Identity = 536/1987 (26.98%), Postives = 793/1987 (39.91%), Query Frame = 3
Query:  666 ASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKC--ILANDG-----------EVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTC-INTVGSYQCKCKAGFNGERCENDIVD-CTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELK--PCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESV---NYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNC---LPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCK------NIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCE---------KXXXXXXXXXXXXGATCDNLADG-----------------FRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMD-WCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNID---DCASQP------CINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFC--EIDYVNECLSTKCYNNGSCVN--GFGKA--ICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCPL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIF---SIRVFAENSNSDSSKSRQKRS-----LSNSVQQGKPGTKVYLEVDNNNC--KTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRK-AEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDL-------IEPRNIEAWCFNTIANLLVSGN--GLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVP-YSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALE-VVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQH 6332
            +  PC NGG C  L   +  CQC   +LG  C+ P+ C     C   G C  +L                  C C  G+TG+ C   ++E        C NGG C +   G  QC C+ G+ GE+C+  + D C+ + C NGG CL      +C CP  + G  CE     C L+  PC  G  C +    YQC+C     G  C   K  C    C N G C+ V   +   + C+C  GF G  CE + D+C +  C NG +C++ ++   C C     G++ +             C+N   C +    + C C  G  G  CE N+D+C    C  G+ C DRVG F+C C  G  GL C  + D+C    PC     C + N       CIC  G     C ++L +C+      +     G C++      C+C+PG+ G  CE + NEC + PC  GS C DL   + C+C PG +G+ CE+ +NEC  NPC     C D + GF+C C+  ++G  C   +D C+   C N   C   ++  +++C C   L  +EG  CEK+VDEC  D                    PC     C++  G+F C C   + G+ CE         +P   C+    R    C + + G                   C C  G+TG  CE E+  C   PC++   C    + Y C C +G+ G  C      C    CL  G C  +  G+ C C  ++ G +C+     C S  CLN G+C+N+      PG + C C  GF G  CE K +  C  +PC +   C+      +C C+  Y G  C+                 +    K C H   C     +  F+C C  G+ G+ C+  +       SQ       C NGG C D    YFC+C PGFQG  CQ N N C  N C+ G  C+ Q + + C C  G  G+ C  ++D C+   C N G C +  G F C CP GF G  CE D++EC                 PC P+GT  C      F+C C    TG+ CE  +D C+      + PC N G C    +   G    F+C CP G+ G  C   +  C ++ C N G+C P          C C  G GG  C            + C +NG+C    G G     C C   S G +C+  G+                      + C  +  +  CD  C+     +DGG+C            + +  PW  C         C   F + RC PQC++E CLFDG+DC   +   P    +C  H+ +G C+  CN  EC +DGGDC      +     + LL V     + +    L + L+  L   + + ++S G+ M+F     R   E S +  S S ++++     L    +    G  V + VD + C  +  +  C  +S     F+ A     +  P +P   +  +   G +            +    L    V V +L        Q   ++ R+   +W P G  R   QT Q  H+R                     LG      K+ +     VD+ G    +       E   + +  +   ++  C  L    M    PP++     +D+       + P     +C    +    S    GLG   P E    +    +   +     +     A  F++   +   L        P  +G T LH A   + +E  + LL +                T +DA   +      L  +  V DL ++       LI A                     D+   D+ G+TALHWAA    A     LL  G ++DAQD+ E TPL+LA +EG +EV ++L+  GA   + D     P DVA+  +   ++ LLE     T+E + H
Sbjct:   28 SPEPCANGGTCLRLSRGQGICQCAPGFLGETCQFPDPCRDTQLCKNGGSCQALLPTPPSSRSPTSPLTPHFSCTCPSGFTGDRCQTHLEELCPPS--FCSNGGHCYVQASGRPQCSCEPGWTGEQCQ--LRDFCSANPCANGGVCLATYPQIQCRCPPGFEGHTCERDINECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDGLDTYTCLCPKTWKGWDCSEDIDECEARGPPRCRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDCAAATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLE-DMCLS-QPCHVNAQC-STNPLTGSTLCICQPGYSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNGFQCLCLPGFTGARCEKDMDECSSTPCANGGRCR--DQPGAFYCEC---LPGFEGPHCEKEVDECLSD--------------------PCPVGASCLDLPGAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHGHCQRSLCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMGLTCSEEVTACHSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDHCVSASCLNGGTCVNK------PGTFFCLCATGFQGLHCEEKTNPSCADSPCRNKATCQDTPRGARCLCSPGYTGSSCQTLI--------------DLCARKPCPHTARCLQSGPS--FQCLCLQGWTGALCDFPLSCQKAAMSQGIEISGLCQNGGLCIDTGSSYFCRCPPGFQGKLCQDNVNPCEPNPCHHGSTCVPQPSGYVCQCAPGYEGQNCSKVLDACQSQPCHNHGTCTSRPGGFHCACPPGFVGLRCEGDVDECLDR--------------PCHPSGTAACHSLANAFYCQCLPGHTGQRCEVEMDLCQ------SQPCSNGGSC----EITTGPPPGFTCHCPKGFEGPTCSHKALSCGIHHCHNGGLCLPSPKPGSPPL-CACLSGFGGPDCLTPPAPPGCGPPSPCLHNGTCTETPGLGNPGFQCTCPPDSPGPRCQRPGA----------------------SGCEGRGGDGTCDAGCSGPGGDWDGGDC-----------SLGVPDPWKGCPPHSQ----CWLLFRDGRCHPQCDSEECLFDGYDCEIPLTCIPAYDQYCRDHFHNGHCEKGCNNAECGWDGGDCRPEGEDSEGRPSLALLVVLRPPALDQQLLALARVLSLTLRVGLWVRKDSEGRNMVFPYPGTRAKEELSGARDSSSWERQAPPTQPLGKETESLGAGFVVVMGVDLSRCGPEHPASRCPWDSGLLLRFLAAMAAVGALEPLLPGPLLAAHPQAGTRP-------SANQLPWPILCSPVVGVLLLALGALLVLQLIRRRRREHGALWLPPGFIR-RPQTQQAPHRR------------------RPPLGEDNIGLKA-LKPEAEVDEDGVAMCSGPEEGEAEETASASRCQLWPLNSGCGELPQAAMLT--PPQECESEVLDVDTCGPDGVTPLMSAVFCGGVQSTTGASPQRLGLGNLEPWEPLLDRGACPQAHTVGTG--ETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREVCQLLLAS--------------RQTTVDARTEDGTTPLMLAARLAVEDLVEE-------LIAARA-------------------DVGARDKRGKTALHWAAAVNNARAARSLLQAGADKDAQDSREQTPLFLAAREGAVEVAQLLLELGAARGLRDQAGLAPGDVARQRSHWDLLTLLEGAGPTTQEARAH 1827          

HSP 2 Score: 459.144 bits (1180), Expect = 1.095e-130
Identity = 361/1209 (29.86%), Postives = 532/1209 (44.00%), Query Frame = 3
Query:  450 KCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITP-CQNGGTCKL--------------IAGNNVCQCLNEWVGEFCE--FSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTC-LDKIGS---YRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD---DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCI--DLNNDYTCDCPEGLTGKNCEINIDECT-----PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACY------------------NDAICIPG-NKYDSYHCNCSTAL----GRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDN-DCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRG---------NPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCN---TGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGD---FECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFH-CSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCK 3854
             C NG TC     G+ +C+CA G+ G  C+    C  T  C+NGG+C+               +  +  C C + + G+ C+      C  S C NGG C      + +C C   + G  C+L + C S NPC  NG   LA   +++C C  G+ G+TC  DI+EC     P C  G +C NT+GSYQC C  G  G +C+     C   +C NGGTC L   G    + C+CP  + G +CE     C    C+NG  C D  + Y C+C   W G +C    D         C+N G C++     + C+C  G+ G  CE ++D+C   +C  G +CI+ +    C C PG          + C ++PC  NA+C    L     C C  G +G  C  ++DEC      P+PC +G  C +  G F C CL G+ G RCE   + C    PC     CL++  T   + C+CP G++   C+ E+++C +  C+N   C D+ N  +C+C+PGF G  CE +++EC + PC +G +C+D    + C CLPGF+G  CE  ++EC  +PC +   C+D    F C C   ++G  C   L  C PN C                       C+P  +    +H +C  +L      + G +CE ++  C                +S     PC +   C      + C C + Y G  C + +  C + PC NG +C    +G+ C C+   TG  C+  ++ C    C N   C++    + C+C +GF G +CE   N  C +S C     C D   G  C C+  Y G++C+ L   C   PC +   C+     Q+ P + C C +G+TG  C+  +   +            C + G+C     S+ C+C   + G+ C+      C+                C H   C   P+  G+ C C  GY G  C   +D C SQPC N G C    G + C C PGF G+ C+ + +EC    C+   T  C    N F C C  G +G+ CE  +D C+   C NGG C+   G    F C+CPKGF G  C      C  +   N    + +P              +PG+   C+C   F G  C T          S  +   +NG C    +     N  F C CP    G RC+
Sbjct:   31 PCANGGTCLRLSRGQGICQCAPGFLGETCQFPDPCRDTQLCKNGGSCQALLPTPPSSRSPTSPLTPHFSCTCPSGFTGDRCQTHLEELCPPSFCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDFC-SANPC-ANGGVCLATYPQIQCRCPPGFEGHTCERDINECFLEPGP-CPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDGLDTYTCLCPKTWKGWDCSEDIDECEARGPPRCRNGGTCQNT-AGSFHCVCVSGWGGAGCEENLDDCAAATCAPGSTCIDRVGSFSCLCPPG-RTGLLCHLEDMCLSQPCHVNAQCSTNPLTGSTLCICQPGYSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLS-QPCHPGSTCLDLLAT---FHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNGFQCLCLPGFTGARCEKDMDECSSTPCANGGRCRDQPGAFYCECLPGFEGPHCEKEVDECLSDPCPVGASCLDLPGAFFCLCRPGFTGQLCEVPL--CTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHGHCQRSLCVCDEGWTGPECETELGGC----------------IST----PCAHGGTCHPQPSGYNCTCPAGYMGLTCSEEVTACHSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDHCVSASCLNGGTCVNKPGTFFCLCATGFQGLHCEEKTNPSCADSPCRNKATCQDTPRGARCLCSPGYTGSSCQTLIDLCARKPCPHTARCL-----QSGPSFQCLCLQGWTGALCDFPLSCQKAAMSQGIEISGLCQNGGLCIDTGSSYFCRCPPGFQGKLCQ-DNVNPCEP-------------NPCHHGSTCV--PQPSGYVCQCAPGYEGQNCSKVLDACQSQPCHNHGTCTSRPGGFHCACPPGFVGLRCEGDVDECLDRPCHPSGTAACHSLANAFYCQCLPGHTGQRCEVEMDLCQSQPCSNGGSCEITTGPPPGFTCHCPKGFEGPTCSHKALSCGIHHCHNGGLCLPSP--------------KPGSPPLCACLSGFGGPDCLTPPAPPGCGPPSPCL---HNGTC---TETPGLGNPGFQCTCPPDSPGPRCQ 1167          

HSP 3 Score: 435.647 bits (1119), Expect = 3.488e-123
Identity = 346/1108 (31.23%), Postives = 484/1108 (43.68%), Query Frame = 3
Query:  432 NFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN---CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSL-EIHK--YECQCPKNYLGMNCEL-PNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKI-----SCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVC-INGQCVDVNNEEKCICIPGFEGRTCEIEI------------------NECF-------------NNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQC-EKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESS----------CLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGM---YFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFS---CVCPRGVSGRFCETIVDYCKKMECQ---NGGICKNVIG----DFECNCPKGFAGKLCE 3539
            +FC  + C NG  C +    +  C C  G++G  CE+  N       PC  G +C    G+  C C     G  C+     C    C NGG C+ + E H   + C CP  + G++CE+ P+ C  ++ C     C+   D    C C K + G  CS DIDEC +   P C NGGTC NT GS+ C C +G+ G  CE ++ DC   TC  G TC+D++GS+ C+CP    G  C +   +C  +PC     C            N  TG                              CICQ G+ G  C   +D CQ        C +GGSCIN      C CLPG+ G+ CE + NEC ++PC   + C+DL   + C CP GL G+ CE+ ++ECT NPCLN A C D + GF C CL GF G RCE   D C   TPC     C    +    + C C  G +  +C+KE+ +C +  C +   C+D+     C+C PGF G+ CE+ +                    C              N PC HG  CQ      LC+C  G+ G +CE  +  C   PC   G C  +  G+ C C   Y G TC+ ++  C+   C N   C    + + Y C C   L  + G  C+  VD C              +S S      CLN   C+N  G+F C C++ ++G  C EK   +C ++PCRN ATC +   G RC C  G+TG  C+  I+ C   PC + A+C+     +QC+C  G++G  C+   + C +++          C   G C+D  + + C+C   + G  C+    PC+ NPC +  +C+ +       GY+C C  G+ G  C   +D C+  PC + G C +    F C C   ++G RCE    E               +++ C   G          F C C  G+ G  CEV +D C SQPC NGG C   TG    + C C  GF+G  C      C  + C N G C+      S   C C  G  G  C T              + G C    G     F+C CP    G  C+
Sbjct:  155 DFCSANPCANGGVCLATYP-QIQCRCPPGFEGHTCERDINECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDC-VRHQCQNGATCLDGLD-TYTCLCPKTWKGWDCSEDIDECEARGPPRCRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDCAAATCAPGSTCIDRVGSFSCLCPPGRTGLLC-HLEDMCLSQPCHVNAQCST----------NPLTGST---------------------------LCICQPGYSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNGFQCLCLPGFTGARCEKDMDECSS-TPCANGGRC---RDQPGAFYCECLPGFEGPHCEKEVDECLSDPCPVGASCLDLPGAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHG-HCQ----RSLCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMGLTCSEEVTACHSGPCLNGGSC--SIRPEGYSCTC---LPSHTGRHCQTAVDHC--------------VSAS------CLNGGTCVNKPGTFFCLCATGFQGLHCEEKTNPSCADSPCRNKATCQDTPRGARCLCSPGYTGSSCQTLIDLCARKPCPHTARCLQSGPSFQCLCLQGWTGALCDFPLS-CQKAAMSQGIEISGLCQNGGLCIDTGSSYFCRCPPGFQGKLCQDNVNPCEPNPCHHGSTCVPQPS-----GYVCQCAPGYEGQNCSKVLDACQSQPCHNHGTCTSRPGGFHCACPPGFVGLRCEGDVDE--------------CLDRPCHPSGTAACHSLANAFYCQCLPGHTGQRCEVEMDLCQSQPCSNGGSCEITTGPPPGFTCHCPKGFEGPTCSHKALSCGIHHCHNGGLCLPSPKPGSPPLCACLSGFGGPDCLTPPAPPGCGPPSPCLHNGTCTETPGLGNPGFQCTCPPDSPGPRCQ 1167          
BLAST of Neurogenic locus notch protein vs. Ensembl Mouse
Match: Notch4 (notch 4 [Source:MGI Symbol;Acc:MGI:107471])

HSP 1 Score: 372.089 bits (954), Expect = 5.367e-108
Identity = 296/949 (31.19%), Postives = 440/949 (46.36%), Query Frame = 3
Query:  564 PCQNGGTC-KLIAGNNVCQCLNEWVGEFCEFSSNCASSP-CRNGGICKSLE-------------IHKYECQCPKNYLGMNCE--LPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDT--CKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQ----CICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQK---ISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCE--DRVGGFTCQCLQGFVGLRCETKSDICKQL----TPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGL---AVLSMSNSQIGPCLNDNQCINTNGS---FICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRP-CDSNPCLNKGSCINRKVNQNTP-GYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCK 3281
            PC NGGTC +L  G  +CQC   ++GE C+F   C  +  C+NGG C++L                 + C CP  + G  C+  L   C     C   G C +   G  +C C  G+TG  C    D C++     C NGG C+ T    QC+C  GF G  CE DI +C  +   C  G +C + +GSY+C+CP    G  C+ ++  C    C NGG C+   E +     C+C   +TG +C+   + C  + C+N   C       Y C+C + ++G  C   ID C+      C NGG+C N      C C+ G+ G  CE N+++C    C   + CID    ++C CP G TG  C +  D C   PC   A+C      G   C C  G+ G  C    D C+      +PC+    C+N   T   + C+C  G     C+ + ++C +  C  G  C+D+     C+C PG EGR CE+E+NEC +NPC + + C DL N + C+CLPGF G +CE +++EC+  PC   G+C D+   F C+C+  + GP C  ++D C  + C   A C+  +   ++ C C      + G  CE  +   N+ +      G    A     +   G    ++ C   +G     +C C   + G +CE  L  C + PC +G TC     G+ C C AG+ G  C  E+  C   PC N   C      Y C C    +G++C+   + C  +SCL  G CV+K   F C C   + G +CE    P C  +PC NK +C      Q+TP G  C C  G+TG  C+  +D C   PC     C     SF+C C   + G  C+   +  C+  A+ +      I+ +C++ G C +   +  + C C  G+ G  C+ N++ C   PC +G  C      Y C+
Sbjct:   35 PCANGGTCLRLSRGQGICQCAPGFLGETCQFPDPCRDTQLCKNGGSCQALLPTPPSSRSPTSPLTPHFSCTCPSGFTGDRCQTHLEELCPPSF-CSNGGHCYVQASGRPQCSCEPGWTGEQCQLR-DFCSANP---CANGGVCLATYPQIQCRCPPGFEGHTCERDINECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLD-GLDTYTCLCPKTWKGWDCSEDIDECEARGPPRCRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDCAAATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLE-DMCLSQPCHVNAQCSTNPLTGSTLCICQPGYSGSTCHQDLDECQMAQQGPSPCEHGGSCIN---TPGSFNCLCLPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNGFQCLCLPGFTGARCEKDMDECSSTPCANGGRCRDQPGAFYCECLPGFEGPHCEKEVDECLSDPCPVGASCL--DLPGAFFCLCRPG---FTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHGHCQRSLCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMGLTCSEEVTACHSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDHCVSASCLNGGTCVNKPGTFFCLCATGFQGLHCEEKTNPSCADSPCRNKATC------QDTPRGARCLCSPGYTGSSCQTLIDLCARKPCPHTARCLQSGPSFQCLCLQGWTGALCDFPLS--CQKAAMSQGIE---ISGLCQNGGLCIDTGSS--YFCRCPPGFQGKLCQDNVNPCEPNPCHHGSTCVPQPSGYVCQ 955          

HSP 2 Score: 361.303 bits (926), Expect = 2.514e-104
Identity = 291/975 (29.85%), Postives = 415/975 (42.56%), Query Frame = 3
Query:  666 ASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKC--ILAN-----------DGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTC-INTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELK--PCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESV---NYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNC---LPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNI-----VCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCE---------KXXXXXXXXXXXXGATCDNLADG-----------------FRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMD-WCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNID---DCASQP------CINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSC 3389
            +  PC NGG C  L   +  CQC   +LG  C+ P+ C     C   G C  +L                  C C  G+TG+ C   ++E        C NGG C +   G  QC C+ G+ GE+C+     C+ + C NGG CL      +C CP  + G  CE     C L+  PC  G  C +    YQC+C     G  C   K  C    C N G C+ V   +   + C+C  GF G  CE + D+C +  C NG +C++ ++   C C     G++ +             C+N   C +    + C C  G  G  CE N+D+C    C  G+ C DRVG F+C C  G  GL C  + D+C    PC     C + N       CIC  G     C ++L +C+        C + G C++      C+C+PG+ G  CE + NEC + PC  GS C DL   + C+C PG +G+ CE+ +NEC  NPC     C D + GF+C C+  ++G  C   +D C+   C N   C   ++  +++C C   L  +EG  CEK+VDEC  D                    PC     C++  G+F C C   + G+ CE         +P   C+    R    C + + G                   C C  G+TG  CE E+  C   PC++   C    + Y C C +G+ G  C      C    CL  G C  +  G+ C C  ++ G +C+     C S  CLN G+C+N+        + C C  GF G  CE K +  C  +PC +   C+      +C C+  Y G  C+                 +    K C H   C     +  F+C C  G+ G+ C+  +       SQ       C NGG C D    YFC+C PGFQG  CQ N N C  N C+ G  C+ Q + + C
Sbjct:   32 SPEPCANGGTCLRLSRGQGICQCAPGFLGETCQFPDPCRDTQLCKNGGSCQALLPTPPSSRSPTSPLTPHFSCTCPSGFTGDRCQTHLEELCPPS--FCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDF-CSANPCANGGVCLATYPQIQCRCPPGFEGHTCERDINECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDGLDTYTCLCPKTWKGWDCSEDIDECEARGPPRCRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDCAAATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLE-DMCLS-QPCHVNAQC-STNPLTGSTLCICQPGYSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNGFQCLCLPGFTGARCEKDMDECSSTPCANGGRCR--DQPGAFYCEC---LPGFEGPHCEKEVDECLSD--------------------PCPVGASCLDLPGAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHGHCQRSLCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMGLTCSEEVTACHSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDHCVSASCLNGGTCVNKPGT-----FFCLCATGFQGLHCEEKTNPSCADSPCRNKATCQDTPRGARCLCSPGYTGSSCQTLI--------------DLCARKPCPHTARCLQSGPS--FQCLCLQGWTGALCDFPLSCQKAAMSQGIEISGLCQNGGLCIDTGSSYFCRCPPGFQGKLCQDNVNPCEPNPCHHGSTCVPQPSGYVC 954          

HSP 3 Score: 355.91 bits (912), Expect = 1.930e-102
Identity = 308/1053 (29.25%), Postives = 426/1053 (40.46%), Query Frame = 3
Query: 1023 TNDTCKNGGTCLD-KIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDN-CQKISCFNGGSCINMIEG-GKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDEC--TPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYK-CICPDGVQ--NCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINEC-FNNP--CQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKK-TETCKSYAVEKFKNESLINKICK---------------HHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERC--KINSKKCQLN-------VCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICH 4064
            + + C NGGTCL    G   C C   + G  C+      + + CKNGG C+                           +    ++    S     + C C  GF G  C+T ++  C    C NGG C     G  +C+C PG+ G  C++        PC N   C+       C CP G  G  CE +I+EC   P PC  G  C + +G + C C  G  G +C+ +   C   + C     C  V    S +  C+CP G    +C+     C    C NG  C+D  +   C+C   ++G  C  +I+EC    P  C++G  CQ+    + C+C+ G+ G  CE N+++CA   C     CID V  F C C    +G  C  + D C    C+ +A C       S  C C      Y GS C +D+DEC                M+     PC +   CINT GS                                      F C C+ G+TG RCE + NEC   PC   + C+D +  + C+C  G  G+ CE+  N+CT + CL    C D +NGF+C C   + G  CE     C S PC N G C      ++ PG + C C  GF GP CE ++D C  +PC     C     +F C C   + G+ CE+   T        +    E     +C                HHG+C          C C  G+ G  CE  +  C S PC +GG C      Y C C  G+ G+ C      C+S  C N G C  +   +SC C    +GR C+T VD+C    C NGG C N  G F C C  GF G  CE   N              S    PC    T  C D P    C C   +TG  C+T ID C +       PC +   CL           +F C+C  G+ G  C   ++ +K  ++       +C+N G+C    ID   S+ C CPPG  G  C+ D VN C    C++  +CV      +C 
Sbjct:   32 SPEPCANGGTCLRLSRGQGICQCAPGFLGETCQFPDPCRDTQLCKNGGSCQAL-------------------------LPTPPSSRSPTSPLTPHFSCTCPSGFTGDRCQTHLEELCPPSFCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDFCSA-NPCANGGVCLATYPQIQCRCPPGFEGHTCERDINECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGS-CLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDGLDTYTCLCPKTWKGWDCSEDIDECEARGPPRCRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDCAAATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLE-DMCLSQPCHVNAQCSTNPLTGSTLCICQPG---YSGSTCHQDLDECQ---------------MAQQGPSPCEHGGSCINTPGS--------------------------------------FNCLCLPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNGFQCLCLPGFTGARCEKDMDECSSTPCANGGRC------RDQPGAFYCECLPGFEGPHCEKEVDECLSDPCPVGASCLDLPGAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHGHCQRS------LCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMGLTCSEEVTACHSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDHCVSASCLNGGTCVNKPGTFFCLCATGFQGLHCEEKTNP-------------SCADSPCRNKAT--CQDTPRGARCLCSPGYTGSSCQTLIDLCAR------KPCPHTARCLQS-------GPSFQCLCLQGWTGALCDFPLSCQKAAMSQGIEISGLCQNGGLC----IDTGSSYFCRCPPGFQGKLCQ-DNVNPCEPNPCHHGSTCVPQPSGYVCQ 955          

HSP 4 Score: 347.051 bits (889), Expect = 1.431e-99
Identity = 277/894 (30.98%), Postives = 395/894 (44.18%), Query Frame = 3
Query:  411 CPIAISLNFCENHK--------CKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN---CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCH---CNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTN---DTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKI-----SCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVC-INGQCVDVNNEEKCICIPGFEGRTCEIEI------------------NECF-------------NNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQC-EKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESS----------CLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCN 2891
            CP   + + C+ H         C NG  C    +G+  C C  G+ G  C+ +  C   PC NGG C        C+C   + G  CE   N       PC  G  C +  +  Y+C CP    G  C+L         C   G C L  +G    H   C  G+TG  C  + D+C  ++   C+NG TC++ + +Y C C   + G  C  DI +C       C+NGGTC +  GS+ CVC + + G  CE     C    C  G  C D    + C+C    TG  C             N     +       CICQ G+ G  C   +D CQ        C +GGSCIN      C CLPG+ G+ CE + NEC ++PC   + C+DL   + C CP GL G+ CE+ ++ECT NPCLN A C D + GF C CL GF G RCE   D C   TPC     C    +    + C C  G +  +C+KE+ +C +  C +   C+D+     C+C PGF G+ CE+ +                    C              N PC HG  CQ      LC+C  G+ G +CE  +  C   PC   G C  +  G+ C C   Y G TC+ ++  C+   C N   C    + + Y C C   L  + G  C+  VD C              +S S      CLN   C+N  G+F C C++ ++G  C EK   +C ++PCRN ATC +   G RC C  G+TG  C+  I+ C   PC + A+C+     +QC+C  G++G  C+   + C +++          C   G C+D  + + C+C   + G  C+    PC+ NPC +  +C+ +       GY+C 
Sbjct:  106 CPSGFTGDRCQTHLEELCPPSFCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDFCSANPCANGGVCLATYPQIQCRCPPGFEGHTCERDINECFLEPGPCPQGTSCHN-TLGSYQCLCPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQ---CQNGATCLDGLDTYTCLCPKTWKGWDCSEDIDECEARGPPRCRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDCAAATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHVNAQCSTNPLTGSTLCICQPGYSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNGFQCLCLPGFTGARCEKDMDECSS-TPCANGGRC---RDQPGAFYCECLPGFEGPHCEKEVDECLSDPCPVGASCLDLPGAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHG-HCQ----RSLCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMGLTCSEEVTACHSGPCLNGGSC--SIRPEGYSCTC---LPSHTGRHCQTAVDHC--------------VSAS------CLNGGTCVNKPGTFFCLCATGFQGLHCEEKTNPSCADSPCRNKATCQDTPRGARCLCSPGYTGSSCQTLIDLCARKPCPHTARCLQSGPSFQCLCLQGWTGALCDFPLS-CQKAAMSQGIEISGLCQNGGLCIDTGSSYFCRCPPGFQGKLCQDNVNPCEPNPCHHGSTCVPQPS-----GYVCQ 955          

HSP 5 Score: 333.569 bits (854), Expect = 5.972e-95
Identity = 288/971 (29.66%), Postives = 404/971 (41.61%), Query Frame = 3
Query:  921 CENGGTCIN-TVGSYQCKCKAGFNGERCENDIVDCTNDT--CKNGGTCLDKIGS--------------YRCVCPNNYFGTNCENK---------------------------------------RTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGK----CNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECT---PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELS-KCKNIVC-INGQCV--DVNNEEKCICIPGFEGRTCEIEINEC-----FNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEI------------NECQHN-PC---SNDAKCID----------HINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTN----------ECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECN 3506
            C NGGTC+  + G   C+C  GF GE C+    D   DT  CKNGG+C   + +              + C CP+ + G  C+                                         R  C   PC NGG+C       QC C   + G  C+ D+            G         Y+C+C  G EG  C+     C   SC NGG+C  + EG      C C PGF G +CE+N ++C    CQN A C+D  + YTC CP+   G +C  +IDEC    P  C NG  C++  G F C C+ G+ G  CE   D C   T C     C++   +   + C+CP G       L   C +  C +N QC    +     CIC PG+ G TC  +++EC       +PC+HG  C +    + C+CLPG+ G +CE + NEC   PC     C+D +  F C C     G  C  +++ C  N C N A C   +  + + C C   L  + G++CEKD+DEC+                      PC N  +C +  G+F C+C   +EG  CEK ++ C ++PC  GA+C +L   F C C  GFTG+ CE+ +               +H  PC        C+           H     C+C  G++G  CE     C  + C   G C  + +G+ C C   Y+G  C      C S PCLN GSC  R       GY C C    TG  C+  +D C    C + G C     +F C C + + G  CE K              N S  +  C++   C + P   G +C C  GY GS C+  ID CA +PC +   C      + C C  G+ G  C    +          E      N G CID  +++ C CP G  G+ C+  V+ C+   C +G  C      + C 
Sbjct:   36 CANGGTCLRLSRGQGICQCAPGFLGETCQ--FPDPCRDTQLCKNGGSCQALLPTPPSSRSPTSPLTPHFSCTCPSGFTGDRCQTHLEELCPPSFCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDFCSANPCANGGVCLATYPQIQCRCPPGFEGHTCERDINECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDGLDTYTCLCPKTWKGWDCSEDIDECEARGPPRCRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDCAAAT-CAPGSTCIDRVGS---FSCLCPPGRTGLLCHLEDMCLSQPCHVNAQCSTNPLTGSTLCICQPGYSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACH--DLLNGFQCLC---LPGFTGARCEKDMDECSST--------------------PCANGGRCRDQPGAFYCECLPGFEGPHCEKEVDECLSDPCPVGASCLDLPGAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHGHCQRSLCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMGLTCSEEVTACHSGPCLNGGSCSIRPE-----GYSCTCLPSHTGRHCQTAVDHCVSASCLNGGTCVNKPGTFFCLCATGFQGLHCEEK-------------TNPSCADSPCRNKATCQDTPR--GARCLCSPGYTGSSCQTLIDLCARKPCPHTARCLQSGPSFQCLCLQGWTGALCDFPLSCQKAAMSQGIEISGLCQNGGLCIDTGSSYFCRCPPGFQGKLCQDNVNPCEPNPCHHGSTCVPQPSGYVCQ 955          

HSP 6 Score: 290.426 bits (742), Expect = 1.350e-80
Identity = 289/1033 (27.98%), Postives = 403/1033 (39.01%), Query Frame = 3
Query: 1380 CFNGGSCINMIEG-GKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKC--------------IDLNNDYTCDCPEGLTGKNCEINIDE-CTPNPCLNGARCEDRVGGFT-CQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECF--NNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNG---QCIDEVYGFRCQCMLP--YSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGP--CLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDH--INDYQCICQSGFSGKNCEINDNDCT-----ESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSN---------------------------------SCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHG---PCSPTGTLE-------------------CLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNEC----------LSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKC 4184
            C NGG+C+ +  G G C C PGF G  C+      + + C+N   C                L   ++C CP G TG  C+ +++E C P+ C NG  C  +  G   C C  G+ G +C+ + D C                                     + C N     G C+    + +C C PGFEG TCE +INECF    PC  G+ C +    Y C+C  G +G +C++    C    C LNG   Q + E +     C+ P  ++G  C    D C  + C N A C+ G   D+Y C C      ++G  C +D+DEC                      GP  C N   C NT GSF C C S + G  CE+ L++C    C  G+TC +    F C C  G TG  C +E + C   PC  +A+C  +       CICQ G+SG  C  + ++C       S C   G C++    F C C   Y G+ CE     C S PC    +C++         + C C  G  G  CE++++ C  NPC +   C   L+ F+C C   + G RCE K  + C S               C + G C + P  G F C C  G+ G  CE  +D+C S PC  G  C D  G +FC C+PGF G  C+V    C  N                                  C+ G C   +    CVC  G +G  CET +  C    C +GG C      + C CP G+ G  C  ++  C      N  +    P G    C P+ T                     C+++PGTF C C   F G +CE + +         + PC N   C +  +          C+C  GY G  C+     C    C +   C    +    SF+C C  G  G  C  D+   C          +S  C N G C++      C C  G  G+ C                  QD ++ CE N C
Sbjct:   36 CANGGTCLRLSRGQGICQCAPGFLGETCQFPDPCRDTQLCKNGGSCQALLPTPPSSRSPTSPLTPHFSCTCPSGFTGDRCQTHLEELCPPSFCSNGGHCYVQASGRPQCSCEPGWTGEQCQLR-DFCSA-----------------------------------NPCAN----GGVCLATYPQIQCRCPPGFEGHTCERDINECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSC-LNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDG--LDTYTCLCPKT---WKGWDCSEDIDECEAR-------------------GPPRCRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDCAAATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLE-DMCLSQPCHVNAQCSTNPLTGSTLCICQPGYSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQPCHPGSTCLDLLAT-----FHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNGFQCLCLPGFTGARCE-KDMDECSSTP-------------CANGGRCRDQP--GAFYCECLPGFEGPHCEKEVDECLSDPCPVGASCLDLPGAFFCLCRPGFTGQLCEVPL--CTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHGHCQRSL----CVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMGLTCSEEVTACHSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDHCVSASCLNGGTCVNKPGTFFCLCATGFQGLHCEEKTN-----PSCADSPCRNKATCQDTPRGA-------RCLCSPGYTGSSCQTLIDLCARKPCPHTARC----LQSGPSFQCLCLQGWTGALC--DFPLSCQKAAMSQGIEISGLCQNGGLCIDTGSSYFCRCPPGFQGKLC------------------QDNVNPCEPNPC 939          

HSP 7 Score: 58.5362 bits (140), Expect = 1.210e-7
Identity = 96/347 (27.67%), Postives = 127/347 (36.60%), Query Frame = 3
Query: 3456 CQNGGICKNVI-GDFECNCPKGFAGKLCE-----TDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECL--STKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPW---SNCEIIKSENIPCHNWFNNKRCDPQCNTEACL----FDGWDCMDAIGQC 4451
            C NGG C  +  G   C C  GF G+ C+      D   CK    G+   L+  P    SPT  L        F C+C   FTG  C+T ++  E    S    C N G C   Y    GR     C C  G+ GE+C++    C  N C N G+C    +      +C CPPG  G  CE D +NEC      C    SC N  G   C C  G  G +C++   AC   S  N  T Q                                       VP+      + +  P     +CE+   + +  H   N   C    +T  CL    + GWDC + I +C
Sbjct:   36 CANGGTCLRLSRGQGICQCAPGFLGETCQFPDPCRDTQLCKN--GGSCQALLPTPPSSRSPTSPLT-----PHFSCTCPSGFTGDRCQTHLE--ELCPPSF---CSNGGHC---YVQASGRP---QCSCEPGWTGEQCQLR-DFCSANPCANGGVC----LATYPQIQCRCPPGFEGHTCERD-INECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSCLNGGTCQ--------------------------------------LVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVR-HQCQNGATCLDGLDTYTCLCPKTWKGWDCSEDIDEC 319          
BLAST of Neurogenic locus notch protein vs. UniProt/SwissProt
Match: sp|P07207|NOTCH_DROME (Neurogenic locus Notch protein OS=Drosophila melanogaster OX=7227 GN=N PE=1 SV=3)

HSP 1 Score: 1003.82 bits (2594), Expect = 0.000e+0
Identity = 688/1991 (34.56%), Postives = 1007/1991 (50.58%), Query Frame = 3
Query:  438 CENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQ------KSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILAN-DGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLI--NKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISD-------CELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCP--LQSFCDKHYADGQCQLECNTMECSFDGGDCI-ESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKK-PEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNF-PPEKRL--KLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSR-------VPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYV 6305
            C  H C+NG TC   I+  Y C C   + G +C+       + + P+  CQNG TC    G+  C C+N W G  C  +++ C  + C  G  C    +  + CQC K   G+ C L ++C S NPC  +  C  +  +G   C C  GY G  CS DIDEC   +   CE+ G C+NT GSY+C C  GF G RCE +I +C +  C+N G+CLD  G++RCVC   + GT CE     C+  PC N G C D    ++C C   +TG  C    + C+  PC+N G C   +   Y C C  G+ G  CE +I++C    C  G  CI+ +   KC C PG+ G  C+  +NECE+ PCQ +  C D    Y C C  G +GKNCE+N++EC  NPC NGA C D +  + CQC+ GF G  CE   D C   +PC    +C++  N   GYKC CP G    +C  ++ +C +  C+N G+C D  NE  C C PG+ G+ CE++I+EC +NPCQHG  C D  N + C C+PG+ G+KCE NI++C  NPCG  G CID+V G++C C +P++G  C +K+DPC  N C N+A C P + +  + C C      Y G  C++D+DEC+L                     PC N   C+N  GS+ C C+  YEGR C    ++C + PC+NG TC +    + C CV GF G+ CE +INEC   PC N A C  ++N Y C C  GFSG NC+ ND DCTESSCL  G C+D +NG+ C C   Y G NC++    CDSNPCLN  +C     ++    Y C+C  GFTG +C   +DWC  +PC +   C      F CKC++ + G+ C++ +T +C+  A  K  +   +  N  CK +GN           C C  GY GS+C+  ID+C SQPC NGG C D  G Y C+C+ GFQG NC++N ++C  N C N G C D++ NFSC CP G  G  CE   D CK   C N G C + +G FEC C  GF G  CE DINEC  N              PCS  GTL+C+     +HC+C+    G++CE ++D+C +       PC N G C         R     CIC NG+ G+ C+++ + C  N C+   +      D+   ++CECP G  G  CEID ++EC    C    +C +  G   C C     G++C+I  +     +  +        +D       C+   C  K  N ICD +CN YAC FDG +C   +            +PW+NC   +     C N F N +C+ +CN  AC +DG DC   +  C     ++C KHY DG C   CN  ECS+DG DC  ++++  +  G + ++ +   E     + + L++++H+L + VR+ +++ G  +I + +        + +   +K  +  + Q  + G ++YLE+DN  C      CF ++  AAEF+ A       R    I SV+   +PG +   EPP         +  ++   +LV +   F      T  K+      W+PEG          F     V S R+R+ +         E+ N+ +    +   +  V   G++                +    V +  N    S+  M   +   ++R+  + H+D+++ R I          +    +  G     ++R    +    L IA       +   D+ N NE S   +I+ L ++       +  +GET LHLAA++ R +AA+ LL+AG+D N  +  GR+ L  A+ A A+ V    L  +    +L+ +  +G+T LI A + A   +++ L+        D+N  D  G+TALHWAA       V++LL +  NRDAQD+++ TPL+LA +EG  E CK L+ N AN +++DH+DRLPRDVA       IV LL+++V
Sbjct:  297 CLGHLCQNGGTCIDGIS-DYTCRCPPNFTGRFCQDDVDECAQRDHPV--CQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCID-GVGSFYCQCTKGKTGLLCHLDDACTS-NPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECD--QGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHD-SIAGYSCECPPGYTGTSCEININDCDSNPCHRG-KCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECIS-SPCANNGVCIDQVN---GYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLG---YTGRYCDEDIDECSLSS-------------------PCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATC-----HEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDV-QTISCQDAADRKGLSLRQLCNNGTCKDYGN--------SHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSN--------------PCSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDFCAQS------PCQNGGNCNI-------RQSGHHCICNNGFYGKNCELSGQDCDSNPCR---VGNCVVADEGFGYRCECPRGTLGEHCEIDTLDECSPNPCAQGAACEDLLGDYECLCPSKWKGKRCDIYDANYPGWNGGSGSGNDRYAADLEQQRAMCDKRGCTEKQGNGICDSDCNTYACNFDGNDCSLGI------------NPWANCTANE-----CWNKFKNGKCNEECNNAACHYDGHDCERKLKSCDSLFDAYCQKHYGDGFCDYGCNNAECSWDGLDCENKTQSPVLAEGAMSVVMLMNVEAFREIQAQFLRNMSHMLRTTVRLKKDALGHDIIINWKDNVRVPEIEDTDFARKNKILYTQQVHQTGIQIYLEIDNRKCTE----CFTHAVEAAEFLAATAAKHQLRNDFQIHSVRGIKNPGDEDNGEPP-------ANVKYVITGIILVIIALAFFGMVLSTQRKRAHGV-TWFPEG----------FRAPAAVMSRRRRDPH-------GQEMRNLNKQVAMQ---SQGVGQPGAHWSDDESDMPLPKRQRSDPVSGVGLGNNGGYASDHTMVSEYEEADQRVWSQAHLDVVDVRAI----------MTPPAHQDGGKHDVDARGPCGLTP--LMIAAVRGGGLDTGEDIEN-NEDSTAQVISDLLAQGAELNATMDKTGETSLHLAARFARADAAKRLLDAGADANCQDNTGRTPLHAAVAADAMGVFQILLRNR--ATNLNARMHDGTTPLILAARLAIEGMVEDLITADA----DINAADNSGKTALHWAAAVNNTEAVNILLMHHANRDAQDDKDETPLFLAAREGSYEACKALLDNFANREITDHMDRLPRDVASERLHHDIVRLLDEHV 2140          

HSP 2 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 470/1351 (34.79%), Postives = 666/1351 (49.30%), Query Frame = 3
Query:  408 FCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNN--VCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCT---NDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQ-DYKCICQRGFEGKMCETSIDNCQKIS-CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVN--GFECKCNENYIGTNCEHLKRPCD-SNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECK--YNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYAC----GFDGGECLHRVPKRIDGNDISIASP---WSNCEIIKS-ENIPCHNWFNNKRCD 4385
             C IA+  N C++  C NG TCQ     +Y C CA GY G  CE K+ C  +PC+NG TC  +AG++   C C   + G+ C +    C S+PC+ GG C +     Y+C CP  Y G +C+      S +PC   G C  +N    +C C KG+ G  C  + D+C  +   LC+NGGTCI+ +  Y C+C   F G  C++D+ +C    +  C+NG TC +  GSY C+C N + G +C N    C+   C  G  C D    + C C    TG  C  + + C  NPC  +  C++      Y C C  G++G  C   ID C + S C + G C+N     +CNC  GF G  CE N+NECE+ PCQN   C+D    + C C  G TG  CEI+IDEC  NPCLN   C D++ GF C C  GF G RC+   D C Q  PC+   IC   +++ +GY C CP G    +C+  ++ C +  C  G+C+D  N  KC+C PG+ G  C+ +INEC +NPCQ    CQD    Y C C  G  GK CE+N+NEC  NPC     CID +  ++CQC+  ++G  C   +D C  + C N+ +CI  ++ + Y C C    G Y+ + C  DVDEC  +                    PC+N+ +C +    FIC C   Y G++CE  ++ C +NPC++G TC +  + F C+C+ G+TG++CE  I++C  NPC N   CID +N Y+C+C+  F+G++CE   + C  + C    +C    N   F C C   Y G  C+     C  S+PC N  SC+      N PG Y C C +G+ G  C I  D C   PC + G C   +  + C C   + G+ CE    E               +++ C++   C        + C+C  G+ G  C+ N +DC    C+NGG C DG   Y C C  G+ G NCQ   N+C SN C N   C +Q N ++C CP G +G+ C   VD+C +  C+NG  C  +   F C C  G+ GKLC+     C+   +  G +   + N        GT  C D   +  C C + + G YC+  ID C+      + PC N G C    ++ +G    + C C  G+ G+ C++N   C  N C+N G C     D  M+F C CPPG  G+ CEI+  ++C    C+NNGSC++  G   C C  G  G +CE                   +I++C  N C S A    C    N Y C    G  G  C H+V       D    SP     NC I +S  +  C+N F  K C+
Sbjct:  134 LCEIAVP-NACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTH-GSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGIC-RSNGLSYECKCPKGFEGKNCEQNYDDCLGH---LCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLC-HLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDC-QSQPCRNRGIC---HDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCI--DQVNGYKCECPR--GFYD-AHCLSDVDECASN--------------------PCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCL------NVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINE--------------CLSQPCQNGATCSQ--YVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCN-------NGT--CKDYGNSHVCYCSQGYAGSYCQKEIDECQ------SQPCQNGGTC----RDLIGA---YECQCRQGFQGQNCELNIDDCAPNPCQNGGTCH----DRVMNFSCSCPPGTMGIICEINK-DDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCE------------------GDINECLSNPC-SNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKV-------DFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCE 1373          

HSP 3 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 453/1315 (34.45%), Postives = 638/1315 (48.52%), Query Frame = 3
Query:  417 IAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNN----VCQCLNEWVGEFCEFS--SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCI-LANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVN-YQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKC--IDLNNDYTCDCPEGLTGKNCEINIDECTP-NPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVC--ETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQ---------LNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDL---ECNKYACGFDGGECLHRV 4271
             A+    C +  C+NG TC + +NGK  C C   Y G YCE ++ C    CQNGGTC++   N      C+C   +    CE +  + C    C NGG C+   + +Y C C   Y G  CE  N C S +PC     C  LA      C C  G+TG+TCS DI+EC S     C+ GGTC+NT GSYQC C  G+ G+ C+     C+   C+NGG C     SY C CP  + G NCE     C    C+NGG C D   DY C C   +TG+ C DDV    + +           N +  Y CIC  G+ G  C  + D+C++ +CF G +CI+ +    C C  G +        + C + PC  +A C    +N  Y C C  G  G +C  +IDEC   +PC +   C +  G + C C QGF G RCET  + C+   PC+ E  CL+   T   ++C+C  G     C+ ++ +C++  C+N G C D  N  KC C  GF G  C+I I++C + PC++   C D    Y C C PG+ G  CEININ+C  NPC   G+CID+V  F+C C   Y+G  C  +++ C  N C  D  C   ++  SY+C C        G  CE +V+EC+ +                    PC N   CI+   S+ C+C   + G+ CEK ++ C ++PC N   C +  +G++C C  GF    C  +++EC  NPC N+ +C D IN++ C C  G++GK CE++ ++C+ + C   G C DK+N F C+C   Y G  CE     C +NPC N G+CI+ KVN    GY C C+  FTG  CE KMD C  N C +   C   ++   F C C   Y G  C             ++  +E  ++  C++  +C N P  G ++C C  GY G  C +N DDCAS PC NGG C DG G Y C C  GF G +C+ + NEC S  C  G  C   +N+++C CP G SG  C+T  + C +  C NGG C + I  + C+C  G++G  C+  +N+C  N              PC    T  C ++   + C C   FTGK C   +D+C      G  PC N   C           + FSC C  G+ G+ C + +  CQ         L    NNG C+    D   S  C C  G  G +C+ + ++EC S  C N G+C +  G   C C +G  G+ CE+    C      N  T  D + +   + C       IC++   +C   AC  + G C+ RV
Sbjct:   55 TALVAASCTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNLCAS-SPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNP---CKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKG-KTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECES-HPCQNEGSCLDDPGT---FRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPC-HRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQ--DRVGSYYCQCQAGT---SGKNCEVNVNECHSN--------------------PCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCID-KVN----GYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYC-------------DEDIDECSLSSPCRNGASCLNVP--GSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSN--------------PCLNGAT--CHEQNNEYTCHCPSGFTGKQCSEYVDWC------GQSPCENGATCSQ-------MKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTCK----DYGNSHVCYCSQGYAGSYCQKE-IDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFSCS-CPPGTMGIICEINKDDCKPGAC-HNNGSCIDRV 1278          

HSP 4 Score: 526.168 bits (1354), Expect = 1.253e-149
Identity = 382/1194 (31.99%), Postives = 549/1194 (45.98%), Query Frame = 3
Query:  411 CPIAISLNFCENHK----------CKNGATCQSDINGKYVCECAYGYKGTYCEQKS-NCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIH-KYECQCPKNYLGMNC-ELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC------------------DDVXXXXXXXXXXXXGF--------CESVNYQ----------DYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGL--------------------------------------TGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCIC--PDGVQNCKKELSKCKNIVCIN------------------------------------------GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQH---------NPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCI--DQINNFSCVCPRGVSGRFCET-IVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKY 3563
            CP   +  FC++            C+NGATC ++ +G Y C C  G+ G  C   + +C    C  G TC    G+  CQC     G  C     C S+PC    IC +  I+  Y C C   Y G++C E  + C   +PC  NG C+    G  +C+C++G+TG  C  +I+EC S+    C+N G+C++  G+++C C  GF G +CE DI +C ++ C N GTC DKI  ++C C   + G  C+     C+ +PC+N GIC D    Y C C   +TG +C                  DDV +   +      G+        CES   Q           Y C CQ G  GK CE +++ C    C NG +CI+ I   KC C+PGF G +CE NV+EC + PC NN  CID  N Y C+CP G                                       TGK CE++IDEC+ NPC +G  C D++  F+CQC+ G+ G +CET  D C    PC     C++  N   GYKC+C  P   ++C+ ++  C +  C N                                            C++V    +C+C  G+EGR C I  ++C + PCQ+G  C D   DY C+C+ GF GK CE +INEC   PC     C   V  + C C L +SG  C    + C  ++C N   CI G   + Y+C+C   L  Y G+ C+  +++C+ +                    PCLN   C   N  + C C S + G+QC + ++ C  +PC NGATC  +   F C+C AG+TG+ C+++   CQ              N+  C D+ N + C C  G++G  C+   ++C    C   G C D +  +EC+C + + G NCE     C  NPC N G+C +R +N     + C+C  G  G  CEI  D C+   C + G C   +  F+C C   ++G RCE    E C S           +  +  +H             C+C+ G+ G  CE  +D CA  PC NGG C      + C C  GF G NC+++  +C SN C  G C+  D+   + C CPRG  G  CE   +D C    C  G  C++++GD+EC CP  + GK C  DI +  Y
Sbjct:  319 CPPNFTGRFCQDDVDECAQRDHPVCQNGATC-TNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICV-NTPGSYRCNCSQGFTGPRCETNINECESHP---CQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCV-TNPCGNGGTCIDKVN---GYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDG--INGYNCSC---LAGYSGANCQYKLNKCDSN--------------------PCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTCKDYGNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMN-----FSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINE-CLSNPCSNAGTLDCVQLVNNYH-------------CNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQDCDSNPCRVGNCVVADEGFGYRCECPRGTLGEHCEIDTLDECSPNPCAQGAACEDLLGDYECLCPSKWKGKRC--DIYDANY 1457          

HSP 5 Score: 451.055 bits (1159), Expect = 3.205e-126
Identity = 339/1007 (33.66%), Postives = 478/1007 (47.47%), Query Frame = 3
Query: 1323 RGFEGKMCETSIDNCQKISCFNGGSCINMIEGGK-CNCLPGFXXXXXXXXXXXXXXKPCQNNAKC-IDLNN---DYTCDCPEGLTGKNCEINI-DECTPNPCLNGARCEDR-VGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVC-INGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPC---NPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNS--------------------QIGPCLNDNQCINT--NGSFICKCSSQYEGRQC-EKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNEC-LSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNK 4229
            RG +  +   S   C  + C NGG+C+  + G   C C   + G+ CE        + CQN   C +   N     +C CP G     CEI + + C    CLNG  C+ + +  +TC C  G+ G RCETK ++C   +PC+    C  +  + S + C CP G     C  ++ +C++  C   G CV+ +   +C+C  G+ G+ C+ +   C  +PCQ+G  C+     Y C C  GF+GK CE N ++C  + C   G CID +  + C+C   ++G  C + +D C   +   C N A C   N + SY C C   +  + G  C  + D+C   +     YG   +    S                       PC  D  C  +  NGS+ C C++ Y+G  C E      + +PC +   C N    +RC C  GFTG RCE  INEC+ +PC N+  C+D    ++C+C  GF+G  CEI+ ++C  + CL  G C DK+NGF+C C   + G  C+     C S PC N+G C     + +  GY C C  G+TG  CEI ++ C  NPC   G C  D++SFKC C+  Y G  C+ K+   C+S               C+  G+C +    G + C CQ+G  G  CEVN+++C S PC NG  C DG   Y C+C PGF G +C+ N +EC S+ C N G CIDQ+N + C CPRG     C + VD C    C N G C++ I +F C+CP G+ GK CE DI+EC  N              PC   GT  C D+   F C C   +TG+ CET ID C         PC N G C++K          + C+C   + G  C+     C  N CKN   C P    + + F C C  G  G +C+ D ++EC LS+ C N  SC+N  G   C C KG  G  C I    C      N  T  D I D     C    D K C+ + N+
Sbjct:   51 RGTDTALVAAS---CTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNPCNSMR-CQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETK-NLCAS-SPCRNGATCTALAGSSS-FTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCT--NTHGSYSCIC---VNGWAGLDCSNNTDDC---KQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGIC-----HDSIAGYSCECPPGYTGTSCEININDCDSNPC-HRGKCIDDVNSFKCLCDPGYTGYICQ-KQINECES-------------NPCQFDGHCQD--RVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSN--------------PCQHGGT--CYDKLNAFSCQCMPGYTGQKCETNIDDCVTN------PCGNGGTCIDKVN-------GYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSS--NFLDFSCTCKLGYTGRYCDED-IDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSC-LCVDGFDGKHCETDINE 987          

HSP 6 Score: 378.637 bits (971), Expect = 6.097e-104
Identity = 289/917 (31.52%), Postives = 411/917 (44.82%), Query Frame = 3
Query: 1548 PEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFT-CQCLQGFVGLRCETKSDICKQLTPCKTEEIC-LNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEI-NECFNNPCQHGSQCQ-DLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYG---FRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINEC---QHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQ-----------------------------------NTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEI 4160
            P  + G +  +    CT   C NG  C  ++ G T C C   +VG  CE + + C  +  C+    C +   N R G  C CP                                    GF+   CEI + N C +  C +G  CQ     +Y C C  G+ G++CE   N CA +PC  NG     + G   F C C   ++G TC+  ++ C  N C     C+  N + SY C C T    Y G  C+     C+                      PC N   C +   S+ CKC   +EG+ CE+  ++C  + C+NG TC +    + CRC   FTG  C+ +++EC    H  C N A C +    Y CIC +G++G +C  N +DC +++C     C+D V  F C+C +   G  C HL   C SNPC     C    +N                                    NTPG Y CNC +GFTGPRCE  ++ C  +PC + G C  D  +F+C C   + G +CEI   E C+S               C + G C +  +  GFKCSC  G+ G+ C++NIDDC SQPC N G C D    Y C+C PG+ G +C++N N+C SN C+ GKCID +N+F C+C  G +G  C+  ++ C+   CQ  G C++ +G + C C  G +GK CE ++NEC  N              PC+   T  C+D   ++ C C   FTG++CE  +D C       + PC NNG+C+++          + C CP G+    C  +  +C  N C N G C     D    F C CPPG  G  CE+D ++EC S  C + G+C +      C C  G  G+KCE     C      N  T  D++
Sbjct:   47 PNTVRGTDTALVAASCTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHR-NPCNSMR-CQNGGTCQVTFRNGRPGISCKCP-----------------------------------LGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETK-NLCASSPC-RNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCV--NTHGSYQCMCPTG---YTGKDCDTKYKPCSPS--------------------PCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLC-HLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDE-CQS-------------NPCLNDGTCHD--KINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSN--------------PCNNGAT--CIDGINSYKCQCVPGFTGQHCEKNVDECI------SSPCANNGVCIDQVN-------GYKCECPRGFYDAHCLSDVDECASNPCVNEGRCE----DGINEFICHCPPGYTGKRCELD-IDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKV 848          
BLAST of Neurogenic locus notch protein vs. UniProt/SwissProt
Match: sp|Q04721|NOTC2_HUMAN (Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3)

HSP 1 Score: 991.875 bits (2563), Expect = 0.000e+0
Identity = 699/2117 (33.02%), Postives = 1032/2117 (48.75%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKK-MECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAI--CHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTA-ALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRK-AEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKF---------ADLFNKNELSNNSLITILT----------SRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKE------NQQHRPLMWGXXXXXXXXXXXXXHPVDLKTVLYSSPHSLQPMSCCVYPNSLPQDSIEFKSKNMGFYNPAMSIQNQSNPSCFRSNQIGSFMNQPHESVKKRLTTH--TSPNLLSS 6656
            ++ C NH+C+NG  C   +N  Y C C   + G +C E    C + P  CQNGGTC    G   C C+N W G+ C E   +CA + C  G  C    +  + C CP+   G+ C L ++C S NPC     C     +G+  C C +GY G  C+ D+DECA   +  CE+ G C+NT G++ C+C  G+ G RCE DI +C +D C+N  TCLDKIG + C+C   + G +CE +   C+  PC N G C D    +QC+C   +TG  C  D+ +             +  N   Y+C C  GF G +CE +IDNC    C +G  C + I+   C C PG+ G  C   ++EC + PC N+ +CIDL N Y C+C  G +G NCEIN D+C  NPC++G  C D +  ++C C  GF G RC    D C    PC+    C+N  N   G++CICP+G  +  C  ++++C +  CI+G C    +  KC+C  G+ G  CE++ NEC +NPCQ+G  C +L N Y C C  GFKG  C++NI+ECA NPC   G C D++ G+ C C+LPY+G  C   L PC+PN C N A+C     ++SY C C+     ++G +C  D+DEC                       PC+N   C NT GS++C+C   + G  CE+ +++C  NPC+NG +C +  + F C C+ GFTG++C+ ++NEC   PC N   C D++N Y C CQ+GF G +CE N N+CTESSC   G CVD +N F C C   + G+ C H    C S+PCLN+G+C++         Y C+C  G+TG  C+  ++ C  +PC + G C       +C C S + G  C++       S  +   +   L+  +C+H G C N   T    C C  GY GS+CE  +D+CAS PC +G  C D  G Y C+C PG+QGVNC+   +EC +  C N G CID +N+F C CP G  G  CE  +D C +   C NGG C + IG + C C  GFAG+ CE DINEC  N              PCS  G+L+C+     + C C+  FTG++CET +D C +      +PC N G C        G    F C CP G+ G RC+     C    C+    C    +      +C CP          D  + C S+ C + GSC          C C     G +CE+  +  +              + C    CA KA + +CD  CN +AC +DGG+C            +++ +PW+NC    S  +PC ++ NN+ CD  CNT  CLFD ++C      C    +C  H+ D  C   CN+ EC +DG DC   +   +  G ++++ +   E + +     L++L  LLH+ +RI R+S G+ M++    + E S +   +   +RSL    +Q   G+KV+LE+DN  C   S  CF N+++AA  + + A+      P V ++S      P R +                L+ L  +  V+  F+        K+ RK   +W PEG   L +  S  NHKR         Q+ +   N S ++     +     ++   VDD G                          +E+  LLS  D  ++  P    + H++  + R   +                     T  + +Q +   +L + V   D              +DL +++E + +S   I+T          ++   +GE  LHLAA+Y+R +AA+ LL+AG+D N  +  GR  L  A+ A A  V    +  +  V DL  +  +G+T LI A + A   ++  L+        D+N  D++G++ALHWAA         LLL  G NRD QDN+E TPL+LA +EG  E  KIL+ + AN D++DH+DRLPRDVA+      IV LL++Y N+T             P++ G    +          + LK        S +P +    P SLP  + E K         ++S + Q + S    + + S +  PH  V    ++   TSP +L +
Sbjct:  261 IDDCPNHRCQNGGVCVDGVN-TYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCID-RVASFSCMCPEGKAGLLCHLDDACIS-NPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPN--GYECQCATGFTGVLCEENIDNCDPDPCHHG-QCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGI-CMDGINRYSCVCSPGFTGQRCNIDIDECAS-NPCRKGATCINGVN---GFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPG---WQGQRCTIDIDECISK--------------------PCMNHGLCHNTQGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVD-----GLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAGAYCDVPNV----SCDIAASRRGVLVEHLCQHSGVCINAGNT--HYCQCPLGYTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGERCEGDINECLSN--------------PCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQ------MPCLNGGTCAVASNMPDG----FICRCPPGFSGARCQ---SSCGQVKCRKGEQC----VHTASGPRCFCPS-------PRDCESGCASSPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPP-----------ATCLSQYCADKARDGVCDEACNSHACQWDGGDC-----------SLTMENPWANC----SSPLPCWDYINNQ-CDELCNTVECLFDNFECQGNSKTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTNLRIKRDSQGELMVYPY--YGEKSAAMKKQRMTRRSLPGEQEQEVAGSKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLT--PERTQ----------------LLYLLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFT-LRRDAS--NHKR----REPVGQDAVGLKNLSVQVSEANLIGTG--TSEHWVDDEGPQP-------------------KKVKAEDEALLSEEDDPIDRRP--WTQQHLEAADIRRTPSLAL------------------TPPQAEQEV--DVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIITDLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQILIRNR--VTDLDARMNDGTTPLILAARLAVEGMVAELINCQA----DVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEY-NVTPSPPGTVLTSALSPVICGPNRSF----------LSLKHTPMGK-KSRRPSAKSTMPTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSPVDS-LESPHTYVSDTTSSPMITSPGILQA 2178          

HSP 2 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 443/1305 (33.95%), Postives = 647/1305 (49.58%), Query Frame = 3
Query:  453 CKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTC--KLIAGNNVCQCLNEWVGEFCEFSSN---CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETP-LCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIG-SYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCI--DLNNDYTCDCPEGLTGKNCEINIDECT---PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCE--TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQL----------NVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACG---FDGGECLHRV 4271
            C N   C +  NG   C+C  G+ G YC+ +  C    CQNGGTC  + + G   C+C + + GE C++S++     S PC NGG C  L    YEC C   + G  C+  ++C S +PC  NG        +  C C  G+TG  C  D++EC   + P  C++GGTC+N  GSYQC+C  GF G+ C++  V C    C NGGTC      ++ C C   + G+ CE     C    C+NGG+C D    Y C C  QWTG+ C +DV           NG   +     Y C+C  G+ G  C  +ID+C   SC  G +CI+ +    C C P  +        + C + PC   A C    LN  Y C CP+G  G +C  ++DEC     NPC +  +C +  G F C+CL+G+ G RCE   + C    PC+ +  CL   +   G+ C+C  G +  +C+ E+++C++  C+ NGQCVD  N  +C+C PGF G  C+I+I++C + PC +G++C D  N Y C C  GF G  CE NI+ C  +PC  +GQC D +  + C C   Y G  C++++D C  + C ND  CI  +  + Y CNC        G  CE + D+C  +                    PC++   C++    + C CS  + G++C   ++ C +NPCR GATC N  +GFRC C  G     C  ++NEC  NPC +   C   ++ Y+C+C +G+ G NCE++ N+C  + C   G C + VNG+ C C + + G NC+     C SNPCLN+G+C +     +  GY C+C   +TG  C+  +  C  NPC +  VC+   + +S+ C C   + G+RC I   E               I+K C +HG C N    G + C C  G+ G  CE +IDDC + PC NGG C DG   + C C PGF G  CQ + NEC S  C N G C D +N+++C C  G  G  CE  ++ C +  C NGG C + I  F C CP GF G  C  +INEC  +              PC   GT  C+D  GT+ CSC   +TGK C+T ++ C +       PC N G C+ K            C+CP+G+ G  C + +  C +          ++C+++G+C    I+   +  C+CP G  G +CE + ++EC S  C +  +C +  G   C C  G  G  CE     C      N  T  D ++  + + C       +C+   +  A G    +GG+C+ R+
Sbjct:   35 CVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLS-HPC-ANGSTCTTVANQFSCKCLTGFTGQKCETDVNEC---DIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMC-PEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHS-DPCQNDATCL---DKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCH-HGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCI--DLVNGYQCNCQPGT---SGVNCEINFDDCASN--------------------PCIH-GICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQVNECLSNPCIH-GNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFD-----DISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDE--------------CISKPCMNHGLCHN--TQGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSH--------------PCLNEGT--CVDGLGTYRCSCPLGYTGKNCQTLVNLCSRS------PCKNKGTCVQKKAES-------QCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVC----INAGNTHYCQCPLGYTGSYCE-EQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCS-CPPGTRGLLCEENIDDCARGPHCLNGGQCMDRI 1245          

HSP 3 Score: 595.504 bits (1534), Expect = 1.524e-172
Identity = 420/1232 (34.09%), Postives = 604/1232 (49.03%), Query Frame = 3
Query:  444 NHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSP--CRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDC--TNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCES--VNYQDYKCICQRGFEGKMCETSIDNCQKIS---CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVN--GFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCE 4097
            +  C NG TC       Y C C  G+ G  C+    C   PC NG TC  +A    C+CL  + G+ CE   N    P  C++GG C +L    Y+CQCP+ + G  C+      + +PC   G C    D   +C+C  G+ G+TC  +ID+C ++    C+NGG C++ V +Y C+C   + G+ C  D+ +C    + C+NGGTC ++ G Y CVC N + G +C      C    C  G  C D    + C+C     G  C  + + C  NPC     C++  +N Q Y C C +G++G  C   +D C   +   C + G C+N      C CL G+ G  CE+++NEC + PCQN+A C+D    +TC C  G  G +CE+ I+EC  NPC+N  +C D+V  F C C  GF G  C+   D C   TPC     C++  N   GY+C C  G     C++ +  C    C +GQC D  +   CIC PG+ G  C  +I+EC+++PC +  +C DL N Y C C PG  G  CEIN ++CA NPC ++G C+D +  + C C   ++G  C   +D C  N C   A CI  N  + + C C    G +  S C   V+EC                +SN    PC++ N C      + C C + + G  CE   N C +NPC+NG TCDNL +G+RC C  GF G  C++ I+EC  NPC N   C D I+ Y C C   ++GKNC+     C+ + C     C +  N   + C C   + G  C      C S PC+N G C N + +     Y+C C  GF+G  CE  +D C  NPC + G C   +++F C C   + G++C+    E               +++ CK+ G C +      + C CQ+G+ G  CE NI++C    C NGG C DG   + C C  GF G  C    NEC S+ C N G C+D +  + C CP G +G+ C+T+V+ C +  C+N G C     + +C CP G+AG  C  D+     +IA +   ++      C  +G   C++   T +C C   +TG YCE ++D C       + PC +   C     + +G    + C C  GY G  C+    +CQ   C+N G C    ID    FKC CPPG  GL CE +  +      C N G C++  G   C C  G  GE+CE
Sbjct:  112 SRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLP-GSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHR---CQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLC-HLDDACISNPCHKGALCDTNPLNGQ-YICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSS-TPCLNGAKCIDHPN---GYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPC-IHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCI--NGVNGFRCICPE--GPHHPS-CYSQVNEC----------------LSN----PCIHGN-CTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGS-----YMCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNE--------------CLSEPCKNGGTCSD--YVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAGAYC--DVPNVSCDIAASRRGVLV--EHLCQHSGV--CINAGNTHYCQCPLGYTGSYCEEQLDEC------ASNPCQHGATC----SDFIG---GYRCECVPGYQGVNCEYEVDECQNQPCQNGGTC----IDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGERCE 1262          

HSP 4 Score: 550.821 bits (1418), Expect = 7.302e-158
Identity = 395/1177 (33.56%), Postives = 559/1177 (47.49%), Query Frame = 3
Query:  408 FCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIH-KYECQCPKNYLGMNC-ELPNSC--GSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQ-------------------------------------GFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDL--FNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCD----------SNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQP-CINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTG---KCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGIC---KNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPH---------------GPCSPTGTLECLDRPGTFHCSCKKYFTGKYCE 3701
            FC   +     + + C+NG TC ++ NG Y C C  G+ G  C E   +C    C  G TC     +  C C     G  C     C S+PC  G +C +  ++ +Y C CP+ Y G +C E  + C   + NPC   GKC+   DG   C C KGY G  C  DI+EC S     C+N  TC++ +G + C C  GF G  CE +I +C ++ C N G C+DK+  ++C+CP  + G  C+     C   PC NG  C D    Y+C C   +TG  C++           ++G C+      Y CIC  G+ G +C   ID C    C N G CI+++ G +CNC PG  G NCEIN ++C + PC +   C+D  N Y+C C  G TG+ C I+IDEC  NPC  GA C + V GF C C +                                     G+VG+ CE   + C    PC+    C N+ N   GY+C C  G +  NC+  + +C +  C+N G C D  +   C C+  + G+ C+  +  C  NPC++ + C++   F  Y C+C PG++G++C I+I+EC   PC  +G C +    + C+C   +SG  C   +D C  N C N   C+ G   +++ C C   L  + G KC+ D++EC  +                    PC N   C +   S+ CKC + ++G  CE  +N C  + C NG TC +  + F C C  GFTG  C  EINEC  +PC N+  C+D +  Y+C C  G++GKNC+   N C+ S C   G CV K    +C C   + G  C+     CD           + C + G CIN     NT  + C C  G+TG  CE ++D C  NPC     C   +  ++C+C   Y G  CE         Y V++ +N+      C++ G C +      FKCSC  G  G  CE NIDDCA  P C+NGG+C D  G Y C+C PGF G  C+ + NEC SN C++     CI   N++ CVC    +GR CET VD C +M C NGG C    N+   F C CP GF+G  C++   + K        +  S P                 PC   G+     +P  + C C   F+G  CE
Sbjct:  294 FCTEDVDECLLQPNACQNGGTC-ANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCV-NTDGAFHCECLKGYAGPRCEMDINECHSDP---CQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGVLCEE-NIDNCDPDPCHHGQCQD-GIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGI-CMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLS-NPCQNGGTCDNLVN---GYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDG--VNTFSCLC---LPGFTGDKCQTDMNECLSE--------------------PCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAG---NT--HYCQCPLGYTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCE---------YEVDECQNQP-----CQNGGTCID--LVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGERCEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCASSPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCE 1412          

HSP 5 Score: 459.529 bits (1181), Expect = 4.968e-129
Identity = 354/1054 (33.59%), Postives = 503/1054 (47.72%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDR--VGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQ-IGP-----------------------------CLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESS-CLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGS--CINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETD---LDSFKCKCNSEYIGERCEI-------KKTETCKSYA--------VEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNI-------DDCASQPCIN---GGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINN 3380
            + +N C +  C+N ATC   I G + C C  G+KG +CE + N C   PC N G C        C C   + G  C+    +C+S+PC NG  C     + YECQC   + G+ CE        +PC  +G+C    D    C CN GY G  CS+ IDEC  Y +P C N G CI+ V  YQC C+ G +G  CE +  DC ++ C + G C+D I  Y CVC   + G  C      C   PC+ G  C +    ++CIC       +C   +    ++    +G C       YKC+C  G+ G  CE   + C    C NGG+C N++ G +C C  GF+G NC++N++EC + PC N   C D  + YTC C    TGKNC+  +  C+PNPC N A C++      +TC C  G+ G RC    D C    PC    +C   +NT+  Y C CP G    +C++++  C    C N G C+D  N   C+C+PGF G  C+ ++NEC + PC++G  C D  N Y C C  GF G  CE NINEC  + C   G C+D +  F C C + ++G  C ++++ C+ + C N+  C+ G    +Y C+C      Y G  C+  V+ C+  R+     G  V   + SQ + P                             C +   CIN   +  C+C   Y G  CE+ L+ C +NPC++GATC +   G+RC CV G+ G  CE E++ECQ+ PC N   CID +N ++C C  G  G  CE N +DC     CL  GQC+D++ G+ C+C   + G  CE     C SNPC ++GS  CI     Q T  YLC CR  FTG  CE  +D C   PC + G C       D F C+C   + G RC+        +K E C   A          +       +  C+H G+C    +   + C C   + GS CE+           C SQ C +    G C +    + C+    + G +C +     ++N  +   C D INN
Sbjct:  455 MDINECHSDPCQNDATCLDKIGG-FTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCID-HPNGYECQCATGFTGVLCEENIDNCDPDPCH-HGQCQDGID-SYTCICNPGYMGAICSDQIDEC--YSSP-CLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIH-GICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYS-QVNECLSNPCIHGNCTG-GLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECIS-KPCMNHGLC---HNTQGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVDG--LGTYRCSCPLG---YTGKNCQTLVNLCS--RSPCKNKGTCVQKKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLGYTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGERCEGDINECLSNPCSSEGSLDCI-----QLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCASSPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPPATCLSQYCADKARDGVCDEACNSHACQ----WDGGDCSLTMENPWANCSSPLPCWDYINN 1478          

HSP 6 Score: 181.415 bits (459), Expect = 6.805e-44
Identity = 140/442 (31.67%), Postives = 199/442 (45.02%), Query Frame = 3
Query: 2823 PCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVC--ETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNEC-YSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGD--FECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSC-VNGF-GKAICHCNKGSCGEKCEITGSACNLA 4124
            PC+N+G C+      N  GY C C  GF G  C+ + D C  N C + G C  +  L    C+C S + GE C+   +  C             +++ C + G C        ++C+CQ G+ G  C+   D C S PC NG  C      + CKC  GF G  C+ + NEC     C + G C++   ++ C CP+G +G++C+++   C    C NGG C+   GD  FECNC  GF G  CE +I++C              P+  C   G   C+D   T++C C   +TG++C   +D C     +    C N G C N       RN  + C+C NG+ G+ C  N   C    C     C    ID   SF C CP G  GL C +D  + C+S  C+    C  N   G+ IC C +G  G  C      C +A
Sbjct:   34 PCVNEGMCVTY---HNGTGY-CKCPEGFLGEYCQHR-DPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPC------------FVSRPCLNGGTCHML-SRDTYECTCQVGFTGKECQW-TDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQT-GDFTFECNCLPGFEGSTCERNIDDC--------------PNHRCQNGGV--CVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNA----CQNGGTCAN-------RNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTC----IDRVASFSCMCPEGKAGLLCHLD--DACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMA 422          
BLAST of Neurogenic locus notch protein vs. UniProt/SwissProt
Match: sp|P46530|NOTC1_DANRE (Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1)

HSP 1 Score: 987.638 bits (2552), Expect = 0.000e+0
Identity = 687/2005 (34.26%), Postives = 978/2005 (48.78%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCK--------KMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSC--VNGFGKAICHCNKGSCGEKCEITG-SACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIP-GGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIF----SIRVFAENSNSDSSK-----SRQKRSLSNSVQQGK---------PGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMN----FPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGL-GEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDY 6302
            ++ C  H C+NG  C   IN  Y C C   + G YC E    C ++P  CQNGGTC    G   C C+N W G+ C E   +CAS+ C +G  C    +  + C+CP    G+ C L ++C S NPC     C      G+  C C  GYTG+ C+ DIDEC+    P CE+GG C+NT GS+QCKC  G+ G RCE D+ +C ++ C+N  TCLD+IG + C+C   Y G  C+     C  +PC NG  C D    + C C   ++G  C  DV               +  N   Y C C  GF G  CE  I+ C    C  G  C + +    C+C PG+ G  CE N+NEC ++PC+N   C D  N Y C CP+G TG NCEINID+C   PC  G +C D++ G+ C C  G+ G  C    D C  L PC     C++  N+   + C+CPDG ++  C  + ++C +  CI+G C+D  N  +C+C  G+ GR C+I INEC +NPC +G  C+D+ + YLC C  GF G  C++NINECA NPC   G CID+V GF+C CMLPY+G  C N L PC+P  C N  +C     + S+ CNC      ++G  CE D++EC  +                    PC N   C N  G F C+C+  + G  CE  +++C  NPC NG  C +  +GF C C+AGF GERC  +I+EC   PC N   C D +N Y C C +GFSG NCEIN  DCTESSC   G CVD ++ F C C   + G  C+H    CDS PC N GSC      Q+  G Y C C  G+TG  C+  + WC  +PC + G C     SF C+C S + G  C++       S  V   +    +  +C+H G C +   T    C CQ+GY GS+C+  +D+C   PC NG  C D  G Y C+C PG+ G+NC    NEC S  C N G CID +N + C CPRG  G  CE  +D C         +  C NGG C + +G + C CP GF G+ CE D+NEC  +              PC P+G+  C+     F C C+  +TGK CET  + C+      + PC N G C      + G    + C C  GY G  C+ +S+ C    C+N   C    +   +S +C C PG  G  C+    + CL   CYN G+C  ++      C C     G  C I   S       D +   + EI  CE+ +C  +  N ICD +CN +ACG+DGG+C            ++   PW NC    S  + C  +FN+ +CD QC T  CL+DG+DC    GQC PL   +C  HYADG C   CN  EC +DG DC +     +  G ++L++ +   E   R  +  L+ L+ LLH+ V   R++NG+ +IF    S    +++  SD +       R +RSL++ ++             G+ VYLE+DN  C   S  CF ++   A F+ A     +   P  I +V +   P +     P            + ++ + + VL         +  +K    ++W+PEG K              VN  +K+ +  +       +   ++ +  S  S  D      +   T+ R      +I E + +          L   D+ +N     PP+ +++     +  R  + +    IA+   SG GL  E    E      ++   +       ++T++                         +GET LHLAA+Y R +AA+ LLE+ +D N  +  GR+ L  A+ A A  V    +  +    DL  +  +G+T LI A + A   +++ L+        D N  D+ G++ALHWAA         +LL  G N+D Q+N+E TPL+LA +EG  E  K+L+ + AN D++DHLD+LPRD+A       IV LLE+Y
Sbjct:  257 VDDCTQHACENGGPCIDGIN-TYNCHCDKHWTGQYCTEDVDECELSPNACQNGGTCHNTIGGFHCVCVNGWTGDDCSENIDDCASAACSHGATCHD-RVASFFCECPHGRTGLLCHLDDACIS-NPCQKGSNCDTNPVSGKAICTCPPGYTGSACNQDIDECSLGANP-CEHGGRCLNTKGSFQCKCLQGYEGPRCEMDVNECKSNPCQNDATCLDQIGGFHCICMPGYEGVFCQINSDDCASQPCLNGK-CIDKINSFHCECPKGFSGSLCQVDVDECASTPCKNGAKCTDGPN--KYTCECTPGFSGIHCELDINECASSPCHYG-VCRDGVASFTCDCRPGYTGRLCETNINECLSQPCRNGGTCQDRENAYICTCPKGTTGVNCEINIDDCKRKPCDYG-KCIDKINGYECVCEPGYSGSMCNINIDDCA-LNPCHNGGTCIDGVNS---FTCLCPDGFRDATCLSQHNECSSNPCIHGSCLDQINSYRCVCEAGWMGRNCDININECLSNPCVNGGTCKDMTSGYLCTCRAGFSGPNCQMNINECASNPCLNQGSCIDDVAGFKCNCMLPYTGEVCENVLAPCSPRPCKNGGVCRESEDFQSFSCNCPAG---WQGQTCEVDINECVRN--------------------PCTNGGVCENLRGGFQCRCNPGFTGALCENDIDDCEPNPCSNGGVCQDRVNGFVCVCLAGFRGERCAEDIDECVSAPCRNGGNCTDCVNSYTCSCPAGFSGINCEINTPDCTESSCFNGGTCVDGISSFSCVCLPGFTGNYCQHDVNECDSRPCQNGGSC------QDGYGTYKCTCPHGYTGLNCQSLVRWCDSSPCKNGGSCWQQGASFTCQCASGWTGIYCDVPSV----SCEVAARQQGVSVAVLCRHAGQCVDAGNT--HLCRCQAGYTGSYCQEQVDECQPNPCQNGATCTDYLGGYSCECVPGYHGMNCSKEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEIDIDDCSPSVDPLTGEPRCFNGGRCVDRVGGYGCVCPAGFVGERCEGDVNECLSD--------------PCDPSGSYNCVQLINDFRCECRTGYTGKRCETVFNGCK------DTPCKNGGTCAVASNTKHG----YICKCQPGYSGSSCEYDSQSCGSLRCRNGATC----VSGHLSPRCLCAPGFSGHECQTRMDSPCLVNPCYNGGTCQPISDAPFYRCSCPANFNGLLCHILDYSFSGGQGRDIAPPVEVEIR-CEIAQCEGRGGNAICDTQCNNHACGWDGGDC-----------SLNFDDPWQNC----SAALQCWRYFNDGKCDEQCATAGCLYDGFDCQRLEGQCNPLYDQYCRDHYADGHCDQGCNNAECEWDGLDCADDVPQKLAVGSLVLVVHIPPDELRNR-SSSFLRELSSLLHTNVVFRRDANGEALIFPYYGSEHELSKHKRSDWTDPGQLMQRARRSLTSFLKPRTRRELDHMEVKGSIVYLEIDNRQCFQQSDECFQSATDVAAFLGALASSGNLNVPYIIEAVTSEGGPPKTGEMYP------------MFLVLLALAVLALAAVGVVVSRKRKREHGQLWFPEGFK--------------VNEPKKKRREPV-----GEDSVGLKPLKNSDSSLMDEQLSEWAEDDTNKRFRFEGQSILEMSGQLDHRQWTQQHLDAADLRLNSMAPTPPQGQIENDCMDVNVRGPDGFTPLMIAS--CSGGGLENENGEAEEDPSADVITDFIYHGANLHNQTDR-------------------------TGETALHLAARYARSDAAKRLLESCADANVQDNMGRTPLHAAVAADAQGVFQILIRNR--ATDLDARMHDGTTPLILATRLAVEGMVEELINCHA----DPNAVDDSGKSALHWAAAVNNVDAAVVLLKNGANKDLQNNKEETPLFLAAREGSYETAKVLLDHLANRDIADHLDQLPRDIAHERMHHDIVRLLEEY 2104          

HSP 2 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 438/1312 (33.38%), Postives = 633/1312 (48.25%), Query Frame = 3
Query:  453 CKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCK-LIAGNNV---CQCLNEWVGEFCEFSSN--CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIG-SYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCID--LNNDYTCDCPEGLTGKNCEINIDECT--PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAV--------------------LSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCE-KFRKSG---NIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRV 4271
            C+NG  C+   +G+  C C   + G  C+  + C  +PC+NGG C+  + GN V   C C+  +    C    N  C +SPCRNGG C  L +  + C+C   + G  C+L + C S NPC   G+C  A +    C C   + G TC  D++ECA   +P C NGGTCIN VGSY C+C   + G  C+     C    C++GGTC+     ++ C C   + G  CE+    C    C+NGG C D    Y C C   WTG+ C +DV           NG         + C+C  G+ G  C  +ID+C   +C +G +C + +    C C P           + C + PCQ  + C    ++    C CP G TG  C  +IDEC+   NPC +G RC +  G F C+CLQG+ G RCE   + CK   PC+ +  CL   +   G+ CIC  G +   C+     C +  C+NG+C+D  N   C C  GF G  C+++++EC + PC++G++C D  N Y C C PGF G  CE++INECA +PC   G C D V  F C C   Y+G  C   ++ C    C N   C   ++ ++Y C C        G  CE ++D+C   + +   YG  +                    +++ +  + PC N   CI+   SF C C   +    C    N C +NPC +G+  D + + +RC C AG+ G  C+I INEC  NPC N   C D  + Y C C++GFSG NC++N N+C  + CL  G C+D V GF+C C   Y G  CE++  PC   PC N G C   + +++   + CNC  G+ G  CE+ ++ C  NPC + GVCE     F+C+CN  + G  CE    + C+                C + G C +     GF C C +G+ G  C  +ID+C S PC NGG C D    Y C C  GF G+NC++NT +C  +SC N G C+D I++FSCVC  G +G +C+  V+ C    CQNGG C++  G ++C CP G+ G  C++ +  C  +              PC   G+  C  +  +F C C   +TG YC+     CE   R+ G    + C + G C++     +       C C  GY G  C+    +CQ N C+N   C     D    + CEC PG  G+ C  + +NECLS  C N G+C++      C C +G+ G  CEI                       +++ C+   D    +  C      F+GG C+ RV
Sbjct:   29 CQNGGICEYKPSGEASCRCPADFVGAQCQFPNPCNPSPCRNGGVCRPQMQGNEVGVKCDCVLGFSDRLCLTPVNHACMNSPCRNGGTCSLLTLDTFTCRCQPGWSGKTCQLADPCAS-NPCANGGQCS-AFESHYICTCPPNFHGQTCRQDVNECAVSPSP-CRNGGTCINEVGSYLCRCPPEYTGPHCQRLYQPCLPSPCRSGGTCVQTSDTTHTCSCLPGFTGQTCEHNVDDCTQHACENGGPCIDGINTYNCHCDKHWTGQYCTEDVDECELSPNACQNGGTCHNTIGGFHCVCVNGWTGDDCSENIDDCASAACSHGATCHDRVASFFCEC-PHGRTGLLCHLDDACISNPCQKGSNCDTNPVSGKAICTCPPGYTGSACNQDIDECSLGANPCEHGGRCLNTKGSFQCKCLQGYEGPRCEMDVNECKS-NPCQNDATCL---DQIGGFHCICMPGYEGVFCQINSDDCASQPCLNGKCIDKINSFHCECPKGFSGSLCQVDVDECASTPCKNGAKCTDGPNKYTCECTPGFSGIHCELDINECASSPCHY-GVCRDGVASFTCDCRPGYTGRLCETNINECLSQPCRNGGTCQ--DRENAYICTCPKGT---TGVNCEINIDDC---KRKPCDYGKCIDKINGYECVCEPGYSGSMCNINIDDCALNPCHNGGTCIDGVNSFTCLCPDGFRDATCLSQHNECSSNPCIHGSCLDQI-NSYRCVCEAGWMGRNCDININECLSNPCVNGGTCKDMTSGYLCTCRAGFSGPNCQMNINECASNPCLNQGSCIDDVAGFKCNCMLPYTGEVCENVLAPCSPRPCKNGGVC---RESEDFQSFSCNCPAGWQGQTCEVDINECVRNPCTNGGVCENLRGGFQCRCNPGFTGALCE-NDIDDCEP-------------NPCSNGGVCQD--RVNGFVCVCLAGFRGERCAEDIDECVSAPCRNGGNCTDCVNSYTCSCPAGFSGINCEINTPDCTESSCFNGGTCVDGISSFSCVCLPGFTGNYCQHDVNECDSRPCQNGGSCQDGYGTYKCTCPHGYTGLNCQSLVRWCDSS--------------PCKNGGS--CWQQGASFTCQCASGWTGIYCDVPSVSCEVAARQQGVSVAVLCRHAGQCVDAGNTHL-------CRCQAGYTGSYCQEQVDECQPNPCQNGATC----TDYLGGYSCECVPGYHGMNCSKE-INECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEI-----------------------DIDDCSPSVDPLTGEPRC------FNGGRCVDRV 1246          

HSP 3 Score: 459.529 bits (1181), Expect = 4.409e-129
Identity = 341/1028 (33.17%), Postives = 499/1028 (48.54%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKS-NCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELP-NSCGSQNPCGVNGKCILANDG--EVKCHCNKGYTGNTCSNDIDECASYETPLCENGGT-------------------------------------CINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCT--------ESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGS--CINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDS---FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDD-CASQPCINGGECG--DGTGMYFCKCQPGFQGVNCQV 3317
            + +N C+++ C+N ATC   I G + C C  GY+G +C+  S +C   PC NG     I   + C+C   + G  C+   + CAS+PC+NG  C     +KY C+C   + G++CEL  N C S +PC       +  DG     C C  GYTG  C  +I+EC S     C NGGT                                     CI+ +  Y+C C+ G++G  C  +I DC  + C NGGTC+D + S+ C+CP+ +    C ++   C   PC +G  C D    Y+C+C   W G+NCD   N C  NPC N G C+ +    Y C C+ GF G  C+ +I+ C    C N GSCI+ + G KCNC+  + G  CE  +  C  +PC+N   C +  +   ++C+CP G  G+ CE++I+EC  NPC NG  CE+  GGF C+C  GF G  CE   D C+   PC    +C +  N   G+ C+C  G   + C +++ +C +  C N G C D  N   C C  GF G  CEI   +C  + C +G  C D  + + C+CLPGF G  C+ ++NEC   PC   G C D    ++C C   Y+G  C + +  C+ + C N   C    +  S+ C C++    + G  C+     C +   Q  +  +AVL         C +  QC++   + +C+C + Y G  C++ ++ C+ NPC+NGATC +   G+ C CV G+ G  C  EINEC   PC N   CID +N Y+C C  G  G +CEI+ +DC+        E  C   G+CVD+V G+ C C   ++G  CE     C S+PC   GS  C+     Q    + C CR G+TG RCE   + C+  PC + G C    ++   + CKC   Y G  CE              + ++S  +  C++   C +   +   +C C  G+ G  C+  +D  C   PC NGG C        Y C C   F G+ C +
Sbjct:  450 MDVNECKSNPCQNDATCLDQIGG-FHCICMPGYEGVFCQINSDDCASQPCLNGKCIDKINSFH-CECPKGFSGSLCQVDVDECASTPCKNGAKCTDGP-NKYTCECTPGFSGIHCELDINECAS-SPCHYG----VCRDGVASFTCDCRPGYTGRLCETNINECLSQP---CRNGGTCQDRENAYICTCPKGTTGVNCEINIDDCKRKPCDYGKCIDKINGYECVCEPGYSGSMCNINIDDCALNPCHNGGTCIDGVNSFTCLCPDGFRDATCLSQHNECSSNPCIHGS-CLDQINSYRCVCEAGWMGRNCDININECLSNPCVNGGTCKDMT-SGYLCTCRAGFSGPNCQMNINECASNPCLNQGSCIDDVAGFKCNCMLPYTGEVCENVLAPCSPRPCKNGGVCRESEDFQSFSCNCPAGWQGQTCEVDINECVRNPCTNGGVCENLRGGFQCRCNPGFTGALCENDIDDCEP-NPCSNGGVCQDRVN---GFVCVCLAGFRGERCAEDIDECVSAPCRNGGNCTDCVNSYTCSCPAGFSGINCEINTPDCTESSCFNGGTCVDGISSFSCVCLPGFTGNYCQHDVNECDSRPCQNGGSCQDGYGTYKCTCPHGYTGLNCQSLVRWCDSSPCKNGGSCW--QQGASFTCQCASG---WTGIYCDVPSVSCEVAARQQGV-SVAVL---------CRHAGQCVDAGNTHLCRCQAGYTGSYCQEQVDECQPNPCQNGATCTDYLGGYSCECVPGYHGMNCSKEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEIDIDDCSPSVDPLTGEPRCFNGGRCVDRVGGYGCVCPAGFVGERCEGDVNECLSDPCDPSGSYNCV-----QLINDFRCECRTGYTGKRCETVFNGCKDTPCKNGGTCAVASNTKHGYICKCQPGYSGSSCE--------------YDSQSCGSLRCRNGATCVSGHLSP--RCLCAPGFSGHECQTRMDSPCLVNPCYNGGTCQPISDAPFYRCSCPANFNGLLCHI 1424          
BLAST of Neurogenic locus notch protein vs. UniProt/SwissProt
Match: sp|P46531|NOTC1_HUMAN (Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4)

HSP 1 Score: 982.63 bits (2539), Expect = 0.000e+0
Identity = 688/2031 (33.87%), Postives = 987/2031 (48.60%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYC--------KKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECL-STKCYNNGSCVNGFGKAI--CHCNKGSCGEKCEITG-SACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIF------------SIRVFAEN-SNSDSSKSRQKRSLSNSVQQGKP-----------GTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNAS------SELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNF----PPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQHRPLMWG 6350
            ++ C  + CKNG  C   +N  Y C C   + G YC E    C + P  CQNGGTC    G   C C+N W GE C E   +CAS+ C +G  C    +  + C+CP    G+ C L ++C S NPC     C     +G+  C C  GYTG  CS D+DEC+    P CE+ G CINT+GS++C+C  G+ G RCE D+ +C ++ C+N  TCLD+IG ++C+C   Y G +CE     C   PC + G C D   ++QC C   +TG  C  DV               +  N   Y C+C  G+ G  CE  ID C    C  G SC + +    C C PG+ G++CE N+NEC ++PC++   C D +N Y C C +G TG NCEIN+D+C  +PC +G  C D++ G+ C C  G+ G  C    D C    PC     C +  N   G+ C CP+G  +  C  E+++C +  C++G C D  N  KC C PG+ G  C+I  NEC +NPC +G  C+D+ + Y+C C  GF G  C+ NINECA NPC   G CID+V G++C C+LPY+G TC   L PC P+ C N   C     Y+S+ C C T    ++G  CE D++EC             VLS       PC +   C NT+G + C C + Y GR CE  +++CR NPC NG +C +  +   C C+ GF G  CE +INEC  +PC N A C D ++ Y C C +GFSG +CE N  DCTESSC   G CVD +N F C C   + G+ C+H    CDS PCL+ G+C           Y C C +G+TGP C+  + WC  +PC + G C      ++C+C S + G  C++       S  V   +    + ++C+H G C +   T    C CQ+GY GS+CE  +D+C+  PC NG  C D  G Y CKC  G+ GVNC    +EC S+ C N G C+D  N + C CPRG  G  CE  VD C        +  +C N G C + +G + C CP GF G+ CE D+NEC  N              PC   GT  C+ R   FHC C+   TG+ CE+ I+ C+        PC N G C        G    F C CP G+ G  C+ +++ C    C N G C    I    S  C C     G  C+    + CL    CYN G+C          C C     G  C I   S    A  D      +E   CEL +C   A NK+C L+CN +ACG+DGG+C            ++   PW NC    ++++ C  +F++  CD QCN+  CLFDG+DC  A GQC PL   +C  H++DG C   CN+ EC +DG DC E     +  G ++++ +   E +       L+ L+ +LH+ V   R+++GQQMIF             I+  AE  +  D+   + K SL     +G             G+ VYLE+DN  C   S  CF ++   A F+ A     S   P  I +VQ+      +  EPP       + +     + +        +  K     ++ +  ++W+PEG K    + S+   +  +  +    + L N  + +      +E G+    TK K    + V     +  T  R  + +                   L   D+ M+     PP+  +      +  R  + +    IA+   SG GL   +  E  D   ++   +    +  ++T++                         +GET LHLAA+Y+R +AA+ LLEA +D N  +  GR+ L  A+ A A  V    +  +    DL  +  +G+T LI A + A   +++ L+        D+N  D+ G++ALHWAA         +LL  G N+D Q+N E TPL+LA +EG  E  K+L+ + AN D++DH+DRLPRD+A+      IV LL++Y N+ +  Q H   + G
Sbjct:  258 IDDCPGNNCKNGGACVDGVN-TYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHD-RVASFYCECPHGRTGLLCHLNDACIS-NPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANP-CEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNT--YTCVCTEGYTGTHCEVDIDECDPDPCHYG-SCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGT-CLDKIDGYECACEPGYTGSMCNINIDECAG-NPCHNGGTCEDGIN---GFTCRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTG---WQGQTCEVDINEC-------------VLS-------PCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTC-----QDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSV----SCEVAAQRQGVDVARLCQHGGLCVDAGNT--HHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSN--------------PCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCK------GKPCKNGGTCAVASNTARG----FICKCPAGFEGATCENDARTCGSLRCLNGGTC----ISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDIPPPLIEEA--CELPECQEDAGNKVCSLQCNNHACGWDGGDC-----------SLNFNDPWKNC----TQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRELDPMDVRGSIVYLEIDNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQS------ETVEPPPPAQLHFMYVAAAAFVLLFFVGCGVLLSRK-----RRRQHGQLWFPEGFKV--SEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQNEWGDEDLETK-KFRFEEPVVLPDLDDQTDHRQWTQQH------------------LDAADLRMSAMAPTPPQGEVDADCMDVNVRGPDGFTPLMIAS--CSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDR-------------------------TGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNR--ATDLDARMHDGTTPLILAARLAVEGMLEDLINSHA----DVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEY-NLVRSPQLHGAPLGG 2131          

HSP 2 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 425/1242 (34.22%), Postives = 615/1242 (49.52%), Query Frame = 3
Query:  453 CKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLI----AGNNVCQCLNEWVGEFC--EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIG-SYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCI--DLNNDYTCDCPEGLTGKNCEINIDECT--PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCET--DLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQL----------NVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKC 4094
            C NG  C++  NG   C C   + G  C+  + C  TPC+N GTC ++      +  C C   + G  C     + C ++PCRNGG C  L + +Y+C+CP  + G +C+  + C S NPC   G+C L  +    CHC   + G TC  D++EC   +  LC +GGTC N VGSY+C C+A   G  CE   V C+   C+NGGTC      ++ C C   + G NCE     C    CKNGG C D    Y C C  +WTG+ C +DV     +     NG      +  Y C+C  G+ G+ C  +ID+C   +CF+G +C + +    C C P           + C + PC   + C    +N    C CP G TG  C  ++DEC+   NPC +  +C + +G F CQCLQG+ G RCE   + C    PC+ +  CL+       ++CIC  G +  +C+    +C +  C+ NG+C+D  NE +C C  GF G  C+ +++EC + PC++G++C D  N Y C+C  G+ G  CE++I+EC  +PC   G C D V  F C C   Y+G  C   ++ C+   C +   C   ++ ++Y C C   L    G  CE ++D+C                       PC +   C++    + C C   Y G  C   ++ C  NPC NG TC++  +GF CRC  G+    C  E+NEC  NPC + A C D +N Y+C C  G+SG NC+IN+N+C  + C+  G C D  +G+ C C E + G NC+     C SNPCLN+G+CI+     +  GY CNC   +TG  CE+ +  C  +PC + G C    D +SF C C + + G+ CE+   E               +   C+H  +C N    GG++C CQ+GY G  CE +IDDC   PC NGG C DG    FC C PGF+G  C+ + NEC S+ C  G  C D +++++C CP G SG  CE     C +  C NGG C + I  F C CP GF G  C+ D+NEC                 PC   GT  C D  G++ C+C + +TG  C+  + +C+      + PC N G C   +         + C CP+G+ G  C + S  C++           +C++ G+C    +D   +  C C  G  G +CE D V+EC  + C N  +C +  G   C C  G  G  C
Sbjct:   31 CLNGGKCEA-ANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCAS-NPCANGGQC-LPFEASYICHCPPSFHGPTCRQDVNECGQ-KPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCEC-PHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVS-NPCQNDATCLDQIGE---FQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHY-GSCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQ--DRDNAYLCFC---LKGTTGPNCEINLDDC--------------------ASSPC-DSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGA-CRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCID-----DVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINE--------------CVLSPCRHGASCQN--THGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQ--------------PCLHGGT--CQDGCGSYRCTCPQGYTGPNCQNLVHWCD------SSPCKNGGKCWQTHT-------QYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLC----VDAGNTHHCRCQAGYTGSYCE-DLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNC 1180          

HSP 3 Score: 474.167 bits (1219), Expect = 1.592e-133
Identity = 373/1098 (33.97%), Postives = 514/1098 (46.81%), Query Frame = 3
Query: 1029 DTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDE----DYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKP--CQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFT--CQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNI--VCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLP--YSGPTCANKLDPCN--PNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTE----------TCKS-------YAVEKFKNESLINKICK------HHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNV--IGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGIC-----------------------LNKYQNEVGRNY--------NFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCE 4097
            +TC NGG C    G+  CVC   + G  C++    C   PCKN G C   D     DY C C   ++G  C   + N C  NPC+N G C+ +   +YKC C  G+ GK C+ + D C    C NGG C+       C+C P F G  C  +VNEC  KP  C++   C +    Y C C    TG NCE     C+P+PC NG  C    G  T  C CL GF G  CE   D C     CK    C++  NT   Y C CP     Q C +++ +C+ +   C N G C + +    C+C+ G+ G  C   I++C +  C HG+ C D    + C C  G  G  C +N + C  NPC     C       +  C  P  Y+GP C+  +D C+   N C +   CI  N   S+ C C   L  Y G +CE DV+EC                +SN    PC ND  C++  G F C C   YEG  CE   + C ++PC +   C +  + F+C C  GFTG  C+ +++EC   PC N AKC+D  N Y C+C  G++G +CE++ ++C    C  +G C D V  F C C   Y G +CE     C S PC + G+C +R        YLC C +G TGP CEI +D C  +PC D G C   +D ++C C   Y G  C I   E          TC+           E + + + ++++ +       HG C +     G+KC C  G+ G+ C++N ++C S PC+NGG C D T  Y C C+ GF G NCQ N NEC SN C N G CID +  + C C    +G  CE ++  C    C+NGG C+       F C CP G+ G+ CE DINEC  +              PC    +  C +  G + C C+  ++G+ CET ID C         PC N G C                       +N+  ++  RN         +++C CP G+ G  C+ N+  C  + C N G C    +D   SF C CPPG  G +C+ D VNEC S  C + G+C +G G   C C +G  G  C+
Sbjct:   29 ETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNP-CLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQA-DPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRP-TGDVTHECACLPGFTGQNCEENIDDCPGNN-CKNGGACVDGVNT---YNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGRTGLLCHLN-DACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCI--NTLGSFECQC---LQGYTGPRCEIDVNEC----------------VSN----PCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCH-YGSCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDN-----AYLCFCLKGTTGPNCEINLDDCASSPC-DSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGACRD--SLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLS--------------PCRHGAS--CQNTHGGYRCHCQAGYSGRNCETDIDDCRPN------PCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTC----VDGINSFTCLCPPGFTGSYCQHD-VNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQ 1057          

HSP 4 Score: 443.351 bits (1139), Expect = 6.295e-124
Identity = 339/1030 (32.91%), Postives = 487/1030 (47.28%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCEL------PNSCG-------------------------------SQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCT--------ESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGS--CINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDS---FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGEC-GDGT-------GMYFCKCQPGFQGVNCQV 3317
            I +N C ++ C+N ATC   I G++ C C  GY+G +CE  ++ C  +PC + G C        C+C   + G  C++  + CAS+PC+NG  C     + Y C C + Y G +CE+      P+ C                                S  PC   G C    D    C C KG TG  C  ++D+CAS       + GTC++ +  Y+C C+ G+ G  C  +I +C  + C NGGTC D I  + C CP  Y    C ++   C   PC +G  CRD    Y+C C   W+G NCD   N C+ NPC N G C+ +    Y C C+ GF G  C+T+I+ C    C N G+CI+ + G KCNCL  + G  CE+ +  C   PC+N  +C    +   ++C CP G  G+ CE++I+EC  +PC +GA C++  GG+ C C  G+ G  CET  D C+   PC     C +  NT     C C  G +   C++++++C +  C NG  C D  +   C C  GF G  CE    +C  + C +G  C D  N + C+C PGF G  C+ ++NEC   PC   G C D    +RC C   Y+GP C N +  C+ + C N   C     +  Y C C +    + G  C+     C +   +    G+ V  +       C +   C++   +  C+C + Y G  CE  ++ C  +PC+NGATC +   G+ C+CVAG+ G  C  EI+EC  +PC N   C+D  N Y+C C  G  G +CEIN +DC            C  +G CVD+V G+ C C   ++G  CE     C SNPC  +G+  C+ R VN     + C CR G TG RCE  ++ C+G PC + G C    ++   F CKC + + G  CE     TC S               C + G C + P +    C C   + G  C+      AS PC+ G  C   GT         Y C C   F G+ C +
Sbjct:  451 IDVNECVSNPCQNDATCLDQI-GEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLD-GPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTC-QDRDNAYLCFCLKGTTGPNCEINLDDCASSPC----DSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGA-CRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMT-SGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRP-NPCHNGGSCTDGINTAF---CDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCW--QTHTQYRCECPSG---WTGLYCDVPSVSCEVAAQR---QGVDVARL-------CQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQR-VND----FHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCE-NDARTCGSLR-------------CLNGGTCISGPRSP--TCLCLGPFTGPECQFP----ASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHI 1427          

HSP 5 Score: 202.216 bits (513), Expect = 2.713e-50
Identity = 173/587 (29.47%), Postives = 241/587 (41.06%), Query Frame = 3
Query:  411 CPIAISLNFCENHKCKNGATCQSDIN-----------------GKYVCECAYGYKGTYCEQKS-NCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCE-LPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYE-------TPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNC--------QKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPC--QNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC---EDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINE-CF-NNPCQHGSQCQDLFND--YLCICLPGFKGKKCEI 2039
            C   I+  FC+      G  C+ DIN                   Y C C  G+ G +CE  + +C  + C NGGTC     +  C C   + G +C+   N C S PC +GG C+      Y C CP+ Y G NC+ L + C S +PC   GKC   +  + +C C  G+TG  C      C             LC++GG C++   ++ C+C+AG+ G  CE+ + +C+   C+NG TC D +G Y C C   Y G NC  +   C   PC+NGG C D    Y+C                                        C RG +G  CE ++D+C        +   CFN G+C++ + G  C C PGF G  CE +VNEC + PC  +    C+   ND+ C+C  G TG+ CE  I+ C   PC NG  C    +   GF C+C  GF G  CE  +  C  L        CLN                                 G C+       C+C+  F G  C+   +  C   NPC +   C+       Y C+C   F G  C I
Sbjct:  922 CTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQD-GCGSYRCTCPQGYTGPNCQNLVHWCDS-SPCKNGGKCWQTHT-QYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKC---------------------------------------SCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCGSLR-------CLN--------------------------------GGTCISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHI 1427          
BLAST of Neurogenic locus notch protein vs. UniProt/SwissProt
Match: sp|Q01705|NOTC1_MOUSE (Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3)

HSP 1 Score: 982.245 bits (2538), Expect = 0.000e+0
Identity = 684/2023 (33.81%), Postives = 987/2023 (48.79%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYC--------KKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECL-STKCYNNGSC----VNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTK--------------VYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNAS------SELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNF----PPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQHRPLMWG 6350
            ++ C  + CKNG  C   +N  Y C C   + G YC E    C + P  CQNGGTC    G   C C+N W GE C E   +CAS+ C  G  C    +  + C+CP    G+ C L ++C S NPC     C     +G+  C C  GYTG  CS D+DECA    P CE+ G C+NT+GS++C+C  G+ G RCE D+ +C ++ C+N  TCLD+IG ++C+C   Y G  CE     C   PC + G C D   ++QC C   + G  C  DV               +  N   Y C+C  G+ G  CE  ID C    C  G SC + +    C C PG+ G++CE N+NEC ++PC++   C D +N Y C C +G TG NCEIN+D+C  NPC +G  C D++ G+ C C  G+ G  C    D C   +PC     C    +  +G+ C CP+G  +  C  E+++C +  CI+G C D  N  KC C PG+ G  C+I  NEC +NPC +G  C+D+ + Y+C C  GF G  C+ NINECA NPC   G CID+V G++C C LPY+G TC   L PC  + C N  +C     Y+S+ C C T    ++G  CE D++EC                       PC +   C NTNGS+ C C + Y GR CE  +++CR NPC NG +C +  +   C C+ GF G  CE +INEC  NPC N A C D ++ Y C C  GF+G +CE N  DCTESSC   G CVD +N F C C   + G+ C++    CDS PCL+ G+C      Q++ G Y C C +G+TG  C+  + WC   PC + G C      + C+C S + G  C++    +C+  A ++  + +L   +C+H G C +  E     C CQ+GY GS+CE  +D+C+  PC NG  C D  G + CKC  G+ G NC    NEC S  C N G CID  N++ C CPRG  G  CE  VD C        +  +C N G C + +G + C CP GF G+ CE D+NEC  N              PC P GT  C+ R   FHC C+   TG+ CE+ I+ C         PC N G+C        G    F C CP G+ G  C+ +++ C    C N G C    I    S  C C     G  C+    + C+ S  CYN G+C     N F + +C       G  C I   +    +  +    Q E + CEL +C   A NK+C+L+CN +ACG+DGG+C            ++   PW NC    ++++ C  +F++  CD QCN+  CLFDG+DC    GQC PL   +C  H++DG C   CN+ EC +DG DC E     +  G ++L+ +   + +       L+ L+H+LH+ V   R++ GQQMIF      E       K       ++S+  G  G +              VYLE+DN  C   S  CF ++   A F+ A     S   P  I +V++      +  EPP      L+ +     + +        +  K     ++ +  ++W+PEG K    + S+   +  +  +    + L N  + +      +E G+    TK K    + V     +  T  R  + +                   L   D+ M+     PP+  +      +  R  + +    IA+   SG GL   +  E  D   ++   +    +  ++T++                         +GET LHLAA+Y+R +AA+ LLEA +D N  +  GR+ L  A+ A A  V    L  +    DL  +  +G+T LI A + A   +++ L+        D+N  D+ G++ALHWAA         +LL  G N+D Q+N+E TPL+LA +EG  E  K+L+ + AN D++DH+DRLPRD+A+      IV LL++Y N+ +  Q H   + G
Sbjct:  258 VDDCPGNNCKNGGACVDGVN-TYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHD-RVASFYCECPHGRTGLLCHLNDACIS-NPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANP-CEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLDGPNT--YTCVCTEGYTGTHCEVDIDECDPDPCHYG-SCKDGVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCLKGTTGPNCEINLDDCASNPCDSGT-CLDKIDGYECACEPGYTGSMCNVNIDECAG-SPCHNGGTC---EDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTG---WQGQTCEVDINEC--------------------VKSPCRHGASCQNTNGSYRCLCQAGYTGRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTC------QDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQYHCECRSGWTGVNCDVLSV-SCEVAAQKRGIDVTL---LCQHGGLCVD--EGDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSN--------------PCDPRGTQNCVQRVNDFHCECRAGHTGRRCESVINGCR------GKPCKNGGVCAVASNTARG----FICRCPAGFEGATCENDARTCGSLRCLNGGTC----ISGPRSPTCLCLGSFTGPECQFPASSPCVGSNPCYNQGTCEPTSENPFYRCLCPAKFN--GLLCHILDYSFTGGAGRDIPPPQIEEA-CELPECQVDAGNKVCNLQCNNHACGWDGGDC-----------SLNFNDPWKNC----TQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQLTEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVLVVLLPPDQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQMIFPYYGHEEELRKHPIKRSTVGWATSSLLPGTSGGRQRRELDPMDIRGSIVYLEIDNRQCVQSSSQCFQSATDVAAFLGALASLGSLNIPYKIEAVKS------EPVEPPLPSQLHLMYVAAAAFVLLFFVGCGVLLSRK-----RRRQHGQLWFPEGFKV--SEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQNEWGDEDLETK-KFRFEEPVVLPDLSDQTDHRQWTQQH------------------LDAADLRMSAMAPTPPQGEVDADCMDVNVRGPDGFTPLMIAS--CSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDR-------------------------TGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILLRNR--ATDLDARMHDGTTPLILAARLAVEGMLEDLINSHA----DVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEY-NLVRSPQLHGTALGG 2121          

HSP 2 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 431/1242 (34.70%), Postives = 612/1242 (49.28%), Query Frame = 3
Query:  453 CKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLI-AGNNV---CQCLNEWVGEFC--EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDK-IGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCI--DLNNDYTCDCPEGLTGKNCEINIDECT--PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCE--TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLN----------VCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKC 4094
            C NG  C+   NG   C C+  + G  C+  + C  TPC+N GTC ++  G  V   C C   + G  C     + C ++PCRNGG C  L + +Y+C+CP  + G +C+  + C S NPC   G+C L  +    C C  G+ G TC  D++EC S    LC +GGTC N +GSY+C C+A   G  CE   V C+   C+NGGTC      ++ C C   + G NCE     C    CKNGG C D    Y C C  +WTG+ C +DV     +     NG      +  Y C+C  G+ G+ C  +ID+C   +CF G +C + +    C C P           + C + PC   + C    +N    C CP G TG  C  ++DEC    NPC +  +C + +G F CQCLQG+ G RCE   + C    PC+ +  CL   +    ++CIC  G +   C+    +C +  C+ NG C+D  NE +C C  GF G  C+ +++EC + PC++G++C D  N Y C+C  G+ G  CE++I+EC  +PC   G C D V  F C C   Y+G  C   ++ C+   C +   C   ++ +SY C C   L    G  CE ++D+C  +                    PC +   C++    + C C   Y G  C   ++ C  +PC NG TC++   GF CRC  G+    C  E+NEC  NPC + A C D +N Y+C C  G+SG NC+IN+N+C  + C+  G C D  +G+ C C E + G NC+     C SNPCLN+G+CI+     +  GY CNC   +TG  CE+ +  C  +PC + GVC+   D +SF C C + + G+ CE+   E  KS               C+H  +C N    G ++C CQ+GY G  CE +IDDC   PC NGG C DG    FC C PGFQG  C+ + NEC SN C  G  C D +++++C CP G +G  CE     C +  C NGG C + I  F C CP GF G  C+ D+NEC                 PC   GT  C D  GT+ C+C + +TG  C+  + +C+      + PC N G C          N  + C C +G+ G  C + S  C++           +C++ G+C    +D+     C C  G  G +CE D V+EC    C N  +C +  G   C C  G  G  C
Sbjct:   31 CLNGGRCEV-ANGTEACVCSGAFVGQRCQDSNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCAS-NPCANGGQC-LPFESSYICRCPPGFHGPTCRQDVNEC-SQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCEC-PHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECIS-NPCQNDATCL---DQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHY-GSCKDGVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQ--DRDNSYLCLC---LKGTTGPNCEINLDDCASN--------------------PC-DSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGA-CRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCID-----DVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKS--------------PCRHGASCQN--TNGSYRCLCQAGYTGRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSR--------------PCLHGGT--CQDSYGTYKCTCPQGYTGLNCQNLVRWCD------SAPCKNGGRCWQT-------NTQYHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLC----VDEGDKHYCHCQAGYTGSYCE-DEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNC 1180          

HSP 3 Score: 473.781 bits (1218), Expect = 1.997e-133
Identity = 376/1113 (33.78%), Postives = 519/1113 (46.63%), Query Frame = 3
Query: 1032 TCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDE----DYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKP--CQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFT---CQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNI--VCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLP--YSGPTCANKLDPC--NPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTE----------TCKSYAV-------EKFKNESLINKICK------HHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNV--IGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNP--HGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGI-----------CLNKYQ--------NEVGRNY------------NFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDN 4136
            TC NGG C    G+  CVC   + G  C++    C   PCKN G C   D     DY C C   ++G  C   + N C  NPC+N G C+ +   +YKC C  G+ GK C+ + D C    C NGG C+       C C PGF G  C  +VNEC   P  C++   C +    Y C C    TG +CE+    C+P+PC NG  C  R  G T   C CL GF G  CE   D C     CK    C++  NT   Y C CP     Q C +++ +C+ +   C N G C + +    C+C+ G+ G  C   I++C +  C  G+ C D    + C C  G  G  C +N + C  NPC     C       +  C  P  Y+GP C+  +D C    N C +   C+  N   S+ C C   L  Y G +CE DV+EC                +SN    PC ND  C++  G F C C   YEG  CE   + C ++PC +   C +  + F+C+C  GF G  C+ +++EC   PC N AKC+D  N Y C+C  G++G +CE++ ++C    C  +G C D V  F C C   Y G +CE     C S PC + G+C +R  +     YLC C +G TGP CEI +D C  NPC D G C   +D ++C C   Y G  C +   E          TC+           E + + + ++++ +       HG C +     G+KC C  G+ G+ C++N ++C S PC+NGG C D T  Y C C+ GF G NCQ N NEC SN C N G CID +  + C CP   +G  CE ++  C    C+N G+CK       F C CP G+ G+ CE DINEC           + +P  HG         C +  G++ C C+  +TG+ CE+ ID C         PC N G            CL  +Q        NE   N             +++C CP G+ G  C+ N+  C  + C N G C    +D   SF C CPPG  G +C+ D VNEC S  C + G+C + +G   C C +G  G  C+     C+ A   N
Sbjct:   30 TCLNGGRCEVANGTEACVCSGAFVGQRCQDSNP-CLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQA-DPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTC--RPTGDTTHECACLPGFAGQNCEENVDDCPGNN-CKNGGACVDGVNT---YNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPHGRTGLLCHLN-DACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCL--NTLGSFECQC---LQGYTGPRCEIDVNEC----------------ISN----PCQNDATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCH-YGSCKDGVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNS-----YLCLCLKGTTGPNCEINLDDCASNPC-DSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDG--LNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINEC-----------VKSPCRHG-------ASCQNTNGSYRCLCQAGYTGRNCESDIDDCRPN------PCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTC----VDGINSFTCLCPPGFTGSYCQYD-VNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKN 1070          

HSP 4 Score: 441.425 bits (1134), Expect = 2.743e-123
Identity = 343/1027 (33.40%), Postives = 480/1027 (46.74%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELP--------------------------------------NSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDC--------TESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGS--CINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDS---FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDD--CASQPCINGGECGDGT--GMYFCKCQPGFQGVNCQV 3317
            I +N C ++ C+N ATC   I G++ C C  GY+G YCE  ++ C  +PC + G C        CQC   + G  C++  + CAS+PC+NG  C     + Y C C + Y G +CE+                                       N C SQ PC   G C    D    C C KG TG  C  ++D+CAS       + GTC++ +  Y+C C+ G+ G  C  +I +C    C NGGTC D I  + C CP  Y    C ++   C   PC +G  CRD    Y+C C   W+G NCD   N C+ NPC N G C+ +    Y C C+ GF G  C+T+I+ C    C N G+CI+ + G KCNC   + G  CE+ +  C   PC+N+  C +  +   ++C CP G  G+ CE++I+EC  +PC +GA C++  G + C C  G+ G  CE+  D C+   PC     C +  NT     C C  G Q   C++++++C +  C NG  C D  +   C C  GF G  CE    +C  + C +G  C D  N + C+C PGF G  C+ ++NEC   PC   G C D    ++C C   Y+G  C N +  C+   C N   C   N    YHC C +    + G  C+     C +   +    G+ V  +       C +   C++      C C + Y G  CE  ++ C  NPC+NGATC +   GF C+CVAG+ G  C  EINEC   PC N   CID  N Y+C C  G  G +CEIN +DC            C  +G CVD+V G+ C C   ++G  CE     C SNPC  +G+  C+ R VN     + C CR G TG RCE  ++ CRG PC + GVC    ++   F C+C + + G  CE     TC S               C + G C + P +    C C   + G  C+         S PC N G C   +    Y C C   F G+ C +
Sbjct:  451 IDVNECISNPCQNDATCLDQI-GEFQCICMPGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLD-GPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCQPGYTGHHCETNINECHSQ-PCRHGGTC-QDRDNSYLCLCLKGTTGPNCEINLDDCASNPC----DSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGA-CRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMT-SGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQAGYTGRNCESDIDDCRP-NPCHNGGSCTDGINTAF---CDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNT--QYHCECRSG---WTGVNCDVLSVSCEVAAQK---RGIDVTLL-------CQHGGLCVDEGDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSNPCDPRGTQNCVQR-VND----FHCECRAGHTGRRCESVINGCRGKPCKNGGVCAVASNTARGFICRCPAGFEGATCE-NDARTCGSLR-------------CLNGGTCISGPRSP--TCLCLGSFTGPECQFPASSPCVGSNPCYNQGTCEPTSENPFYRCLCPAKFNGLLCHI 1427          

HSP 5 Score: 269.626 bits (688), Expect = 1.060e-70
Identity = 218/723 (30.15%), Postives = 311/723 (43.02%), Query Frame = 3
Query: 2364 GPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXG------------------------------------------ATCDNLA-DGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESS--CLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQ--INNFS-CVCPRGVSGRFCETIVDYCK--KMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDL---ECNKYACGFDGGECLHRVPKRIDGNDISIASPWS----NCEIIKSENIPCHN 4361
            G CLN  +C   NG+  C CS  + G++C+             G                                           TCD L    ++CRC  G++G+ C+ + + C  NPC+N  +C+   + Y C C  GF G  C  + N+C+++   C   G C +++  + C C   + G +CE    PC  +PC N G+C  R     T  + C C  GF G  CE  +D C GN C + G C   ++++ C+C  E+ G+            Y  E      L+   C++ G C N    GG+ C C +G+ G  C  NIDDCAS  C  G  C D    ++C+C  G  G+ C +N + C SN CN G   D   +N  + C CP G +G  C   VD C      C++ G C N +G FEC C +G+ G  CE D+NEC           ISN   PC    T  CLD+ G F C C   + G YCE   D C       + PC +NG C++K          F C CP G+ G  C+ +  +C    CKN   C    +D   ++ C C  G  G  CE+D ++EC    C+  GSC +G     C C  G  G  CE   + C+     +  T QD   +  L  C        C++   +C    C  D G CL     +IDG + +    ++    N  I +    PCHN
Sbjct:   29 GTCLNGGRCEVANGTEACVCSGAFVGQRCQDSNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQ-QADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTC--RPTGDTT--HECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQ------------YCTEDVDECQLMPNACQNGGTCHN--THGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPHGRTGLLCHLN-DACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNEC-----------ISN---PCQNDAT--CLDQIGEFQCICMPGYEGVYCEINTDEC------ASSPCLHNGHCMDKIN-------EFQCQCPKGFNGHLCQYDVDECASTPCKNGAKC----LDGPNTYTCVCTEGYTGTHCEVD-IDECDPDPCH-YGSCKDGVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDR-DNSYLCLCLKGTTGPNCEINLDDCASNPC--DSGTCL----DKIDGYECACEPGYTGSMCNVNIDECAGSPCHN 689          

HSP 6 Score: 207.994 bits (528), Expect = 4.784e-52
Identity = 173/587 (29.47%), Postives = 246/587 (41.91%), Query Frame = 3
Query:  411 CPIAISLNFCENHKCKNGATCQSDIN-----------------GKYVCECAYGYKGTYCEQKS-NCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCE-LPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYE-------TPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNC--------QKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPC--QNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC---EDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINE--CFNNPCQHGSQCQDLFND--YLCICLPGFKGKKCEI 2039
            C   I+  FC+      GA C+ DIN                   Y C C  G+ G +CE  + +C  + C NGGTC     +  C C   + G +C++  N C S PC +GG C+      Y+C CP+ Y G+NC+ L   C S  PC   G+C   N  +  C C  G+TG  C      C           T LC++GG C++    + C C+AG+ G  CE+++ +C+ + C+NG TC D +G + C C   Y G+NC  +   C  +PC+NGG C D    Y+C                                        C RG +G  CE ++D+C        +   CFN G+C++ + G  C C PGF G  CE +VNEC + PC  +    C+   ND+ C+C  G TG+ CE  I+ C   PC NG  C    +   GF C+C  GF G  CE  +  C  L        CLN                                 G C+       C+C+  F G  C+   +     +NPC +   C+    +  Y C+C   F G  C I
Sbjct:  922 CTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQD-SYGTYKCTCPQGYTGLNCQNLVRWCDSA-PCKNGGRCWQTNT-QYHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKC---------------------------------------SCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECRAGHTGRRCESVINGCRGKPCKNGGVCAVASNTARGFICRCPAGFEGATCENDARTCGSLR-------CLN--------------------------------GGTCISGPRSPTCLCLGSFTGPECQFPASSPCVGSNPCYNQGTCEPTSENPFYRCLCPAKFNGLLCHI 1427          

HSP 7 Score: 117.087 bits (292), Expect = 1.883e-24
Identity = 107/350 (30.57%), Postives = 145/350 (41.43%), Query Frame = 3
Query: 3222 SQP---CINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKC--IDQ--INNFSCVCPRGVSGRFCETIVD-YCKKMECQNGGICKNV-IGDFECNCPKGFAGKLCETDINECKYNIAGNATNLI-----------SNPHGPCSPTGTLECLDRP-------------GTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNEC--LSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEIS 4163
            SQP   C+NGG C    G   C C   F G  CQ ++N C S  C N G C  +D     +++C CP G SG  C T +D  C    C+NGG C  + + +++C CP G++GK C+   + C  N   N    +              HGP       EC   P             G++ C+C+   TG +CE     C         PC N G C          +    C C  G+ G+ C+ N   C  N CKN G C    +D   ++ C CPP   G +C  D V+EC  +   C N G+C N  G   C C  G  GE C      C  A+     T  D ++
Sbjct:   25 SQPSGTCLNGGRCEVANGTEACVCSGAFVGQRCQ-DSNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQ-QADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSP------SPCQNGGTC------RPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGAC----VDGVNTYNCRCPPEWTGQYCTED-VDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVA 355          
BLAST of Neurogenic locus notch protein vs. TrEMBL
Match: A0A0M5J369 (N OS=Drosophila busckii OX=30019 GN=Dbus_chrXg680 PE=4 SV=1)

HSP 1 Score: 1068.53 bits (2762), Expect = 0.000e+0
Identity = 705/1992 (35.39%), Postives = 1015/1992 (50.95%), Query Frame = 3
Query:  426 SLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILAN-DGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLI--NKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEI-----------TGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQCP--LQSFCDKHYADGQCQLECNTMECSFDGGDC-IESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKK--PEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLL-VSGNGLGEFSP---TESRDKQIIVEKLLQIAVTNQDETNK-FADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYV 6305
            S + C  H C+NG TC   IN  Y C C   + G YC+   + C + P  CQNG TC    G+  C C+N W G  C  +  +C  + C NG  C    +  + C+C     G+ C L ++C S NPC  +  C  +  +G   C C  GY G  CS DIDEC   +   CE+ G C+NT GS+ C C  GF G RCE +I +C +  C+N G+CLD  G++RCVC   + GT CE     C+  PC NGGIC D    ++C C   +TG  C    + C+  PC+NNG C  +    Y C C  G+ G  CE +I++C    C  G  CI+     KC C PGF G  C+  +NECE+ PCQ    C+D    Y C C  G +GKNCEIN++EC  NPC NGA C D +  ++CQC+ GF G  CE   D C   +PC    +C+++ N   GYKC CP G  +  C  ++ +C +  C+N G+C D  NE  C C PG+ G+ CE +I+EC +NPCQHG  C D  N + C C+PG+ G KCE NI++C  NPC   G CID+V G++C C +PY+G  C ++LDPC  N C N+A C P   +  + C+C      Y G  C++D+DEC                       PC N   C+N  GS+ C C+  YEGR C    ++C + PC+NG TC +    F C CV GF G+ CE +INEC   PC N A C  ++N Y C C  GFSG NC+ ND DCTESSCL  G C+D +NG+ C C   Y G NC++    CDSNPCLN  +C  ++       Y C+C  GFTG +C   +DWC  +PC +   C      F CKC   + G+ C++ +T +C+  A+ K  +   +  N  CK+HGN           C CQ GY GS+C+ +ID+CASQPC +GG C D  G Y C C+ GFQG NC++N ++C  N C N G C D +  FSC CP G  G  CE   D C +  C N G C + +G FEC CP GF G  CE DINEC  N              PC+  GTL+C+     +HC+C+    G++CE ++++C +       PC N G+C  K   + G +    C+C  G+ G+ C+ + + C  N C+  G C    IDD   ++CEC  G  G  CE D ++EC S  C    SC+N  G   C C     G++CEI             +   L     +   Q +   CE   C  K  N +C+ ECN YAC FDG +C   +            +PW+NC   +     C   F + +C+ +CN  ACL+DG DC   + +C    +++C KHY DG C   CN  ECS+DG DC ++ ++  +  G + ++ +       + + + L+ ++H+L + VR+ +++ G  MIFS +  A   +   +   +K  +  + + G+ G ++YLE+DN  C      CF+ +  AAEF+ A+    ++    PI SV+   +PG      EP N        +  ++   +LV +   F      T  K+      W+PEG  R          +R       RN N      +S +  ++ Q+  S    +D  D+S        R  +         +++  VSE        D  +        + H+D+ + R I     +   N L V   G    +P      R   +   + ++I   N+D T +  +DL  +           L + +  +GET LHLA++Y R +AA+ LL+AG+D N  +  GR+ L  A+ A A+ V    L  +    +L+ +  +G+T LI A + A   +++ L+        D+N  D  G+TALHWAA       V++LL +  NRDAQD+++ TPL+LA +EG  E CK L+ N AN +++DH+DRLPRDVA       IV LL+++V
Sbjct:  287 SFDDCFGHLCQNGGTCVDGIN-DYRCNCPPNFTGRYCDADVDECAMRPSVCQNGATCTNTHGSYSCICVNGWAGSDCSQNIDDCQQAACFNGATCID-GVGSFYCRCTAGKTGLLCHLDDACTS-NPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECD--QGSPCEHNGICVNTPGSFVCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNGGICHDKINGFKCGCALGFTGTRCQTNIDDCQSQPCRNNGICHDL-IAGYSCECPPGYTGASCEVNINDCDSNPCHRG-KCIDGDNSFKCLCDPGFTGYLCQKQINECESNPCQFGGHCVDRVGSYLCHCLPGTSGKNCEINVNECHSNPCNNGASCIDGINSYSCQCVPGFTGPHCELNVDECAS-SPCANNGVCIDLVN---GYKCECPRGFYDARCLSDVDECASSPCVNDGRCEDGINEFICHCPPGYMGKRCEQDIDECASNPCQHGGSCFDKLNAFSCQCMPGYTGHKCETNIDDCLSNPCANGGTCIDKVNGYKCVCKVPYTGANCESQLDPCASNRCRNEAKCTPSANFLDFSCSCKLG---YTGRYCDEDIDECAFSS-------------------PCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDFSCLCVDGFDGKHCETDINECLSMPCQNGATCRQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLATYSGANCQYKLNKCDSNPCLNGATCHEQRDE-----YTCHCPSGFTGKQCGDYVDWCAQSPCENGASCSQLKHQFSCKCAPGWTGKLCDV-QTISCQDAALRKGLSVKQLCNNGTCKNHGN--------SHVCYCQQGYAGSYCQQDIDECASQPCQHGGSCRDLVGAYECSCRQGFQGQNCELNIDDCAPNPCQNGGTCHDLVQGFSCSCPPGTLGIICELNHDDCVQGACHNNGSCIDRVGGFECACPPGFVGARCEGDINECLSN--------------PCANAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVNFCAQ------SPCQNGGVCSTK---QAGHH----CLCGEGFYGKNCEFSGQDCDSNPCR-AGQC---SIDDAGGYRCECTRGTAGQHCEQDTLDECASNPCQQRASCINLLGDYECLCPAKWTGKRCEIYDASYAGTTRRAHATPTLGLEQFAADLQQQRELCEQRGCNEKQSNGVCNPECNSYACNFDGNDCSLGI------------NPWANCTANE-----CWRVFMDGQCNEECNNAACLYDGRDCEQKLKRCADIFETYCQKHYGDGHCDYGCNNAECSWDGLDCEVKEQSPQLAEGAMSVVMLMDMHQFRQQQAQFLREMSHVLRTTVRVKKDALGNDMIFSWKGAARLPDIQDTDFGRKHKILYTERNGQTGIQIYLEIDNRKCTE----CFNRATEAAEFLAASASKHTFANRYPIYSVRGVQNPGEDDTLAEPAN--------VKYVITGIILVILALAFFGMVLSTQRKRAHGV-TWFPEGF-RAPAAAVMSRRRRDALGQEMRNLNKQQ-GLSSQQAAHLAQLPPSVAHWSD--DESDLPQAKRQRQLNENTGSVAYASDHTMVSE----YEEADQRV------WSQAHLDVADVRAIMTPPAHQDGNKLDVDARGPCGLTPLMIAAVRGGGLDSGEDIEI---NEDSTAQVISDLLAQG--------AELNATMDKTGETSLHLASRYARADAAKRLLDAGADANCQDNTGRTPLHAAVAADAMGVFQILLRNR--ATNLNARMHDGTTPLILAARLAIEGMVEDLITADA----DINAADNSGKTALHWAAAVNNTEAVNILLMHHANRDAQDDKDETPLFLAAREGSYEACKALLDNFANREITDHMDRLPRDVASERLHHDIVRLLDEHV 2139          

HSP 2 Score: 376.326 bits (965), Expect = 8.593e-101
Identity = 262/782 (33.50%), Postives = 362/782 (46.29%), Query Frame = 3
Query: 1881 KCICIPGFEGRTCEIEI-NECFNNPCQHGSQCQ-DLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQC--IDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNP--CSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQ-----------------------------------NTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEI 4100
             C+C  GFE   CEI + N C    C +G  CQ     +Y C+C  G+ G+ CE   N CA +PC   G C  +     F C C   ++G TC+  ++ C  N C     C+  N + SY C C      Y G  C+     C+                      PC N   C     ++ CKC S +EG+ CE   ++C  + C+NG TC +  + +RC C   FTG  C+ +++EC   P  C N A C +    Y CIC +G++G +C  N +DC +++C     C+D V  F C+C     G  C HL   C SNPC     C    +N                                    NTPG ++CNC +GFTGPRCE  ++ C  +PC + G C  D  +F+C C   + G +CEI   E C+S       N  L   IC    N        GFKC C  G+ G+ C+ NIDDC SQPC N G C D    Y C+C PG+ G +C+VN N+C SN C+ GKCID  N+F C+C  G +G  C+  ++ C+   CQ GG C + +G + C+C  G +GK CE ++NEC  N   N  +                C+D   ++ C C   FTG +CE  +D C       + PC NNG+C++           + C CP G+   RC  +  +C  + C N+G C     D    F C CPPG  G  CE D ++EC S  C + GSC +      C C  G  G KCE 
Sbjct:  117 SCLCPLGFEESLCEIAVPNACDEARCFNGGTCQLKTLQEYTCLCANGYTGEHCETQ-NLCASSPCRNGGTCTALAGSGSFTCNCPAGFTGHTCSEDVEECRSNPCQYGGTCV--NTHGSYQCMCPAG---YTGKDCDTKYKPCSPS--------------------PCQNGGTCRANGLTYDCKCPSGFEGKNCESSFDDCFGHLCQNGGTCVDGINDYRCNCPPNFTGRYCDADVDECAMRPSVCQNGATCTNTHGSYSCICVNGWAGSDCSQNIDDCQQAACFNGATCIDGVGSFYCRCTAGKTGLLC-HLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSFVCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDE-CQS-------NPCLNGGICHDKIN--------GFKCGCALGFTGTRCQTNIDDCQSQPCRNNGICHDLIAGYSCECPPGYTGASCEVNINDCDSNPCHRGKCIDGDNSFKCLCDPGFTGYLCQKQINECESNPCQFGGHCVDRVGSYLCHCLPGTSGKNCEINVNECHSNPCNNGAS----------------CIDGINSYSCQCVPGFTGPHCELNVDEC------ASSPCANNGVCIDLVN-------GYKCECPRGFYDARCLSDVDECASSPCVNDGRCE----DGINEFICHCPPGYMGKRCEQD-IDECASNPCQHGGSCFDKLNAFSCQCMPGYTGHKCET 821          
BLAST of Neurogenic locus notch protein vs. TrEMBL
Match: V4BGJ2 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_184955 PE=4 SV=1)

HSP 1 Score: 1060.06 bits (2740), Expect = 0.000e+0
Identity = 705/1946 (36.23%), Postives = 1031/1946 (52.98%), Query Frame = 3
Query:  552 CPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILAN-DGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCE------ITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNC-KTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGM--KRLNQQTSQFNHKRLVNSNRKRNQ------NLLNCHNASSELG-NIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVS---GNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDY 6302
            C  TP  CQNGGTC       +C C+N W G  C E   +C ++PC NGG C+   +  + C+CP+   GM C L ++C S NPC     C  +  DG   C C +G+TG+TCS D+DEC       CE+GGTCINT GSY+C C  GF G  CE +I +C+++ C N GTCLD+ G+YRC+C   + G NCE +   C   PC NGG+C+D    ++C C   + G  C    + C+  PC N G C       Y C C+ G+ G  C+ ++DNC+K+ C +G +C++ ++   C+CLPG+ G  C+ +++EC + PC+    C +L+N Y C CP G +G+NCE N +EC  NPC NGA C D +  + C+C  G+ G  CE   D C    PC     C ++ N    +KC CP G  +  C+  +++C +  C+N G CVD  N+ +C+C+ G+ G  C+ +IN+C +NPCQHG  C D  N Y C C PGF+GK C+ NINECA NPC ++G+C+D    + C C  PYSG  C  +L+PC+P+ C N A C+P N Y  + C C T    + G  C +DVDEC                   +   PC N  QC+N NGSF C C   YEG++CE   ++C  NPC NG TC +   G+ CRCV GF G+ C+ +I+EC  NPC + + C D++N Y C C+ GFSG +CE+NDNDCT+SSCL  G+C+D VN F C+C   + G+ C+    PCD+NPC+N G+C N   N     Y CNC  GF G  CE   DWC+ NPC + G CE   ++F+C C S++ GE+C+I++   C S A  K  +   ++K+C++ G C N   T   +C CQ+GY GS+CE  I++CAS PC NG  C D    Y C+C  GFQG NC+ N ++C +  C N G C D +++F C CP G  G  CE   + C    C +GG C + IG +EC CP GFAG  CE D+NEC  N              PCS  GT +C+     + C CK  F+G+ CE RI   E        PC N G C N        +    C C  GY G+ C+  S  C  + C+N+G CRP +      + C CP G  G+ CEID ++ECLS+ C N+G+C +  G   C+C +   G  C+      + G      ++  S     +   CE   C +KA+N  CD ECN +AC +D  EC + +             PW  C  ++ + + C   F +  C+PQCN E CL+DG+DC   + +C P+  S+C K+Y +G C   C+T EC +DG DC +S      G +++++ V    F      + L+ L HLL +VVR++++ NG  MI+  +    +  SD  + ++              TKVYLE+DN  C K  +  CFDN+++AA+FV AAL        +P+  +++      K+P   +  +  + ++     + ++  V+   +        +K  +A  W+PEG   KR +++    N +       K  Q       L    +   + G + ++  K+K    D   DS   SL +  +        ++       + + + L+        PP+       D I+ ++I A     +  L+++   GN L      ES             +    +E N+ AD+ N N L   + I + T R   +GET LHLAA+Y R +AA+ LL+AG+D N L+  GR+ L TA+ A A  V    L  ++   +L+ K  +G+T LI A + A  ++++ L+        D+N  D  G+TALHW+A          LL    NRDAQDN++ TPL+LA +EG  E  K L+ + AN +++DHL+ LPR+VA   +   IV LL+ Y
Sbjct:   13 CETTPFICQNGGTCMNHNDGFMCICVNGWTGSDCSENIDDCKNNPCFNGGNCED-RVGYFYCKCPRGKTGMRCHLDDACES-NPCNAGASCETSPIDGSPICTCKRGWTGDTCSRDVDECTESADTPCEHGGTCINTPGSYKCDCAVGFTGPWCEVNINECSSNPCINDGTCLDEKGAYRCLCMPGFTGRNCEVEYDECGSNPCINGGVCQDLVNKFKCTCPAGFEGPTCAVNIDECETFPCLNGGTCND-QINTYTCTCKTGYSGVHCQENVDNCRKVDCGHG-TCVDGLDTYTCSCLPGYTGLLCQYDIDECSSNPCKFGGTCSNLDNSYECRCPYGTSGQNCEKNYNECVSNPCHNGATCIDGINRYNCKCKPGYEGTHCELDIDDCAS-QPCHNGGKCTDLINK---FKCECPAGYYDAECRSNVNECGSNPCMNYGTCVDGVNKFECLCLDGYGGHRCQNDINDCVSNPCQHGGTCNDHLNSYSCDCKPGFEGKNCDKNINECASNPC-VHGECVDLANEYHCNCNPPYSGKNCEQELNPCHPSPCQNHAQCVPTNNYKDFECRCPTG---FTGKLCNQDVDEC-------------------ASGSPCRNGAQCVNKNGSFKCICLRGYEGKRCEVNHDDCAPNPCINGGTCVDEIGGYSCRCVDGFGGQHCQNDIDECASNPCMHGSTCTDYVNSYTCTCRLGFSGVHCEVNDNDCTKSSCLNDGKCIDGVNNFTCQCKGGFTGSICQTRINPCDTNPCMNAGTCFNHNGN-----YYCNCPYGFQGTHCERVQDWCKNNPCQNSGTCEQFANNFRCTCTSDWTGEKCDIRRV-PCNSAAALKGVD---VSKLCRNGGICKNLGGT-THECICQAGYEGSYCEREINECASAPCKNGATCKDLVNHYTCQCMTGFQGQNCEYNIDDCANQPCANNGVCHDLVDDFKCSCPAGTLGLLCEINSNDCFDNACYHGGTCVDKIGHYECKCPPGFAGPRCEGDVNECSSN--------------PCSALGTQDCVQLDNDYRCQCKAGFSGRLCENRIQCSE-------APCKNGGTCTNT-------DSGPKCSCLKGYSGDYCEFQSADCDSSPCQNDGTCRPTQD----GYFCLCPAGASGINCEIDEMDECLSSPCKNDGTCHDKIGYYECYCPRYYTGIHCQNYDVNAVPGIG-RPVTMKPSLNLNPDKELCEQYGCEAKANNGKCDNECNMHACDYDNKECSYGM------------KPWKECSGMR-DGVFCWKVFKDGTCNPQCNNEECLYDGFDCQTKLKECNPIYDSYCKKYYGNGHCDQGCDTEECEWDGLDCDKSPERLAEGTLVIIVLVEPEAF-RNMSKEFLRKLGHLLRAVVRVLKDKNGSPMIYPWQQKEGDDVSDVIRVKRWAE-----------TKVYLEIDNRGCYKYSTDECFDNTDNAAQFVAAALQRNDADLGMPVGKIESL----GKEPTVDSPAITFVYIVVACGAILLITLVVIIVIS-------RKRERAVTWFPEGFFNKRGSEKAGVRNRRGPDGEEMKDVQKGSHHSQLDKMDDRHGDWGEDEEEHPKAKRQRIDEQGDSSDQSLVNFEIQDSRQWTQKHMEAANVTNPSILTLT--------PPQGD-----DPIDTKDINARGPGGMTPLMLASLRGNTLDTSCDDESG------------SAEGNEEDNRAADVIN-NLLFQGASINLQTDR---TGETSLHLAARYARADAAKVLLDAGADCNALDSTGRTPLHTAVAADAQGVFQILLRNRS--TNLNAKMYDGTTPLILAARLAIEDMVEDLINADA----DINAFDNNGKTALHWSAAVNNVEATESLLERNANRDAQDNKDETPLFLAAREGSFEAAKALLNHYANREITDHLECLPREVADERHHHDIVQLLDTY 1813          

HSP 2 Score: 499.59 bits (1285), Expect = 3.773e-141
Identity = 372/1026 (36.26%), Postives = 510/1026 (49.71%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCE-QKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFC-ESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC--EDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCE----------KXXXXXXXXXXXXGATCDNL-ADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGV--CETDLDSFKCKCNSEYIGERCE--IKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVN-TNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCE 3425
            +++N C ++ C N  TC  D  G Y C C  G+ G  CE +   C   PC NGG C+ +     C C   + G  C  +   C + PC NGG C   +I+ Y C C   Y G++C+       +  CG +G C+   D    C C  GYTG  C  DIDEC+S     C+ GGTC N   SY+C+C  G +G+ CE +  +C ++ C NG TC+D I  Y C C   Y GT+CE     C  +PC NGG C D    ++C C   +    C    N C  NPC N G C + VN   ++C+C  G+ G  C+  I++C    C +GG+C + +    C+C PGFEG NC+ N+NEC + PC  + +C+DL N+Y C+C    +GKNCE  ++ C P+PC N A+C   +    F C+C  GF G  C    D C   +PC+    C+N N +   +KCIC  G +   C+     C    CIN G CVD      C C+ GF G+ C+ +I+EC +NPC HGS C D  N Y C C  GF G  CE+N N+C  + C  +G+CID V  F CQC   ++G  C  +++PC+ N C N   C   N   +Y+CNC      ++G+ CE+  D C                    +  PC N   C     +F C C+S + G +C+                 +  CRNG  C NL      C C AG+ G  CE EINEC   PC N A C D +N Y C C +GF G+NCE N +DC    C  +G C D V+ F+C C    +G  CE     C  N C + G+C+++  +     Y C C  GF GPRCE  ++ C  NPC   G   C    + ++C+C + + G  CE  I+ +E                   CK+ G C N     G KCSC  GY G +CE    DC S PC N G C      YFC C  G  G+NC+++  +EC S+ C N G C D+I  + C CPR  +G  C+
Sbjct:  166 VNINECSSNPCINDGTCL-DEKGAYRCLCMPGFTGRNCEVEYDECGSNPCINGGVCQDLVNKFKCTCPAGFEGPTCAVNIDECETFPCLNGGTCND-QINTYTCTCKTGYSGVHCQENVDNCRKVDCG-HGTCVDGLD-TYTCSCLPGYTGLLCQYDIDECSSNP---CKFGGTCSNLDNSYECRCPYGTSGQNCEKNYNECVSNPCHNGATCIDGINRYNCKCKPGYEGTHCELDIDDCASQPCHNGGKCTDLINKFKCECPAGYYDAECRSNVNECGSNPCMNYGTCVDGVN--KFECLCLDGYGGHRCQNDINDCVSNPCQHGGTCNDHLNSYSCDCKPGFEGKNCDKNINECASNPCV-HGECVDLANEYHCNCNPPYSGKNCEQELNPCHPSPCQNHAQCVPTNNYKDFECRCPTGFTGKLCNQDVDECASGSPCRNGAQCVNKNGS---FKCICLRGYEGKRCEVNHDDCAPNPCINGGTCVDEIGGYSCRCVDGFGGQHCQNDIDECASNPCMHGSTCTDYVNSYTCTCRLGFSGVHCEVNDNDCTKSSCLNDGKCIDGVNNFTCQCKGGFTGSICQTRINPCDTNPCMNAGTCF--NHNGNYYCNCPYG---FQGTHCERVQDWC--------------------KNNPCQNSGTCEQFANNFRCTCTSDWTGEKCDIRRVPCNSAAALKGVDVSKLCRNGGICKNLGGTTHECICQAGYEGSYCEREINECASAPCKNGATCKDLVNHYTCQCMTGFQGQNCEYNIDDCANQPCANNGVCHDLVDDFKCSCPAGTLGLLCEINSNDCFDNACYHGGTCVDKIGH-----YECKCPPGFAGPRCEGDVNECSSNPCSALGTQDCVQLDNDYRCQCKAGFSGRLCENRIQCSEA-----------------PCKNGGTCTN--TDSGPKCSCLKGYSGDYCEFQSADCDSSPCQNDGTCRPTQDGYFCLCPAGASGINCEIDEMDECLSSPCKNDGTCHDKIGYYECYCPRYYTGIHCQ 1129          

HSP 3 Score: 440.269 bits (1131), Expect = 6.712e-122
Identity = 353/1084 (32.56%), Postives = 477/1084 (44.00%), Query Frame = 3
Query: 1557 LTGKNCEINIDEC--TP--------------------------------------NPCLNGARCEDRVGGFTCQCLQGFVGLRCETKS--------------------------------DICKQ---------LTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDEC------------NLD-----RTQLALYGLAVLSMSNSQIG-PCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVA--------------------------------------GFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWC-RGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGN-------ATNL----ISNPHG--------PCSPTGTLE-------------CLDRPGTFH-CSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYAC----GFDGGECLHRV 4271
            +TG  C+I++DEC  TP                                      NPC NG  CEDRVG F C+C +G  G+RC                                    D C +          TPC+    C+   NT   YKC C  G     C+  +++C +  CIN G C+D     +C+C+PGF GR CE+E +EC +NPC +G  CQDL N + C C  GF+G  C +NI+EC   PC   G C D++  + C C   YSG  C   +D C    C     C+ G   D+Y C+C   L  Y G  C+ D+DEC            NLD     R      G       N  +  PC N   CI+    + CKC   YEG  CE  +++C + PC NG  C +L + F+C C A                                      G+ G RC+ +IN+C  NPC +   C DH+N Y C C+ GF GKNC+ N N+C  + C+ HG+CVD  N + C CN  Y G NCE    PC  +PC N   C+      N   + C C  GFTG  C   +D C  G+PC +   C     SFKC C   Y G+RCE+               ++      C + G C +  E GG+ C C  G+GG  C+ +ID+CAS PC++G  C D    Y C C+ GF GV+C+VN N+C  +SC N GKCID +NNF+C C  G +G  C+T ++ C    C N G C N  G++ CNCP GF G  CE   + CK N   N       A N      S+  G        PC+    L+             C +  GT H C C+  + G YCE  I+ C       + PC N   C +          +++C C  G+ G+ C+ N   C    C NNG+C    +DD   FKC CP G  GL CEI+  N+C    CY+ G+CV+  G   C C  G  G +CE                   ++++C  N C++        L+ N Y C    GF G  C +R+
Sbjct:    1 MTGDLCQIDVDECETTPFICQNGGTCMNHNDGFMCICVNGWTGSDCSENIDDCKNNPCFNGGNCEDRVGYFYCKCPRGKTGMRCHLDDACESNPCNAGASCETSPIDGSPICTCKRGWTGDTCSRDVDECTESADTPCEHGGTCI---NTPGSYKCDCAVGFTGPWCEVNINECSSNPCINDGTCLDEKGAYRCLCMPGFTGRNCEVEYDECGSNPCINGGVCQDLVNKFKCTCPAGFEGPTCAVNIDECETFPCLNGGTCNDQINTYTCTCKTGYSGVHCQENVDNCRKVDC-GHGTCVDG--LDTYTCSC---LPGYTGLLCQYDIDECSSNPCKFGGTCSNLDNSYECRCPYGTSGQNCEKNYNECVSNPCHNGATCIDGINRYNCKCKPGYEGTHCELDIDDCASQPCHNGGKCTDLINKFKCECPAGYYDAECRSNVNECGSNPCMNYGTCVDGVNKFECLCLDGYGGHRCQNDINDCVSNPCQHGGTCNDHLNSYSCDCKPGFEGKNCDKNINECASNPCV-HGECVDLANEYHCNCNPPYSGKNCEQELNPCHPSPCQNHAQCV---PTNNYKDFECRCPTGFTGKLCNQDVDECASGSPCRNGAQCVNKNGSFKCICLRGYEGKRCEV--------------NHDDCAPNPCINGGTCVD--EIGGYSCRCVDGFGGQHCQNDIDECASNPCMHGSTCTDYVNSYTCTCRLGFSGVHCEVNDNDCTKSSCLNDGKCIDGVNNFTCQCKGGFTGSICQTRINPCDTNPCMNAGTCFNHNGNYYCNCPYGFQGTHCERVQDWCKNNPCQNSGTCEQFANNFRCTCTSDWTGEKCDIRRVPCNSAAALKGVDVSKLCRNGGICKNLGGTTHECICQAGYEGSYCEREINEC------ASAPCKNGATCKDLVN-------HYTCQCMTGFQGQNCEYNIDDCANQPCANNGVCHDL-VDD---FKCSCPAGTLGLLCEIN-SNDCFDNACYHGGTCVDKIGHYECKCPPGFAGPRCE------------------GDVNECSSNPCSALGTQDCVQLD-NDYRCQCKAGFSGRLCENRI 1018          

HSP 4 Score: 398.667 bits (1023), Expect = 1.317e-108
Identity = 318/947 (33.58%), Postives = 438/947 (46.25%), Query Frame = 3
Query:  420 AISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQK-SNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDG--EVKCHCNKGYTGNTCSNDIDECASY-----------------ETPL------------------CENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESV-NYQDYKCICQRGFEGKMCETSIDNCQKIS---------------------------------------CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCIN-GQCVDVNNEEKC-------------------------------------------------ICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPC--LNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDND-CTESSCLGHGQCVDKVNGFECKCNENYIGTNCEH--------LKRPCDSNPCLN 2834
            A++++ CE   C NG TC   IN  Y C C  GY G +C++   NC    C + GTC        C CL  + G  C++    C+S+PC+ GG C +L+ + YEC+CP    G NCE   +    NPC     CI   DG     C C  GY G  C  DID+CAS                  E P                   C N GTC++ V  ++C C  G+ G RC+NDI DC ++ C++GGTC D + SY C C   + G NC+     C   PC +G  C D   +Y C C   ++GKNC+   NPC  +PC+N+  C    NY+D++C C  GF GK+C   +D C   S                                       C NGG+C++ I G  C C+ GF G +C+ +++EC + PC + + C D  N YTC C  G +G +CE+N ++CT + CLN  +C D V  FTCQC  GF G  C+T+ + C    PC     C N N     Y C CP G Q  +C++    CKN  C N G C    N  +C                                                 IC  G+EG  CE EINEC + PC++G+ C+DL N Y C C+ GF+G+ CE NI++CA+ PC  NG C D V  F+C C     G  C    + C  NACY+   C+  +K   Y C C      + G +CE DV+EC+ +                    PC  L    C+  +  + C+C + + GR CE     C   PC+NG TC N   G +C C+ G++G+ CE +  +C  +PC ND  C    + Y C+C +G SG NCEI++ D C  S C   G C DK+  +EC C   Y G +C++        + RP    P LN
Sbjct:  241 AVNIDECETFPCLNGGTCNDQIN-TYTCTCKTGYSGVHCQENVDNCRKVDCGH-GTCVDGLDTYTCSCLPGYTGLLCQYDIDECSSNPCKFGGTCSNLD-NSYECRCPYGTSGQNCEKNYNECVSNPCHNGATCI---DGINRYNCKCKPGYEGTHCELDIDDCASQPCHNGGKCTDLINKFKCECPAGYYDAECRSNVNECGSNPCMNYGTCVDGVNKFECLCLDGYGGHRCQNDINDCVSNPCQHGGTCNDHLNSYSCDCKPGFEGKNCDKNINECASNPCVHGE-CVDLANEYHCNCNPPYSGKNCEQELNPCHPSPCQNHAQCVPTNNYKDFECRCPTGFTGKLCNQDVDECASGSPCRNGAQCVNKNGSFKCICLRGYEGKRCEVNHDDCAPNPCINGGTCVDEIGGYSCRCVDGFGGQHCQNDIDECASNPCMHGSTCTDYVNSYTCTCRLGFSGVHCEVNDNDCTKSSCLNDGKCIDGVNNFTCQCKGGFTGSICQTRINPC-DTNPCMNAGTCFNHNGN---YYCNCPYGFQGTHCERVQDWCKNNPCQNSGTCEQFANNFRCTCTSDWTGEKCDIRRVPCNSAAALKGVDVSKLCRNGGICKNLGGTTHECICQAGYEGSYCEREINECASAPCKNGATCKDLVNHYTCQCMTGFQGQNCEYNIDDCANQPCANNGVCHDLVDDFKCSCPAGTLGLLCEINSNDCFDNACYHGGTCV--DKIGHYECKCPPG---FAGPRCEGDVNECSSN--------------------PCSALGTQDCVQLDNDYRCQCKAGFSGRLCEN-RIQCSEAPCKNGGTCTNTDSGPKCSCLKGYSGDYCEFQSADCDSSPCQNDGTCRPTQDGYFCLCPAGASGINCEIDEMDECLSSPCKNDGTCHDKIGYYECYCPRYYTGIHCQNYDVNAVPGIGRPVTMKPSLN 1150          

HSP 5 Score: 83.9593 bits (206), Expect = 6.169e-12
Identity = 62/182 (34.07%), Postives = 92/182 (50.55%), Query Frame = 3
Query:  483 INGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEF-SSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELP--NSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSN-DIDECASYETPLCENGGTCINTVGSY--QCKCKAGFNGERCEND 1010
            ++  Y C+C  G+ G  CE +  C   PC+NGGTC        C CL  + G++CEF S++C SSPC+N G C+  +   Y C CP    G+NCE+   + C S +PC  +G C     G  +C+C + YTG  C N D++       P+       +N       Q  C+A  N  +C+N+
Sbjct:  997 LDNDYRCQCKAGFSGRLCENRIQCSEAPCKNGGTCTNTDSGPKCSCLKGYSGDYCEFQSADCDSSPCQNDGTCRPTQ-DGYFCLCPAGASGINCEIDEMDECLS-SPCKNDGTC-HDKIGYYECYCPRYYTGIHCQNYDVNAVPGIGRPVTMKPSLNLNPDKELCEQYGCEAKANNGKCDNE 1175          
BLAST of Neurogenic locus notch protein vs. TrEMBL
Match: A0A1S3K904 (neurogenic locus notch homolog protein 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106179862 PE=4 SV=1)

HSP 1 Score: 1059.28 bits (2738), Expect = 0.000e+0
Identity = 714/1997 (35.75%), Postives = 1007/1997 (50.43%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCK-LIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILAN-DGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCING-QCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEI-----TGSACNLASIDNSQTYQDEISDCELNK--CASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEG-MKRLNQQTSQFNHKRLVNSNRKRNQNLLNCH-----------NASSELGNIQQ--MTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLS----NGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDE--TNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDY 6302
            I+++ C NH+C++G  C   +N  Y C C    +G YCEQ  + C   PC +G TC     G+  C C+N W G  CE +  +CA+ PC +GG C   ++  + C+CP    G++C L +SC S NPC     C  +  DG   C C +G+TG  C  DI+EC      LCE+GG+C+NT GSY C C+ G++G RCE++I +C ++ C+N GTCLD++G +RC+C   Y GT CE     C+  PC+N GIC D    Y C C   ++G  C  +      +     G C  +    Y C C RGF G+ CE++ID+C  I+C N G C++      C C PG+ G  CE  + EC + PC NN  C DL   Y+C CP G  G NCE+NI+EC  NPC  G+ C D++ G+ CQC  GF G  CE   D C    PC     C ++ N    Y C CP G    NC   +++C +  C+NG +C+D  +   C C  G+EG  C+ E NEC +NPCQH   C D    Y C C PG+ G  CE NI++CA NPC  +G CID+V  +RC C LP++G  C  +++PC PN C N A C     Y  + C C   LG Y G  CE+D+DEC L                   + PC N   C NTNGS+ C C++ +EGR C    ++C ++PC+NG TC +   G+ C CV+GF G  C+ ++NEC  NPC N A C D++N Y C CQ GFSG +C+INDNDCT SSCL  G C+D VN F C C   Y G+NC+H    C+S PCLN G+C     +     Y C+C  G+TGP+CE  +DWC   PC +   CE   + ++C C + + G  C++       S AV        ++ +C H G C +   +    C C  GY GS+CE  I++C S PC NGG C DG G Y C+C  G+ G  CQ + NEC    C N G C D  + F C C  G  G+ CE  V  C    C N G C + +G FEC CP GF G  CE D+NEC  +              PC   G+ +C+     + C C   +TG++CET  D+C         PC NN  C               CIC  GY G  C+ +  +C  + C+N G C P    +  S+ CECPP   G  CE+D  NEC S  C NNGSC++  G   C C     G  C++      G        D +     +I   E  K  C +KA N  CD ECNKYACG+DG +C                SPW NC ++K +   C+  FNN  CD QCNT  CLFDG+DC   +G+C P+   +C  HYA+G C   CNT EC++DG DC+         G+++L+     +         L++L  LL +VV++ +++NG  MI+    +   +N    K   K  L    +     TKVYL VD   C  + + C   +++ A+F+ AA+   +++P + I  V +        P  P      + V   ++    ++ V        + T  +K+ +   W+PEG     + + S+   K     + +  +N    H           N S +  +  +  M + K+     +D  G   +        +       + + A   N  +L+     GD H +         ++D+  P  +       +    + GNGL      E  D+          A   +DE   N  +DL     L   + I + T R   +GET LHLAA+  R +AA+ LL+AG+DPN  +  GR+ L TA+ A A  V    L  +    +L+ +  +G+T LI AV+ A   +++ L+        D+N TDEYG+TALHWAA         +L+  G NRDAQDN+E TPL+LA KEG +E  +IL+ N AN D++DH+DRLPR++A+      IV LL+ Y
Sbjct:  266 INIDDCGNHRCQHGGICIDGVN-DYTCNCPSHRQGRYCEQYLDPCNSHPCLHGSTCTNETDGSFRCLCVNGWEGPLCEVNKDDCANHPCFHGGTCHD-KVGYFWCECPVGMTGLHCHLNDSCLS-NPCSAGSNCDTSPIDGGHICSCERGFTGTNCEVDINECNEGAMDLCEHGGSCVNTPGSYYCDCRIGYSGPRCEDNINECASNPCQNDGTCLDEVGHFRCLCMPGYTGTLCEADIDECQSSPCQNHGICVDSIGQYSCQCQAGFSGPRCQ-INIDDCDSNPCRFGTCVDM-INGYLCDCTRGFTGRNCESNIDDCVGINC-NHGVCVDGYASFNCRCHPGYTGRYCESEIKECNSAPCMNNGTCTDLIPGYSCRCPLGTQGNNCEVNINECASNPCQYGS-CVDQLNGYRCQCNPGFTGTHCEINIDECAS-NPCHNNGRCTDLINE---YTCECPPGYYDLNCLSNVNECDSNPCLNGGRCIDGVDRFNCSCPRGYEGFRCQQETNECLSNPCQHSGSCIDRLGYYQCSCQPGYTGVNCESNIDDCASNPC-RHGDCIDQVNAYRCVCNLPFTGRNCDVEMNPCQPNQCQNGAPCQVSADYQDFACQC-LGLG-YTGRFCEQDIDECAL-------------------VAPCANGATCKNTNGSYACICTTGFEGRHCAVNRDDCAHDPCQNGGTCRDEIGGYTCMCVSGFGGHHCQEDVNECLSNPCQNGATCTDYVNSYTCRCQPGFSGVHCQINDNDCTSSSCLYGGTCIDLVNSFRCHCAPGYTGSNCQHKINACESQPCLNSGTC-----SLVAGSYKCHCPYGYTGPQCESFVDWCSLGPCQNGATCEQIGNRYQCLCKAWWTGRYCDVGLV----SCAVAANTKGVSLSNLCAHGGTCRDVGNS--HVCDCHPGYTGSYCETEINECESVPCQNGGTCIDGIGTYRCQCAAGYNGSQCQTDINECLPKPCYNGGTCHDLPHGFHCACRPGTLGKLCEINVVDCYSGACHNNGTCIDRVGGFECRCPPGFVGDRCEGDVNECLSD--------------PCLSPGSQDCIQLVNDYRCDCNPGWTGRHCETLQDFCSSN------PCQNNAACAGSV-----------CICQQGYSGTYCEFHHVQCASSPCQNGGRCIP----NAQSYTCECPPNFVGGGCEVDIRNECDSNPCRNNGSCLDKDGFYQCDCPPSYRGTNCQVFDPNAPGGIGEPVGPDFTTLSPLDILRLECKKLDCDNKAGNGKCDEECNKYACGYDGKDCFG-------------VSPWQNCTVVKDDTF-CYQLFNNSICDEQCNTPECLFDGFDCEPRLGECNPIFDPYCRNHYANGHCDRGCNTEECNWDGDDCLGDVPLQTADGVLVLIVRVPPDVFRNKSVDFLRNLGRLLRAVVKVKKDANGADMIYP---WHPETNEVRVKRFVKDILRRFRRNDDEWTKVYLVVDLTKCIELQQECLGTADTVAQFIAAAIKNNNWKPSLDISKVSSEDGTTDVTPSTP------INVAYIVIGAVSILVVALLLGVLITTTRKRKIARGVTWFPEGFFATASHKNSRKGSKTRKGPDGQEMKNFNGGHCDGQVPLDVTDNGSPDAWSDDEPPMKQKKM----KMDQQGDAQVHGEDFDEMDTRQWTQQHLDAANVHNPSILALTPPQGDEHYD-------TKNVDIKGPDGLTP-----LMVAAIRGNGL------EFDDESSGSGSGSGSAEGGEDEGVGNVISDL-----LMQGAAINMQTDR---TGETALHLAARNARADAAKRLLDAGADPNTQDNTGRTPLHTAVAADASGVFQILLRNR--ATNLNARMHDGTTPLILAVRLAVEGMVEELMNAEA----DVNSTDEYGKTALHWAAAVNNVDATMVLMQNGANRDAQDNKEQTPLFLAAKEGSLEAARILLDNFANRDITDHMDRLPREIAEERMHHDIVQLLDSY 2124          
BLAST of Neurogenic locus notch protein vs. TrEMBL
Match: A0A087URB0 (Neurogenic locus Notch protein (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_02530 PE=4 SV=1)

HSP 1 Score: 1049.27 bits (2712), Expect = 0.000e+0
Identity = 696/1983 (35.10%), Postives = 1022/1983 (51.54%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILAN-DGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCING-QCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEI-----TGSACNLASIDN--SQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC--PLQSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNC-KTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIA---NLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYV 6305
            ++++ C  H C+NGA C   IN  Y C+C   Y G+YC +  + C + P  C+NG TC    G+  C C+N W G  C E   +CA + C NG  C    +  + CQC     G+ C L ++C S NPC V   C  +  DG   C C +G+ G  C+ D+DEC   E   CE+GG C+NT GS+ C C  GF G RCE +I +C ++ CKN GTCLD+ G +RCVC   Y G NCE     C   PC N GIC D    ++C+C   ++GK C+  ++ C  +PC+N G C       + C C  GF G  CE +I++CQ + C +G  CI+      C C PG++G+ C+  +NEC + PCQ+   C DL N Y C C  G +G NCE NI+EC+ NPC NGA C D +  +TCQC+ GF GL CET  + C    PC    IC ++ N   G+KC CP G     C  ++++C +  CING  C D  N+  C CI G+ G  CE+EI+EC +NPCQHG  CQD    Y C CLPG+ G+ CE NI++C  +PC   G CID V  ++C C +P++G  C  +LDPC+PN C N A C P + Y  + C+C      Y G  C++D+DEC +                     PC N   C+NTNGS+ C C+  YEGR C    ++C + PC+NG TC +    + C CV GF G+ CE +INEC  +PC N A C D++N Y C C  GFSG NC+ ND DCT SSC+  G C+D +N + C+C   Y G+NC+     CDS PC + G+CI+     +   Y C+C  G+TG  C+  +DWC  NPC +   C    +++ C C   + G+ C++    +C   A +K      +  +CK+ G C N   +   +C C +GY GS+C+  I++C+SQPC NG  C D  G Y C C PGFQG+NC+ N N+C  N C + G C D IN F C CP G  G  CE  V+ C +  C + G C + IG +EC C  G+ G  CE D+NEC  +              PC   GT +C+     + C CK  + G++CE +++ C         PC N GIC ++       N +  CICP G+ GE C + +  C    C+N G C+P        + C CP GVGGL CE D V+ECLS+ C + G C++  GK  C C     G +C+I      G   N+   ++   Q+ ++E   C  N C  KA N +C+ ECN +AC FDGG+C   +            +PW NC+      I C + F NK CD +CN   CL+DG+DC   +  C     ++C ++Y +G C   CN  EC++DG DC  +      G  IL+L +    F+       L+ + H L + +R+  + N + M++  +    +   DS+ ++  RS          GT+V+LE+DN  C K +   CFD++N AA+F+ A     +     PI  +Q   +  +   E      + L++   +V++G +   +    Q       +K  +   W+PEG  R N    + + +R  +    RN +     N    + N          + D +D      + + R  +             +  +   +++  D   N  P    + H+D  + RN +           ++  +G  +    P       +   +     + ++ E +  +    ++ L   + I + T R   +GET LHLAA+Y R +AA+ LL+AG+D N  +  GR+ L  A+ A A  V    L  +    +L+ +  +G+T L+ A + A   ++++L+        D+N  D++G+TALHWAA       V +LL++G NRDAQD +E TPL+LA +EG     KIL+ + AN D++DH+DRLPRDVA       IV LL++Y+
Sbjct:  262 VNIDDCPGHNCQNGALCIDGIN-SYTCQCPPTYTGSYCSKDVDECAVRPSVCKNGATCINTIGSYSCICVNGWSGPDCSENIDDCAGAACFNGATCHD-RVGSFYCQCAPGKTGLLCHLEDACAS-NPCHVGAICDTSPIDGTYICSCPQGFKGVDCTQDVDECD--EGSPCEHGGICVNTPGSFHCNCTKGFTGPRCEININECDSNPCKNEGTCLDERGGFRCVCMPGYSGANCEEDIDECSPNPCLNNGICSDRINAFKCLCPIGFSGKKCEVNEDDCMSHPCQNGGNCTD-GIASFTCHCNPGFTGTNCEININDCQSLPCHHG-QCIDGTNTFTCVCDPGYKGSLCQYQINECLSNPCQHGGSCEDLVNGYQCRCRAGTSGPNCEYNINECSSNPCRNGAVCVDGINAYTCQCVPGFTGLHCETNINECAS-NPCANGGICTDMVN---GFKCECPRGYFDARCLSDVNECASNPCINGGTCEDEVNKFICHCIDGYGGHRCEVEIDECQSNPCQHGGSCQDRLASYECSCLPGYSGQNCETNIDDCDSSPCLNGGSCIDLVDAYQCVCEVPFTGLRCDTELDPCSPNKCKNHAKCTPSSNYLDFACSCQLG---YTGHLCDEDIDECAISS-------------------PCRNGATCVNTNGSYTCVCTKGYEGRDCLINTDDCASFPCQNGGTCLDGIGEYTCLCVDGFGGKHCEADINECASSPCLNGATCNDYVNSYTCTCPLGFSGTNCQTNDEDCTSSSCMNGGTCIDGINNYICQCTPGYTGSNCQFHINECDSQPCQSGGTCID-----HVGYYTCHCPFGYTGLHCDTFVDWCSTNPCMNGATCMQLNNTYGCTCQPGWTGKLCDVSMV-SCSDAAAQKGIE---VKDLCKNGGTCENIGNS--HRCICGNGYDGSYCQHEINECSSQPCQNGATCNDQIGQYSCDCPPGFQGLNCEFNINDCDPNPCRHGGTCHDLINKFVCSCPHGTIGILCEINVNECFEGACHHDGSCIDKIGGYECQCQPGYVGSRCEGDVNECLSD--------------PCKRPGTQDCVQLVNDYRCDCKPGYMGRHCEIKVNIC------ATNPCMNGGICSHR------PNGSAMCICPEGFWGETCAMTNTTCASYPCRNGGQCKP----KHHGYYCICPEGVGGLHCEKDLVDECLSSPCLHGGDCIDRIGKFECDCPPEWNGLRCDIYDSSFGGGIGNVIPPEDPPKQSLEEEKKICIANSCELKARNNVCNEECNSFACNFDGGDCSLGI------------NPWKNCKA----GIKCSSVFKNKICDIECNNMDCLYDGFDCDQMLMPCNEHYDTYCLRNYGNGLCDNGCNNEECNWDGLDCEPNPPVLAAGSFILILSMEPEVFLNN-SVSFLREMGHALRTNLRLKMDENNRPMVYPWK----SPEKDSAITKHYRST---------GTEVHLEIDNRRCSKLLYGECFDSANKAAQFLAAIHSRHALSTAFPISQIQESDYDEKGTAEATYTRNFYLIIGAIVVLIGGIAFGVLINAQ-------RKRARGITWFPEGFLRNNSGQHRRSRRRGPDGQEMRNLHKQCSINHMEVMDNGSMPHDGSQWSDDDMDHPPMKRMKNDRSPN------------PSYGDTHTVMTTDDYDDN-DPRPWTQQHLDAADIRNPDILALTPPQGDNDMDPNGVDVDVRGPGGLTPLMLASFRSGGFDIGDEVEDDDGSVSMIQDLLMQGAQINMTTER---TGETSLHLAARYARADAAKRLLDAGADANAQDNTGRTPLHAAVAADAQGVFQILLRNR--ATNLNARMHDGTTPLVLAARLAIEGMVEILINAEA----DINAADDHGKTALHWAAAVNNVEAVQVLLAHGANRDAQDVKEETPLFLAAREGSYAAAKILLEHFANRDITDHMDRLPRDVAYERMHHDIVRLLDEYI 2111          

HSP 2 Score: 645.195 bits (1663), Expect = 0.000e+0
Identity = 494/1489 (33.18%), Postives = 704/1489 (47.28%), Query Frame = 3
Query:  387 AAILILLFCPIAIS-LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITP---CQNGGTCKL-IAGNN----VCQCLNEWVGEFCEFS--SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTC--LDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKC--IDLNNDYTCDCPEGLTGKNCEINIDECTP-NPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCI-NGQCVDVNNEEKCICI--------------------------------------PGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCR-GNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIP----CFNNG-----------ICLNKY-----QNEV----------GRNYN-----FSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKAD--NKICDLECNKYACG--FDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNW--FNNKRCDPQCNTEACLFDGWDCMDAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCIE 4550
            A ++++ F P+ ++ L  C  + CKNGA+C S+  G+  C C   Y G YC+  + C   P   CQNGGTC + ++  N     C C   +    CE +  ++C S+PC+NGG C  + ++ Y C C   + G +CE  + C  + PC  NG    +     KC C +G+TG+TC+NDIDEC+  + P     G C NTVGSY+C C++G+ G+ CE+  + C    C+NGGTC  L+ + SY+C CP  + GTNCE     C    C+NG +C D    Y C C   +TG  C  DV           NG         Y CIC  G+ G  C  +ID+C   +CFNG +C + +    C C PG +        + C + PC   A C    ++  Y C CP+G  G +C  ++DEC   +PC +G  C +  G F C C +GF G RCE   + C    PCK E  CL   + R G++C+C  G    NC++++ +C    C+ NG C D  N  KC+C                                       PGF G  CEI IN+C + PC HG QC D  N + C+C PG+KG  C+  INEC  NPC   G C D V G++C+C    SGP C   ++ C+ N C N A+C+ G   ++Y C C      + G  CE +++EC  +                    PC N   C +    F C+C   Y   +C   +N C +NPC NG TC++  + F C C+ G+ G RCE+EI+ECQ NPC +   C D +  Y+C C  G+SG+NCE N +DC  S CL  G C+D V+ ++C C   + G  C+    PC  N C N   C     + N   + C+C+ G+TG  C+  +D C   +PC +   C     S+ C C   Y G  C I  T+ C S+              C++ G C +    G + C C  G+GG  CE +I++CAS PC+NG  C D    Y C C  GF G NCQ N  +C S+SC N G CID INN+ C C  G +G  C+  ++ C    CQ+GG C + +G + C+CP G+ G  C+T ++ C  N              PC    T  C+    T+ C+C+  +TGK C+  +  C        I     C N G           IC N Y     Q+E+          G   N     +SC CP G+ G  C+ N   C  N C++ G C     D    F C CP G  G+ CEI+ VNEC    C+++GSC++  G   C C  G  G +CE   + C L+        QD +      +C  K     + C+++ N  A     +GG C HR     +G+ + I       E     N  C ++   N  +C P+ +   C+     C + +G       C+K   D     EC +  C   GGDCI+
Sbjct:   12 AMVVLVTFSPVYVTGLVSCSPNPCKNGASCVSNPRGESYCNCPPLYVGQYCQHMNPCHTGPGPRCQNGGTCNVGLSAKNGPTFSCSCPVGYSASLCEIAVPNSCDSNPCQNGGTCNLVTLNNYTCSCTVGFRGHHCEEVDHCAPR-PC-RNGATCQSRLDSYKCTCTEGFTGHTCTNDIDECS--KEPCIH--GRCTNTVGSYRCTCESGYTGQNCESQYIPCEPSPCENGGTCTALNSL-SYKCSCPEGFTGTNCEVNIDDCPGHNCQNGALCIDGINSYTCQCPPTYTGSYCSKDVDECAVRPSVCKNGATCINTIGSYSCICVNGWSGPDCSENIDDCAGAACFNGATCHDRVGSFYCQCAPG-KTGLLCHLEDACASNPCHVGAICDTSPIDGTYICSCPQGFKGVDCTQDVDECDEGSPCEHGGICVNTPGSFHCNCTKGFTGPRCEININECDS-NPCKNEGTCL---DERGGFRCVCMPGYSGANCEEDIDECSPNPCLNNGICSDRINAFKCLCPIGFSGKKCEVNEDDCMSHPCQNGGNCTDGIASFTCHCNPGFTGTNCEININDCQSLPCHHG-QCIDGTNTFTCVCDPGYKGSLCQYQINECLSNPCQHGGSCEDLVNGYQCRCRAGTSGPNCEYNINECSSNPCRNGAVCVDG--INAYTCQCVPG---FTGLHCETNINECASN--------------------PCANGGICTDMVNGFKCECPRGYFDARCLSDVNECASNPCINGGTCEDEVNKFICHCIDGYGGHRCEVEIDECQSNPCQHGGSCQDRLASYECSCLPGYSGQNCETNIDDCDSSPCLNGGSCIDLVDAYQCVCEVPFTGLRCDTELDPCSPNKCKNHAKCT---PSSNYLDFACSCQLGYTGHLCDEDIDECAISSPCRNGATCVNTNGSYTCVCTKGYEGRDCLI-NTDDCASFP-------------CQNGGTCLDG--IGEYTCLCVDGFGGKHCEADINECASSPCLNGATCNDYVNSYTCTCPLGFSGTNCQTNDEDCTSSSCMNGGTCIDGINNYICQCTPGYTGSNCQFHINECDSQPCQSGGTCIDHVGYYTCHCPFGYTGLHCDTFVDWCSTN--------------PCMNGAT--CMQLNNTYGCTCQPGWTGKLCDVSMVSCSDAAAQKGIEVKDLCKNGGTCENIGNSHRCICGNGYDGSYCQHEINECSSQPCQNGATCNDQIGQYSCDCPPGFQGLNCEFNINDCDPNPCRHGGTCH----DLINKFVCSCPHGTIGILCEIN-VNECFEGACHHDGSCIDKIGGYECQCQPGYVGSRCEGDVNEC-LSDPCKRPGTQDCVQLVNDYRCDCKPGYMGRHCEIKVNICATNPCMNGGICSHRP----NGSAMCICPEGFWGETCAMTNTTCASYPCRNGGQCKPKHHGYYCI-----CPEGVGGL----HCEKDLVD-----ECLSSPC-LHGGDCID 1402          

HSP 3 Score: 371.318 bits (952), Expect = 2.745e-99
Identity = 327/1064 (30.73%), Postives = 446/1064 (41.92%), Query Frame = 3
Query: 1593 CTPNPCLNGARCEDRVGGFT-CQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEI-NECFNNPCQHGSQCQDL-FNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNG-SFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNP--CSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQ-----------------------------------NTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLAS-------IDNSQTYQ-------------DEISDCELNKCASKADNKICDLECN--KYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIP----CHNWFNNKRCDPQCNTEACLF----DGWDCMDAIGQCPLQSFCDKHYADGQCQLECNTMECS--FDGGDCIESRNS 4562
            C+PNPC NGA C     G + C C   +VG         C+ + PC          +T  G +C      QN            C  G          C C  G+    CEI + N C +NPCQ+G  C  +  N+Y C C  GF+G  CE  ++ CA  PC     C   +  ++C C   ++G TC N +D C+   C +       N   SY C C +    Y G  CE     C                    +  PC N   C   N  S+ C C   + G  CE  +++C  + C+NGA C +  + + C+C   +TG  C  +++EC   P  C N A CI+ I  Y CIC +G+SG +C  N +DC  ++C     C D+V  F C+C     G  C HL+  C SNPC     C    ++                                    NTPG + CNC +GFTGPRCEI ++ C  NPC + G C  +   F+C C   Y G  CE +  + C         N  L N IC    N         FKC C  G+ G  CEVN DDC S PC NGG C DG   + C C PGF G NC++N N+C S  C+ G+CID  N F+CVC  G  G  C+  ++ C    CQ+GG C++++  ++C C  G +G  CE +INEC  N   N                   C+D    + C C   FTG +CET I+ C       + PC N GIC +           F C CP GY   RC  +  +C  N C N G C     D+   F C C  G GG  CE++ ++EC S  C + GSC +      C C  G  G+ CE     C+ +        ID    YQ              E+  C  NKC + A    C    N   +AC    G   H   + ID  + +I+SP  N     + N      C   +  + C    NT+ C      +G  C+D IG+      C   +    C+ + N    S   +G  C +  NS
Sbjct:   30 CSPNPCKNGASCVSNPRGESYCNCPPLYVG-------QYCQHMNPC----------HTGPGPRC------QN---------GGTCNVGLSAKNGPTFSCSCPVGYSASLCEIAVPNSCDSNPCQNGGTCNLVTLNNYTCSCTVGFRGHHCE-EVDHCAPRPCRNGATCQSRLDSYKCTCTEGFTGHTCTNDIDECSKEPCIHGRC---TNTVGSYRCTCESG---YTGQNCESQYIPC--------------------EPSPCENGGTCTALNSLSYKCSCPEGFTGTNCEVNIDDCPGHNCQNGALCIDGINSYTCQCPPTYTGSYCSKDVDECAVRPSVCKNGATCINTIGSYSCICVNGWSGPDCSENIDDCAGAACFNGATCHDRVGSFYCQCAPGKTGLLC-HLEDACASNPCHVGAICDTSPIDGTYICSCPQGFKGVDCTQDVDECDEGSPCEHGGICVNTPGSFHCNCTKGFTGPRCEININECDSNPCKNEGTCLDERGGFRCVCMPGYSGANCE-EDIDECS-------PNPCLNNGICSDRIN--------AFKCLCPIGFSGKKCEVNEDDCMSHPCQNGGNCTDGIASFTCHCNPGFTGTNCEININDCQSLPCHHGQCIDGTNTFTCVCDPGYKGSLCQYQINECLSNPCQHGGSCEDLVNGYQCRCRAGTSGPNCEYNINECSSNPCRNGA----------------VCVDGINAYTCQCVPGFTGLHCETNINEC------ASNPCANGGICTDMVN-------GFKCECPRGYFDARCLSDVNECASNPCINGGTCE----DEVNKFICHCIDGYGGHRCEVE-IDECQSNPCQHGGSCQDRLASYECSCLPGYSGQNCETNIDDCDSSPCLNGGSCIDLVDAYQCVCEVPFTGLRCDTELDPCSPNKCKNHAK---CTPSSNYLDFACSCQLGYTGHLCDEDID--ECAISSPCRNGATCVNTNGSYTCVCTKGYEGRDC--LINTDDCASFPCQNGGTCLDGIGE--YTCLCVDGFGGKHCEADINECASSPCLNGATCNDYVNS 974          

HSP 4 Score: 309.301 bits (791), Expect = 2.581e-80
Identity = 227/676 (33.58%), Postives = 319/676 (47.19%), Query Frame = 3
Query: 2106 FRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXX-XXXXXXXGATCDNLA-DGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQI---NNFSCVCPRGVSGRFCETIVDYCKK-MECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSAC 4115
            F    +L    P     L  C+PN C N A C+   + +SY CNC      Y G  C+  ++ C+         G       +++ GP            +F C C   Y    CE  + N   +NPC+NG TC+ +  + + C C  GF G  CE E++ C   PC N A C   ++ Y+C C  GF+G  C  + ++C++  C+ HG+C + V  + C C   Y G NCE    PC+ +PC N G+C       N+  Y C+C  GFTG  CE+ +D C G+ C +  +C   ++S+ C+C   Y G  C  K  + C           ++   +CK+   C N    G + C C +G+ G  C  NIDDCA   C NG  C D  G ++C+C PG  G+ C +  + C SN C+ G   D       + C CP+G  G  C   VD C +   C++GGIC N  G F CNC KGF G  CE +INEC  N              PC   GT  CLD  G F C C   ++G  CE  ID C         PC NNGIC ++          F C+CP G+ G++C++N   C  + C+N G C     D   SF C C PG  G  CEI+ +N+C S  C+ +G C++G     C C+ G  G  C+   + C
Sbjct:   10 FLAMVVLVTFSPVYVTGLVSCSPNPCKNGASCVSNPRGESY-CNCPPL---YVGQYCQH-MNPCHTGPGPRCQNGGTCNVGLSAKNGP------------TFSCSCPVGYSASLCEIAVPNSCDSNPCQNGGTCNLVTLNNYTCSCTVGFRGHHCE-EVDHCAPRPCRNGATCQSRLDSYKCTCTEGFTGHTCTNDIDECSKEPCI-HGRCTNTVGSYRCTCESGYTGQNCESQYIPCEPSPCENGGTC----TALNSLSYKCSCPEGFTGTNCEVNIDDCPGHNCQNGALCIDGINSYTCQCPPTYTGSYCS-KDVDEC-----------AVRPSVCKNGATCIN--TIGSYSCICVNGWSGPDCSENIDDCAGAACFNGATCHDRVGSFYCQCAPGKTGLLCHLE-DACASNPCHVGAICDTSPIDGTYICSCPQGFKGVDCTQDVDECDEGSPCEHGGICVNTPGSFHCNCTKGFTGPRCEININECDSN--------------PCKNEGT--CLDERGGFRCVCMPGYSGANCEEDIDECSPN------PCLNNGICSDRIN-------AFKCLCPIGFSGKKCEVNEDDCMSHPCQNGGNC----TDGIASFTCHCNPGFTGTNCEIN-INDCQSLPCH-HGQCIDGTNTFTCVCDPGYKGSLCQYQINEC 612          
BLAST of Neurogenic locus notch protein vs. TrEMBL
Match: Q2WBY6 (Notch protein (Fragment) OS=Platynereis dumerilii OX=6359 GN=notch PE=2 SV=1)

HSP 1 Score: 1045.42 bits (2702), Expect = 0.000e+0
Identity = 715/1998 (35.79%), Postives = 1032/1998 (51.65%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN---CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILAN-DGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCING-QCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEI-----TGS--------ACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQII--VEKLLQIAVTNQDETNKFADLF------NKNELSNNSLITILT------SRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDY 6302
            I+++ C+N+ CK+GATC   I   Y C C   +KG YC++  +     + PC+NG TC+   G   C C+N W G+ C E   +CA  PC NG  C   ++  Y C CP    G+ C L ++C S NPC     C  +  DG+  C C  G+ G+ C+ D +EC       CE+GGTC+NT GSY+C C  GF+G RCE +I +C ++ C N GTCLD+ G ++C+C   Y G  CE     C  +PC NGG+C D    + C C   +TG  C    N C+  PC N G C+      Y+CICQ+G+ GK CE  ID+CQ ++C NGG CI++ +  +C C  G+ G  C+  ++EC +KPCQ+   C +L N Y C  P+G  G NCE NI+EC  NPC NGA CED +  + C C  GF G  CE   + C+   PC+    CL+  N+   + C CP G  +  C   +++C++  C++G +C+D  N   C C  G+EG  C+ E N C NNPCQHGS C+    +Y C C  G+ G+ CE NI+ C  NPC ++G C+D + G+ C C + YSG  C+ +++PC PN C N A CIP N Y+ + C C      + G  C +D+DEC               + SN    PC N   C NT+GS++C C+  + GR C+  +++C  +PC+NGATC +    + C CV GF G  C+ +I+EC  +PC N A C D++N Y C CQ GFSG NC+IND+DCT SSCL  G C+D+V  + C C+  Y G NC+H   PCDS PCLN GSC N+  +     + C CR GFTGPRC+  ++WC  NPC + G C    + F+C+C   + G  C++     C+  A+ K  +   + ++C+H G C +D E   F C C  G+ GS+CEV ID+C S PC NG  C +  G Y C C  GFQG +C+ + +EC ++ C  G  C D +N+F C CP G  G  CE  V+ C +  C N G+CK+ IG F C CP GF G  CE DINEC  +              PCS  GT  C+     + C C   + G++C  ++D+C       + PC N G C       +       C C +GY G++C+  +  C+   C+NNG+C P   D    + CECPPGV G  C+ D  +EC+S  C + G C N  G   C C +   G  C++     TG             ASID  Q        C  N CA K+ N  CD ECN YAC FD  EC   V             PW NC  I+ + I C++ F N RCD  CN++ CL+DG+DC D + +C P+   +C+ HY +G C   C+   C +DG DC E       G ++ +L +   EF ++ R   L+ +  LLH+V++I +N  G  MI+    + ++S   +S+ R KR+ S+       GT+V+ ++DN  C    + CFD++ +AAE++ A            + S+ +   P   KP   N +  +L     ++++ +L+GVL   ++       +K      W+PEG +             L NS  K+ ++         + G I Q     + TT S D+  S                               +   D   + P  KR K   D  + +    W    +A   V    +   +P +  D+     V+       T     + +   +      N N++S + + T+L+      +R   SGET LHLAA+Y R +AA+ LL+ GSDPN  + +GR+ L  A+ A A  V    L  +    +L+ +  +G+T L  A + A    +  L+        D+N  DEYG+TALHWAA         +LL +G NRDAQD+++ TPL+LA KEG  EV K+L+ + AN D++D +DRLPRDVA       IV LL++Y
Sbjct:  198 INIDDCKNNLCKHGATCVDGIE-SYSCSCPPTFKGQYCDEDVDECSMGVNPCKNGATCQNQIGGYQCICVNGWTGKDCSENVDDCAIRPCYNGARCID-KVGYYYCDCPPGKTGLRCHLDDACVS-NPCKSGANCETSPIDGKFLCSCQPGWNGDDCNLDNNECQESWRSPCEHGGTCVNTPGSYRCDCPIGFDGPRCEVNINECLSNPCFNDGTCLDESGRFQCICMPGYQGKRCEEDVDECRDQPCLNGGVCEDKIAKFTCSCPKGFTGPTCAINVNECQSRPCINGGTCQD-EIDGYQCICQKGYYGKNCEQDIDDCQGVNCNNGG-CIDLQDSFQCRCWEGYTGKYCDSEIDECSSKPCQHGGTCTNLVNGYECQSPKGAYGPNCEHNINECASNPCRNGASCEDGLNQYVCNCRPGFTGTLCEIDINECES-NPCQNGGTCLDQINS---FLCRCPRGYYDYMCASNINECESSPCMHGGRCIDGINRFDCECPIGYEGYRCQSEENLCDNNPCQHGSTCEPGLAEYRCACKNGYTGRDCETNIDNCNPNPC-VHGNCLDHISGYECICDVAYSGVNCSKEMNPCEPNRCQNGAHCIPENNYEDFMCQCPIG---FTGRLCAQDIDEC---------------AASN----PCYNGATCENTDGSYVCWCAKGFTGRHCQTNVDDCNPDPCQNGATCHDGDADYTCHCVVGFGGRNCQQDIDECASDPCQNGASCHDYVNSYTCTCQLGFSGVNCDINDSDCTSSSCLNGGSCIDEVISYRCACSAGYTGANCQHRINPCDSRPCLNDGSCNNQDGS-----FECTCRFGFTGPRCDHFVNWCTQNPCRNGGRCFQRANQFECECPPNWTGPLCDVGMV-NCQVAAMSKSVS---LQELCQHGGTC-HDSENSHF-CRCHRGFDGSYCEVEIDECQSAPCKNGATCDNHQGYYTCLCPDGFQGPDCEYDIDECATSPCGYGGVCHDLVNSFVCSCPPGTMGSLCEINVNECFEGACHNNGLCKDGIGTFTCECPSGFIGPRCEGDINECLSD--------------PCSTPGTHSCVQLINDYRCDCYPGWGGRHCNEKVDFCN------SQPCKNGGTCSPGPSGPL-------CACRDGYTGDKCQYTNTVCKSAPCQNNGVCVPHGDD----YTCECPPGVAGRNCQHDVQDECVSNPCQHGGHCQNRMGYYECMCPRLWNGFNCDVYDEFFTGGLGSPVTTPPTTPASIDKQQKM------CIDNNCAEKSGNGRCDEECNLYACKFDNHECTFYV------------GPWQNCSAIR-QGIHCYDLFKNGRCDKACNSKECLYDGFDCEDPVQECNPIYNEYCNSHYGNGHCDKGCDNAACGWDGLDCTEDTPEIAVGTLVFILKIDPMEF-SKIRVGFLRDVGRLLHTVLKIKQNE-GMDMIYP---WPDDSYPVASELRTKRAASSK------GTQVFTQLDNQKCH---QECFDDTRNAAEYLAAGAQIDGLAKAYQVHSLYSADGP---KPHAENPIWIILSSTLFIIIVFLLLGVLGTAVR-------RKRAHGTTWFPEGFRL-----------PLGNSAPKQERDGPVGEERVVQNGQIPQ----SLDTTSSSDNLASG------------------------------IEWDDEGPDHPQSKRFKHDPDQDDDK--RQWTREHLAAACVPQPSIAALTPPQGDDQYDTSCVDVRGPGGYTPLLLASCYGGRYGSGEDENDNDVSADFITTLLSQGASINARTDQSGETSLHLAARYARADAAKRLLDVGSDPNAQDYSGRTPLHAAVAADAQGVFQILLRHRQ--TNLNMRMNDGTTALHLAARLAIEGTVNDLIAADA----DVNSVDEYGKTALHWAAAVNNLEASLVLLQHGANRDAQDSKDETPLFLAAKEGSYEVAKVLLDHFANRDITDQMDRLPRDVAVEKRHHDIVKLLDEY 2025          

HSP 2 Score: 547.74 bits (1410), Expect = 5.388e-156
Identity = 427/1264 (33.78%), Postives = 589/1264 (46.60%), Query Frame = 3
Query:  663 CASSPCRNGGICKSLEIH----KYECQCPKNYLGMNCEL--PNSCGSQNPCGVNGKCILANDGEV---KCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDT-CKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDE-DYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKI--SCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRV--GGFTCQCLQGFVGLRCETKSDICKQ--LTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG---YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIK----KTETCKSYA-------VEKFKNESLINKI----------CKHHGNCFN----DPETGGFKCSCQSGYGGSFCEVNIDD--------------------------------------CASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLIS-----------NPHGPCSPTGTLECL---------------------DRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCE 4097
            C +  C NGG C +++I     +  C+CP  Y G  CEL  P +  + +PCG  G C L  DG +   KC C  G  G+ C  + D CAS     C NGG C +  G+Y C+C +G+ G  C  DI +C   T CK+GGTC +  G+YRC CP  Y G NCE     C   PC+NGG C       Y+C C N + G NC  +      N    +G       + Y C C   F+G+ C+  +D C      C NG +C N I G +C C+ G+ G +C  NV++C  +PC N A+CID    Y CDCP G TG  C ++ D C  NPC +GA CE     G F C C  G+ G  C   ++ C++   +PC+    C+   NT   Y+C CP G     C+  +++C +  C N G C+D +   +CIC+PG++G+ CE +++EC + PC +G  C+D    + C C  GF G  C IN+NEC   PC   G C DE+ G++C C   Y G  C   +D C    C N+  CI  +  DS+ C C      Y G  C+ ++DEC+                      PC +   C N    + C+      G  CE  +N C +NPCRNGA+C++  + + C C  GFTG  CEI+INEC+ NPC N   C+D IN + C C  G+    C  N N+C  S C+  G+C+D +N F+C+C   Y G  C+  +  CD+NPC +  +C         PG   Y C C+ G+TG  CE  +D C  NPC   G C   +  ++C C+  Y G  C  +    +   C++ A        E F  +  I             C     C+N    +   G + C C  G+ G  C+ N+DD                                      CAS PC NG  C D    Y C CQ GF GVNC +N ++C S+SC N G CID++ ++ C C  G +G  C+  ++ C    C N G C N  G FEC C  GF G  C+  +N C  N   N                 N  GP    G + C                      D   +  C C + F G YCE  ID C+      + PC N   C N       + Y ++C+CP+G+ G  C+ +  +C  + C   G+C     D   SF C CPPG  G  CEI+ VNEC    C+NNG C +G G   C C  G  G +CE
Sbjct:    4 CRADKCMNGGTC-TVDIRTSGLRAICRCPIGYNGTMCELMDPKNICATSPCGYGGTCKL--DGSLSRFKCECPPGRIGSICELE-DYCASRP---CRNGGDCTSLSGTYSCRCLSGYTGRNCTEDIDECQTMTPCKHGGTCQNLFGTYRCTCPVTYTGENCETTYLPCSPSPCQNGGSCIVMGSLSYECRCANGFHGTNC-HINIDDCKNNLCKHGATCVDGIESYSCSCPPTFKGQYCDEDVDECSMGVNPCKNGATCQNQIGGYQCICVNGWTGKDCSENVDDCAIRPCYNGARCIDKVGYYYCDCPPGKTGLRCHLD-DACVSNPCKSGANCETSPIDGKFLCSCQPGWNGDDCNLDNNECQESWRSPCEHGGTCV---NTPGSYRCDCPIGFDGPRCEVNINECLSNPCFNDGTCLDESGRFQCICMPGYQGKRCEEDVDECRDQPCLNGGVCEDKIAKFTCSCPKGFTGPTCAINVNECQSRPCINGGTCQDEIDGYQCICQKGYYGKNCEQDIDDCQGVNC-NNGGCI--DLQDSFQCRCWEG---YTGKYCDSEIDECSSK--------------------PCQHGGTCTNLVNGYECQSPKGAYGPNCEHNINECASNPCRNGASCEDGLNQYVCNCRPGFTGTLCEIDINECESNPCQNGGTCLDQINSFLCRCPRGYYDYMCASNINECESSPCMHGGRCIDGINRFDCECPIGYEGYRCQSEENLCDNNPCQHGSTC--------EPGLAEYRCACKNGYTGRDCETNIDNCNPNPCV-HGNCLDHISGYECICDVAYSGVNCSKEMNPCEPNRCQNGAHCIPENNYEDFMCQCPIGFTGRLCAQDIDECAASNPCYNGATCENTDGSYVCWCAKGFTGRHCQTNVDDCNPDPCQNGATCHDGDADYTCHCVVGFGGRNCQQDIDECASDPCQNGASCHDYVNSYTCTCQLGFSGVNCDINDSDCTSSSCLNGGSCIDEVISYRCACSAGYTGANCQHRINPCDSRPCLNDGSCNNQDGSFECTCRFGFTGPRCDHFVNWCTQNPCRNGGRCFQRANQFECECPPNWTGPLCDVGMVNCQVAAMSKSVSLQELCQHGGTCHDSENSHFCRCHRGFDGSYCEVEIDECQ------SAPCKNGATCDNH------QGY-YTCLCPDGFQGPDCEYDIDECATSPCGYGGVCH----DLVNSFVCSCPPGTMGSLCEIN-VNECFEGACHNNGLCKDGIGTFTCECPSGFIGPRCE 1202          

HSP 3 Score: 502.286 bits (1292), Expect = 4.158e-141
Identity = 375/1153 (32.52%), Postives = 544/1153 (47.18%), Query Frame = 3
Query:  843 CHCNKGYTGNTCSNDIDECASYETPLCENGGTCI--NTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCE-LKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXX--XXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKC----KNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCE-------------------IKKTETCKSYAVEKFKNESLINKI----CKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDC-ASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVN---------ECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSAC------NLASIDNSQTY 4148
            C C  GY G  C   +D      T  C  GGTC    ++  ++C+C  G  G  CE +   C +  C+NGG C    G+Y C C + Y G NC      C+ + PCK+GG C++    Y+C C   +TG+NC+    PC  +PC+N G C  +    Y+C C  GF G  C  +ID+C+   C +G +C++ IE   C+C P F+G   + +++       PC+N A C +    Y C C  G TGK+C  N+D+C   PC NGARC D+VG + C C  G  GLRC    D C    PCK+   C   +     + C C  G    +C  + ++C    ++     G CV+     +C C  GF+G  CE+ INEC +NPC +   C D    + CIC+PG++GK+CE +++EC   PC   G C D++  F C C   ++GPTCA  ++ C    C N   C   ++ D Y C C      Y G  CE+D+D+C                      G   N+  CI+   SF C+C   Y G+ C+  ++ C + PC++G TC NL +G+ C+   G  G  CE  INEC  NPC N A C D +N Y C C+ GF+G  CEI+ N+C  + C   G C+D++N F C+C   Y    C      C+S+PC++ G CI+  +N+    + C C  G+ G RC+ + + C  NPC     CE  L  ++C C + Y G  CE                   I   E     A         +N      C++  +C  +     F C C  G+ G  C  +ID+C AS PC NG  C +  G Y C C  GF G +CQ N ++C  + C  G  C D   +++C C  G  GR C+  +D C    CQNG  C + +  + C C  GF+G  C+ + ++C  +   N  +                C+D   ++ C+C   +TG  C+ RI+ C+      + PC N+G C N+       + +F C C  G+ G RC      C  N C+N G C          F+CECPP   G  C++  VN           L   C + G+C +      C C++G  G  CE+    C      N A+ DN Q Y
Sbjct:   28 CRCPIGYNGTMCEL-MDPKNICATSPCGYGGTCKLDGSLSRFKCECPPGRIGSICELEDY-CASRPCRNGGDCTSLSGTYSCRCLSGYTGRNCTEDIDECQTMTPCKHGGTCQNLFGTYRCTCPVTYTGENCETTYLPCSPSPCQNGGSCIVMGSLSYECRCANGFHGTNCHINIDDCKNNLCKHGATCVDGIESYSCSCPPTFKGQYCDEDVDECSMGVNPCKNGATCQNQIGGYQCICVNGWTGKDCSENVDDCAIRPCYNGARCIDKVGYYYCDCPPGKTGLRCHL-DDACVS-NPCKSGANC-ETSPIDGKFLCSCQPGWNGDDCNLDNNECQESWRSPCEHGGTCVNTPGSYRCDCPIGFDGPRCEVNINECLSNPCFNDGTCLDESGRFQCICMPGYQGKRCEEDVDECRDQPCLNGGVCEDKIAKFTCSCPKGFTGPTCAINVNECQSRPCINGGTCQ--DEIDGYQCICQKG---YYGKNCEQDIDDCQ---------------------GVNCNNGGCIDLQDSFQCRCWEGYTGKYCDSEIDECSSKPCQHGGTCTNLVNGYECQSPKGAYGPNCEHNINECASNPCRNGASCEDGLNQYVCNCRPGFTGTLCEIDINECESNPCQNGGTCLDQINSFLCRCPRGYYDYMCASNINECESSPCMHGGRCID-GINR----FDCECPIGYEGYRCQSEENLCDNNPCQHGSTCEPGLAEYRCACKNGYTGRDCETNIDNCNPNPCVHGNCLDHISGYECICDVAYSGVNCSKEMNPCEPNRCQNGAHCIPENNYEDFMCQCPIGFTGRLCAQDIDECAASNPCYNGATCENTDGSYVCWCAKGFTGRHCQTNVDDCNPDPCQNGATCHDGDADYTCHCVVGFGGRNCQQDIDECASDPCQNGASCHDYVNSYTCTCQLGFSGVNCDINDSDCTSSSCLNGGS----------------CIDEVISYRCACSAGYTGANCQHRINPCD------SRPCLNDGSCNNQ-------DGSFECTCRFGFTGPRCDHFVNWCTQNPCRNGGRC----FQRANQFECECPPNWTGPLCDVGMVNCQVAAMSKSVSLQELCQHGGTCHDSENSHFCRCHRGFDGSYCEVEIDECQSAPCKNGATCDNHQGY 1111          

HSP 4 Score: 207.223 bits (526), Expect = 2.323e-49
Identity = 169/524 (32.25%), Postives = 239/524 (45.61%), Query Frame = 3
Query: 2688 DNDCTESSCLGHGQC-VD-KVNGFE--CKCNENYIGTNCEHL--KRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGEC-GDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKM--ECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISN--------PHG---------------PCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEI 4160
            DN C    C+  G C VD + +G    C+C   Y GT CE +  K  C ++PC   G+C   K++ +   + C C  G  G  CE++ D+C   PC + G C +   ++ C+C S Y G  C  +  + C++               CKH G C N    G ++C+C   Y G  CE     C+  PC NGG C   G+  Y C+C  GF G NC +N ++C +N C  G  C+D I ++SC CP    G++C+  VD C      C+NG  C+N IG ++C C  G+ GK C  ++++C      N    I          P G               PC      E     G F CSC+  + G  C    + C++  +S   PC + G C+N          ++ C CP G+ G RC++N  +C  N C N+G C    +D+   F+C C PG  G  CE D V+EC    C N G C +   K  C C KG  G  C I  + C      N  T QDEI
Sbjct:    1 DNPCRADKCMNGGTCTVDIRTSGLRAICRCPIGYNGTMCELMDPKNICATSPCGYGGTC---KLDGSLSRFKCECPPGRIGSICELE-DYCASRPCRNGGDCTSLSGTYSCRCLSGYTGRNC-TEDIDECQTMTP------------CKHGGTCQN--LFGTYRCTCPVTYTGENCETTYLPCSPSPCQNGGSCIVMGSLSYECRCANGFHGTNCHINIDDCKNNLCKHGATCVDGIESYSCSCPPTFKGQYCDEDVDECSMGVNPCKNGATCQNQIGGYQCICVNGWTGKDCSENVDDCAIRPCYNGARCIDKVGYYYCDCPPGKTGLRCHLDDACVSNPCKSGANCETSPIDGKFLCSCQPGWNGDDCNLDNNECQESWRS---PCEHGGTCVNTPG-------SYRCDCPIGFDGPRCEVNINECLSNPCFNDGTC----LDESGRFQCICMPGYQGKRCEED-VDECRDQPCLNGGVCEDKIAKFTCSCPKGFTGPTCAINVNECQSRPCINGGTCQDEI 490          
BLAST of Neurogenic locus notch protein vs. Ensembl Cavefish
Match: notch1a (neurogenic locus notch homolog protein 1 [Source:NCBI gene;Acc:103034623])

HSP 1 Score: 1007.67 bits (2604), Expect = 0.000e+0
Identity = 685/2008 (34.11%), Postives = 983/2008 (48.95%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCK--------KMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSC--VNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIP-GGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSI-----------RVFAENSNSDSSKSRQKRSLSNSV---------QQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITI-------LTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDY 6302
            ++ C  H C+NG  C   +N  Y C C   + G YC E    C ++P  CQNGGTC    G   C C+N W G+ C E   +CAS+ C +G  C    +  + C+CP    G+ C L ++C S NPC     C     +G+  C C  GYTG+ C+ DIDEC+    P CE+GG C+NT GS+QCKC  G+ G RCE D+ +C ++ C+N  TCLD+IG + C+C   Y G  C+     C  +PC N G C D    + C C   ++G  C  DV               +  N   + C C+ GF G +CE  I+ C    C  G  C + +    C C PG+ G  CEIN+NEC ++PC+N   C+D  N YTC CP+G TG+NCEIN+D+C   PC  G +C D++ G+ C C  G+ G  C    D C  L PC+    C++  N+   + C+CPDG  +  C  + ++C +  CI+G C D  N   C+C PG+ GR C++ +NEC +NPC +G  C+D+ N Y+C C  GF G  C+ NINECA NPC   G CID+V G++C C+LPY+G  C + L PC+   C N  +C     Y S+ C C      ++G  CE D++EC                       PCLN   C+N+ G F C C+  + G  CE   ++C  NPC NG  C +  +GF C CVAGF GERC  +I+EC   PC N   C D +N Y C C +GFSG NCEIN  DCTESSC   G CVD +N F C C   + G+ C+H    CDS PCLN G+C      Q+  G Y C C  G+TG  C+  + WC  +PC + G C     SF C+C S + G  C++       S  V   +    +  +C++ G C +   T    C CQ+GY GS+C+  +D+C   PC NG  C D  G Y C+C  G+ GVNC    NEC S  C N G CID +N++ C CPRG  G  CE  VD C         +  C NGG C + +G + C C  G+ G+ CE D+NEC  +              PC P G+  C+    ++ C C+  +TG+ C+T  D C+      + PC N G C      + G    + C CP G+ G  C+ NS+ C    C+N   C    +   +S +C CPPG  G  C+    + CLS  CYN G+C  ++      C C     G  C I   + N     +     +    CE+ +C  +  N ICD +CN +ACG+DGG+C            ++   PW NC    S  + C  +FN+ +CD QC    CL+DG+DC    GQC PL   +C  HY+DG C   CN +EC +DG DC E     +  G ++L++ ++ TE   R  +  L+ L+ LLH+ V   RN+NG+ +IF             R   + S+      R +RSLS  V         Q    G+ VYLE+DN  C   S  CF ++   A F+ A     +   P  I +V + +       E P+      + +  LV+  +++  +   M  K     +K    ++W+PEG K             +    +KR + +         L N +     +  +  + +D G                           E  ML    D+     P +  + H+D  + R       N++A     G+   +      R    +   ++        ET    D   +++  + ++IT        L ++   +GET LHLAA+Y R +AA+ LLE+ +D N  +  GR+ L  A+ A A  V    +  +    DL  +  +G+T LI A + A   ++  L+        D+N  D+ G++ALHWAA         +LL  G N+D Q+N+E TPL+LA +EG  E  KIL+ + AN D++DHLD+LPRD+A+      IV LLE+Y
Sbjct:  255 IDDCVQHACENGGKCMDGVN-TYNCHCDKHWTGQYCTEDVDECELSPNACQNGGTCHNTVGGFHCVCVNGWSGDDCSENIDDCASAACYHGATCHD-RVASFYCECPHGRTGLLCHLDDACIS-NPCQKGSNCDTNPVNGKAICTCPPGYTGSACNQDIDECSLGANP-CEHGGRCLNTKGSFQCKCLKGYEGPRCEMDVNECKSNPCQNDATCLDQIGGFHCICMPGYEGEFCQINTDDCASQPCLNNGKCIDKINSFYCECPKGFSGSLCQVDVDECASTPCQNGAKCTDGPN--KFTCECKEGFTGSLCEIDINECASNPCHYG-VCKDGLASFTCACRPGYAGRLCEININECLSQPCRNGGTCLDRENSYTCTCPKGTTGRNCEINVDDCKSKPCDFG-KCIDKINGYECLCDPGYTGATCNINIDDCA-LNPCRNGGTCVDGVNS---FTCLCPDGYHDSTCLSQRNECASNPCIHGNCQDQANSYLCVCEPGWTGRNCDLNLNECLSNPCVNGGTCRDMTNGYICSCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGDLCESVLAPCSSRPCKNGGVCRESEDYQSFSCACPAG---WQGQTCEVDINEC--------------------VKSPCLNGGVCLNSVGGFQCHCNPGFTGDLCETDTDDCTPNPCSNGGVCVDRVNGFTCVCVAGFRGERCTEDIDECVSAPCRNGGNCTDCVNSYTCSCPAGFSGINCEINTPDCTESSCFNGGTCVDGINSFSCVCLPGFTGSYCQHDVNECDSRPCLNGGTC------QDGFGTYKCTCPHGYTGANCQSLVRWCDSSPCKNGGSCWQKGSSFTCQCASGWTGLYCDVPSV----SCEVAAQQQGVPVATLCRNGGQCVDVGST--HLCRCQAGYTGSYCQEQVDECVPNPCHNGATCTDYLGGYTCECVAGYHGVNCSKEINECVSQPCQNGGTCIDLVNSYKCSCPRGTQGVHCEIDVDDCSPDTDPLTGEPRCFNGGRCVDRVGGYGCVCSPGYVGERCEGDVNECLSD--------------PCDPNGSYNCVQLVNSYRCECRTGYTGQRCDTVFDGCK------DKPCKNGGTCAVASNTKHG----YICKCPPGFSGSSCEYNSQSCGSLRCRNGATC----VSGHLSPRCLCPPGFSGHECQNRLDSPCLSNPCYNGGTCQPISDAPFFRCLCPHNFNGLLCHILDYSFNGGQGKDIAPPPELEIRCEVAQCEGRGGNAICDAQCNNHACGWDGGDC-----------SLNFDDPWQNC----SAALQCWRYFNDGKCDEQCANAGCLYDGFDCQRLEGQCNPLYDQYCKDHYSDGHCDQGCNNVECEWDGLDCAEDVPQKLAVGSLVLVVHITPTELQNR-SSSFLRELSGLLHTNVVFRRNANGEPLIFPYYGNEHELSKHKRSAHDWSDPAQLLQRARRSLSAFVHTRLRRELDQMEIKGSIVYLEIDNRQCFQQSDECFQSATDVAAFLGALASSGNLNVPYIIEAVTSEN-------EAPSRGEMYPMFLALLVLAVLVLVAVGVVMSRK-----RKREHGQLWFPEGFK-------------VTEPKKKRREPVGEDSVGLKPLKNSESTLMDEQLSEWAEEDHGKR---------------------FRFEEQSML----DIGGQLDPRQWTQQHLDAADLR------LNSMAPTPPQGDIDNDCMDVNVRGPDGLTPLMIASCSGGGLETANGED---EDDDPSAAVITDFICHGANLHNQTDRTGETALHLAARYARSDAAKRLLESSADANVQDNMGRTPLHAAVAADAQGVFQILIRNR--ATDLDARMNDGTTPLILATRLAVEGMVDELINCHA----DINAIDDTGKSALHWAAAVNNVDATVVLLKNGANKDLQNNKEETPLFLAAREGSYETAKILLDHLANRDITDHLDQLPRDIAQERMHHDIVRLLEEY 2106          

HSP 2 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 442/1312 (33.69%), Postives = 632/1312 (48.17%), Query Frame = 3
Query:  390 AILILLFCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCK-LIAGNNV---CQCLNEWVGEFCEFSSN--CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGS-YRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCID--LNNDYTCDCPEGLTGKNCEINIDECT--PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAV--------------------LSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNI------------------AGNATNLISN-PHGPCS--------PTGTL-----ECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECL--------STKCYNNGSCVNGFGKAICHCNKGSCGEKCE 4097
             I I +     ++     +  C+NG TC+   NG+  C C   + G  C+  + C  +PC+NGG C+    GN+V   C+C+  + G  C    N  C +SPCRNGG C  + +  + C+CP  + G  C+  + C S NPC   G+C  A +    C C   + G TC  D++ECA   +P C NGG C+N VGSY+C+C A F G  CE     C    C NGGTC+    + Y C C   + G +CE+    C    C+NGG C D    Y C C   WTG+ C +DV           NG         + C+C  G+ G  C  +ID+C   +C++G +C + +    C C P           + C + PCQ  + C    +N    C CP G TG  C  +IDEC+   NPC +G RC +  G F C+CL+G+ G RCE   + CK   PC+ +  CL   +   G+ CIC  G +   C+     C +  C+ NG+C+D  N   C C  GF G  C+++++EC + PCQ+G++C D  N + C C  GF G  CEI+INECA NPC   G C D +  F C C   Y+G  C   ++ C    C N   C+  ++ +SY C C        G  CE +VD+C   +++   +G  +                    +++ +  + PC N   C++   SF C C   Y    C    N C +NPC +G  C + A+ + C C  G+TG  C++ +NEC  NPC N   C D  N Y C C++GFSG NC+ N N+C  + CL  G C+D V G++C C   Y G  CE +  PC S PC N G C   + +++   + C C  G+ G  CE+ ++ C  +PC + GVC   +  F+C CN  + G+ CE   T+ C                 C + G C +     GF C C +G+ G  C  +ID+C S PC NGG C D    Y C C  GF G+NC++NT +C  +SC N G C+D IN+FSCVC  G +G +C+  V+ C    C NGG C++  G ++C CP G+ G  C++ +  C  +                   A   T L  + P   C         P  TL     +C+D   T  C C+  +TG YC+ ++D C         PC N   C +           ++C C  GY G  C     +C    C+N G C    ID   S+KC CP G  G+ CEID V++C           +C+N G CV+  G   C C+ G  GE+CE
Sbjct:    6 VITIFVTAIFTVTEGLRCSEPCQNGGTCELVANGQVACRCPADFVGPQCQIPNPCSPSPCRNGGVCRPRTQGNDVDFTCECMLGFSGPLCLTPVNHACMNSPCRNGGSCSLITLATFSCRCPPGWSGKTCQQADPCAS-NPCANGGQCS-AFESHFICTCPPNFHGQTCRQDVNECALSPSP-CRNGGVCVNEVGSYRCRCPAEFAGTHCERPFHPCHPSPCTNGGTCVQTSDTGYTCSCLPGFNGQDCEHNIDDCVQHACENGGKCMDGVNTYNCHCDKHWTGQYCTEDVDECELSPNACQNGGTCHNTVGGFHCVCVNGWSGDDCSENIDDCASAACYHGATCHDRVASFYCEC-PHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTGSACNQDIDECSLGANPCEHGGRCLNTKGSFQCKCLKGYEGPRCEMDVNECKS-NPCQNDATCL---DQIGGFHCICMPGYEGEFCQINTDDCASQPCLNNGKCIDKINSFYCECPKGFSGSLCQVDVDECASTPCQNGAKCTDGPNKFTCECKEGFTGSLCEIDINECASNPCHY-GVCKDGLASFTCACRPGYAGRLCEININECLSQPCRNGGTCL--DRENSYTCTCPKGT---TGRNCEINVDDC---KSKPCDFGKCIDKINGYECLCDPGYTGATCNINIDDCALNPCRNGGTCVDGVNSFTCLCPDGYHDSTCLSQRNECASNPCIHG-NCQDQANSYLCVCEPGWTGRNCDLNLNECLSNPCVNGGTCRDMTNGYICSCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGDLCESVLAPCSSRPCKNGGVC---RESEDYQSFSCACPAGWQGQTCEVDINECVKSPCLNGGVCLNSVGGFQCHCNPGFTGDLCET-DTDDCTP-------------NPCSNGGVCVD--RVNGFTCVCVAGFRGERCTEDIDECVSAPCRNGGNCTDCVNSYTCSCPAGFSGINCEINTPDCTESSCFNGGTCVDGINSFSCVCLPGFTGSYCQHDVNECDSRPCLNGGTCQDGFGTYKCTCPHGYTGANCQSLVRWCDSSPCKNGGSCWQKGSSFTCQCASGWTGLYCDVPSVSCEVAAQQQGVPVATLCRNGGQCVDVGSTHLCRCQAGYTGSYCQEQVDECVPN------PCHNGATCTDYLG-------GYTCECVAGYHGVNCSKEINECVSQPCQNGGTC----IDLVNSYKCSCPRGTQGVHCEID-VDDCSPDTDPLTGEPRCFNGGRCVDRVGGYGCVCSPGYVGERCE 1262          

HSP 3 Score: 488.804 bits (1257), Expect = 4.132e-139
Identity = 366/1099 (33.30%), Postives = 515/1099 (46.86%), Query Frame = 3
Query: 1026 NDTCKNGGTC-LDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDF----DEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXX--XXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC-EDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLN-------------------------------------VNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQD--LFNDYLCICLPGFKGKKCEININECA--HNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNV--IGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQD 4154
            ++ C+NGGTC L   G   C CP ++ G  C+     C   PC+NGG+CR      D D+ C C   ++G  C   V + C  +PC+N G C  +    + C C  G+ GK C+ + D C    C NGG C        C C P F G     ++N       PC+N   C++    Y C CP    G +CE     C P+PC NG  C +    G+TC CL GF G  CE   D C Q   C+    C++                                      +NT  G+ C+C +G    +C + +  C +  C +G  C D      C C  G  G  C ++ + C +NPCQ GS C    +    +C C PG+ G  C  +I+EC+   NPC   G+C++    F+C+C+  Y GP C   ++ C  N C NDA C+  ++   +HC C   +  YEG  C+ + D+C                       PCLN+ +CI+   SF C+C   + G  C+  ++ C + PC+NGA C +  + F C C  GFTG  CEI+INEC  NPC +   C D +  + C C+ G++G+ CEIN N+C    C   G C+D+ N + C C +   G NCE     C S PC + G CI+ K+N    GY C C  G+TG  C I +D C  NPC + G C   ++SF C C   Y    C  ++ E   +  +               HGNC +  +   + C C+ G+ G  C++N+++C S PC+NGG C D T  Y C C+ GF G NCQ N NEC SN C N G CID +  + C C    +G  CE+++  C    C+NGG+C+       F C CP G+ G+ CE DINEC  +              PC   G   CL+  G F C C   FTG  CET  D C         PC N G+C+++          F+C+C  G+ GERC  +  +C    C+N G C     D   S+ C CP G  G+ CEI+   +C  + C+N G+CV+G     C C  G  G  C+   + C+     N  T QD
Sbjct:   24 SEPCQNGGTCELVANGQVACRCPADFVGPQCQIPNP-CSPSPCRNGGVCRPRTQGNDVDFTCECMLGFSGPLCLTPVNHACMNSPCRNGGSCSLITLATFSCRCPPGWSGKTCQQA-DPCASNPCANGGQCSAFESHFICTCPPNFHGQTCRQDVNECALSPSPCRNGGVCVNEVGSYRCRCPAEFAGTHCERPFHPCHPSPCTNGGTCVQTSDTGYTCSCLPGFNGQDCEHNIDDCVQHA-CENGGKCMDGVNTYNCHCDKHWTGQYCTEDVDECELSPNACQNGGTCHNTVGGFHCVCVNGWSGDDCSENIDDCASAACYHGATCHDRVASFYCECPHGRTGLLCHLD-DACISNPCQKGSNCDTNPVNGKAICTCPPGYTGSACNQDIDECSLGANPCEHGGRCLNTKGSFQCKCLKGYEGPRCEMDVNECKSNPCQNDATCL--DQIGGFHCIC---MPGYEGEFCQINTDDCASQ--------------------PCLNNGKCIDKINSFYCECPKGFSGSLCQVDVDECASTPCQNGAKCTDGPNKFTCECKEGFTGSLCEIDINECASNPC-HYGVCKDGLASFTCACRPGYAGRLCEININECLSQPCRNGGTCLDRENSYTCTCPKGTTGRNCEINVDDCKSKPC-DFGKCID-KIN----GYECLCDPGYTGATCNINIDDCALNPCRNGGTCVDGVNSFTCLCPDGYHDSTCLSQRNECASNPCI---------------HGNCQD--QANSYLCVCEPGWTGRNCDLNLNECLSNPCVNGGTCRDMTNGYICSCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGDLCESVLAPCSSRPCKNGGVCRESEDYQSFSCACPAGWQGQTCEVDINECVKS--------------PCLNGGV--CLNSVGGFQCHCNPGFTGDLCETDTDDCTPN------PCSNGGVCVDRVN-------GFTCVCVAGFRGERCTEDIDECVSAPCRNGGNC----TDCVNSYTCSCPAGFSGINCEIN-TPDCTESSCFNGGTCVDGINSFSCVCLPGFTGSYCQHDVNECDSRPCLNGGTCQD 1035          

HSP 4 Score: 480.715 bits (1236), Expect = 1.231e-136
Identity = 349/1026 (34.02%), Postives = 499/1026 (48.64%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDING-------------------------------------KYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCEL-PNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCT--------ESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGS--CINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDS---FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDD-CASQPCINGGECGDGTGMYF--CKCQPGFQGVNCQV 3317
            + +N C+++ C+N ATC   I G                                      + CEC  G+ G+ C+   + C  TPCQNG  C        C+C   + G  CE   N CAS+PC   G+CK   +  + C C   Y G  CE+  N C SQ PC   G C L  +    C C KG TG  C  ++D+C S         G CI+ +  Y+C C  G+ G  C  +I DC  + C+NGGTC+D + S+ C+CP+ Y  + C ++R  C   PC +G  C+D    Y C+C   WTG+NCD   N C  NPC N G C  +    Y C C+ GF G  C+T+I+ C    C N G+CI+ + G KCNCL  + G+ CE  +  C ++PC+N   C +  +   ++C CP G  G+ CE++I+EC  +PCLNG  C + VGGF C C  GF G  CET +D C    PC    +C++  N   G+ C+C  G   + C +++ +C +  C N G C D  N   C C  GF G  CEI   +C  + C +G  C D  N + C+CLPGF G  C+ ++NEC   PC   G C D    ++C C   Y+G  C + +  C+ + C N   C    K  S+ C C++    + G  C+     C +   Q    G+ V ++       C N  QC++   + +C+C + Y G  C++ ++ C  NPC NGATC +   G+ C CVAG+ G  C  EINEC   PC N   CID +N Y+C C  G  G +CEI+ +DC+        E  C   G+CVD+V G+ C C+  Y+G  CE     C S+PC   GS  C+     Q    Y C CR G+TG RC+   D C+  PC + G C    ++   + CKC   + G  CE              + ++S  +  C++   C +   +   +C C  G+ G  C+  +D  C S PC NGG C   +   F  C C   F G+ C +
Sbjct:  448 MDVNECKSNPCQNDATCLDQIGGFHCICMPGYEGEFCQINTDDCASQPCLNNGKCIDKINSFYCECPKGFSGSLCQVDVDECASTPCQNGAKCTDGPNKFTCECKEGFTGSLCEIDINECASNPCHY-GVCKD-GLASFTCACRPGYAGRLCEININECLSQ-PCRNGGTC-LDRENSYTCTCPKGTTGRNCEINVDDCKSKPCDF----GKCIDKINGYECLCDPGYTGATCNINIDDCALNPCRNGGTCVDGVNSFTCLCPDGYHDSTCLSQRNECASNPCIHGN-CQDQANSYLCVCEPGWTGRNCDLNLNECLSNPCVNGGTCRDMT-NGYICSCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGDLCESVLAPCSSRPCKNGGVCRESEDYQSFSCACPAGWQGQTCEVDINECVKSPCLNGGVCLNSVGGFQCHCNPGFTGDLCETDTDDCTP-NPCSNGGVCVDRVN---GFTCVCVAGFRGERCTEDIDECVSAPCRNGGNCTDCVNSYTCSCPAGFSGINCEINTPDCTESSCFNGGTCVDGINSFSCVCLPGFTGSYCQHDVNECDSRPCLNGGTCQDGFGTYKCTCPHGYTGANCQSLVRWCDSSPCKNGGSCW--QKGSSFTCQCASG---WTGLYCDVPSVSCEVAAQQ---QGVPVATL-------CRNGGQCVDVGSTHLCRCQAGYTGSYCQEQVDECVPNPCHNGATCTDYLGGYTCECVAGYHGVNCSKEINECVSQPCQNGGTCIDLVNSYKCSCPRGTQGVHCEIDVDDCSPDTDPLTGEPRCFNGGRCVDRVGGYGCVCSPGYVGERCEGDVNECLSDPCDPNGSYNCV-----QLVNSYRCECRTGYTGQRCDTVFDGCKDKPCKNGGTCAVASNTKHGYICKCPPGFSGSSCE--------------YNSQSCGSLRCRNGATCVSGHLSP--RCLCPPGFSGHECQNRLDSPCLSNPCYNGGTCQPISDAPFFRCLCPHNFNGLLCHI 1423          

HSP 5 Score: 410.609 bits (1054), Expect = 6.796e-115
Identity = 355/1153 (30.79%), Postives = 496/1153 (43.02%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDIN-----------------GKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTV-------------------------------------GSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFC-ESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNA----------CYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNP--------CSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQ--CVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTP-GYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEV--------NIDDCASQPCI----NGGECGDGTGMYFCKCQ-----PGFQGVNCQVNTNECYSNSC---------NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNI 3569
            I+  +CE  K  +G+ CQ D++                  K+ CEC  G+ G+ CE   N C   PC   G CK    +  C C   + G  CE + N C S PCRNGG C   E + Y C CPK   G NCE+        PC   GKCI   +G  +C C+ GYTG TC+ +ID+CA      C NGGTC++ V                                      SY C C+ G+ G  C+ ++ +C ++ C NGGTC D    Y C C   + G NC+     C   PC N G C D    Y+C C   +TG  C+ V  PC   PCKN G C ES +YQ + C C  G++G+ CE  I+ C K  C NGG C+N + G +C+C PGF G+ CE + ++C   PC N   C+D  N +TC C  G  G+ C  +IDEC   PC NG  C D V  +TC C  GF G+ CE  +  C       TE  C N                                 G CVD  N   C+C+PGF G  C+ ++NEC + PC +G  CQD F  Y C C  G+ G  C+  +  C  +PC   G C  +   F CQC   ++G  C      C   A          C N   C+  +   ++ C C      Y GS C++ VDEC  +                    PC N   C +  G + C+C + Y G  C K +N C + PC+NG TC +L + ++C C  G  G  CEI++++C  +         C N  +C+D +  Y C+C  G+ G+ CE + N+C    C  +G   CV  VN + C+C   Y G  C+ +   C   PC N G+C    V  NT  GY+C C  GF+G  CE     C    C +   C +   S +C C   + G  C+ +    C             ++  C + G C    +   F+C C   + G  C +           D A  P +       +C    G   C  Q      G+ G +C +N ++ + N           N GKC +Q  N  C+      G  C+ +   C  +  Q    CK+   D  C+  +G     CE D  +C  ++
Sbjct:  506 INSFYCECPKGFSGSLCQVDVDECASTPCQNGAKCTDGPNKFTCECKEGFTGSLCEIDINECASNPCHY-GVCKDGLASFTCACRPGYAGRLCEININECLSQPCRNGGTCLDRE-NSYTCTCPKGTTGRNCEINVDDCKSKPCDF-GKCIDKING-YECLCDPGYTGATCNINIDDCALNP---CRNGGTCVDGVNSFTCLCPDGYHDSTCLSQRNECASNPCIHGNCQDQANSYLCVCEPGWTGRNCDLNLNECLSNPCVNGGTCRDMTNGYICSCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGDLCESVLAPCSSRPCKNGGVCRESEDYQSFSCACPAGWQGQTCEVDINECVKSPCLNGGVCLNSVGGFQCHCNPGFTGDLCETDTDDCTPNPCSNGGVCVDRVNGFTCVCVAGFRGERCTEDIDECVSAPCRNGGNCTDCVNSYTCSCPAGFSGINCEINTPDC-------TESSCFN--------------------------------GGTCVDGINSFSCVCLPGFTGSYCQHDVNECDSRPCLNGGTCQDGFGTYKCTCPHGYTGANCQSLVRWCDSSPCKNGGSCWQKGSSFTCQCASGWTGLYCDVPSVSCEVAAQQQGVPVATLCRNGGQCV--DVGSTHLCRCQAG---YTGSYCQEQVDECVPN--------------------PCHNGATCTDYLGGYTCECVAGYHGVNCSKEINECVSQPCQNGGTCIDLVNSYKCSCPRGTQGVHCEIDVDDCSPDTDPLTGEPRCFNGGRCVDRVGGYGCVCSPGYVGERCEGDVNECLSDPCDPNGSYNCVQLVNSYRCECRTGYTGQRCDTVFDGCKDKPCKNGGTC---AVASNTKHGYICKCPPGFSGSSCEYNSQSCGSLRCRNGATCVSGHLSPRCLCPPGFSGHECQNRLDSPC-------------LSNPCYNGGTCQPISDAPFFRCLCPHNFNGLLCHILDYSFNGGQGKDIAPPPELEIRCEVAQCEGRGGNAICDAQCNNHACGWDGGDCSLNFDDPWQNCSAALQCWRYFNDGKCDEQCANAGCL----YDGFDCQRLEGQCNPLYDQ---YCKDHYSDGHCD--QGCNNVECEWDGLDCAEDV 1562          
BLAST of Neurogenic locus notch protein vs. Ensembl Cavefish
Match: notch3 (neurogenic locus notch homolog protein 2 [Source:NCBI gene;Acc:103042072])

HSP 1 Score: 993.03 bits (2566), Expect = 0.000e+0
Identity = 690/2001 (34.48%), Postives = 985/2001 (49.23%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCR-GNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCK-------KMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVN--GFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRKAEIWYPEGMKRLNQQTSQFNHKRLVNSN--------RKRNQNLLNCHNASSELGNIQQMTKSKISTTDSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRN-IEAWCFNTIANLLVSGNGLGEFSPTESRDK-QIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLITILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQH 6332
            ++++ C  HKC NG TC   +N  Y C+C   + G YC +  N C + P  C NGGTC    G + C C+N W G+ C E   +CA++ C NG  C    +  + C+CP    G+ C L ++C S NPC     C     +G   C C  G+ G  C  D+DEC+    P CE+ G C+NTVGS+QC+C  G+ G RCE DI +C +  C+N  TCLD+IG + C+C   Y GT+CE     CE  PC N GICRD    + C C   +TG  C  D+               +  N   Y+C C  GFEG++CE++IDNCQ   C +G +C++ I    CNC+PG+ G  CE  +NEC + PCQN  KC+DL N Y C C  G +G NCEIN D+C  NPC  G  C+D +  + C C  GF G +C  + D C    PC+    C++  N   G+ C+CP G     C   + +C +  C++G C +  +  +C C PG+ G+ C+++ N+C  NPCQ+   C D  N + C C  GF+G +C++NINECA +PC   G C+D V  F C C  PYSGPTCA  L PC+PN C N A+C     Y  Y CNC      ++G  C  DV+EC  +                    PC N   C NT G ++C C   Y G  CE  +N+C  NPC +G +C +  + F C C+ GFTG RC IE++ECQ  PC N   C D++N Y C C+ GF+G +CE N  DCTESSC   G CVDK+NGF C C   + G +C++    CDS PCLN G C           + C+C +G+TG RC++++DWCR  NPC + G C     S  C C   + G  C+I    +C+  A+++       +++C   G+C N   T    C C + Y GS+CE  +D C  +PC+NG  C    G Y C C PG++G NC+   NEC S+ C N G CID + ++ C CP G  G  CE   D C          +CQN G C + +G + CNCP G+ G  CE DINEC  N              PC+   +L+C+  P  + C CK  FTG+ C+ R   CE      + PC N G C     + +G    + C C  GY G  C+  S  C+   C N G C    +  R + +C C  G  G  C+      C S  C NNG C+    F    C C +G  G++CE             S+  +     C +  C  KA++ +CD ECN  AC +DGG+C               A+PW+ C   +     C   FNN +CD  CN   CL+D +DC      C P+ +++C  HYADG+C   CN  EC +DG DC  +    +  G+++++ +   E + R  T  LQ L+ +L + +R   + NG  M   IR +           R KR L    QQ   G+ VYLE+DN  C   S  CF  ++SAAE++ A    +  R P P+  V+      +  P           V   L+++ V    L   +        +K   + +W+PEG       +S  N +  V  +        +   ++LL  H+      +  +  + K+     + DS  +++ S + T +                    L+  D+ M  PP       M L  P+   +  C +      V+  G   F+P          +E  +      +   N  +DL  +           L ++   +GET LHLAA+Y R +AA+ LL+AG+D N  +  GR+ L  A+ + A  V    +  +T   DL  +  +GST LI A + A   +++ L+        D+N  DE G++ALHWAA          LL  G N+D QD +E TPL+LA +EG  E  KIL+A+ AN +++DH+DRLPRD+A+      IV LL++Y N  +  Q H
Sbjct:  211 VNVDDCPGHKCMNGGTCVDGVN-TYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGGHTCVCVNGWTGDDCSENIDDCATAVCFNGATCHD-RVASFYCECPVGKTGLLCHLDDACVS-NPCNEGAVCDTNPLNGRAICTCPAGFIGGACIQDMDECSIGANP-CEHFGKCVNTVGSFQCQCGRGYTGPRCEIDINECLSMPCQNDATCLDRIGEFTCICMPGYTGTHCEIDIDECESNPCVNDGICRDLVNAFTCTCQTGFTGTMCQIDIDECASTPCQNGAKCIDRPN--GYECRCAEGFEGRLCESNIDNCQPDPCHHG-TCVDGIASYTCNCVPGYTGYRCENQLNECHSNPCQNGGKCVDLVNKYICQCQHGTSGTNCEINYDDCASNPCEYGM-CKDGINRYDCVCKPGFTGPQCNVELDECSS-NPCRNGGTCVDDEN---GFHCLCPAGFHEPYCFSHVDECSSSPCVHGACREDPDGYRCECEPGWVGKNCDLDRNDCLPNPCQNAGTCIDQLNGFTCKCRQGFRGNQCQVNINECASSPCLNQGTCVDGVASFTCLCEAPYSGPTCAEVLTPCSPNPCSNHAVCTHTPDYFGYQCNCQPG---WQGHLCNIDVNECASN--------------------PCKNRGTCTNTLGGYVCSCRGGYSGPNCETDINDCLPNPCMSGGSCTDGINTFYCTCLPGFTGPRCAIEVDECQSAPCKNGGTCTDYVNSYTCTCKPGFTGLHCETNAMDCTESSCFNGGTCVDKINGFSCTCRVGFTGEHCQYEVNECDSQPCLNGGVC-----QDGLESFRCSCPKGYTGSRCQVRVDWCRHSNPCQNGGRCRPKDGS--CDCVGGWSGRYCDIPGV-SCEMAAMQRGLQ---TDELCHRGGHCVNTGNT--HYCKCPNDYTGSYCESQVDHCEDKPCLNGATCRGYVGGYTCDCMPGYEGQNCEREINECRSHPCQNGGTCIDLVGHYICSCPPGTMGVLCEINEDDCATPTRPRGTPKCQNNGTCVDRVGGYRCNCPPGYTGDRCEGDINECHSN--------------PCNAANSLDCIQLPNDYLCVCKPGFTGRGCQNRFGVCE------SQPCKNGGACSGAGSSPLG----YICTCQLGYTGTNCE-RSMSCRELSCYNGGSC---TVTSRGA-RCSCQQGFAGPQCQHRSNQSCSSKPCRNNGICIEEANFPFFSCQCMEGWKGKRCE-----------QESRMLERPAPTCLIADCHGKANDGVCDKECNSMACRWDGGDC------------SLAANPWARCADPR-----CWRVFNNSQCDESCNNADCLYDNFDCKTKEKVCNPIYETYCMDHYADGRCDQGCNNEECGWDGLDCARTIPEDLADGVLVIVVLLPPEELLRTGTAFLQKLSSILRTSLRFRLDQNGDAM---IRPYTRR------DGRPKREL--MPQQEVIGSIVYLEIDNRLCSQDSNDCFPTADSAAEYLGALSAREMLRFPYPLKEVRGEKIKDQVVP-----------VWGKLLLVSVASLFLMIILVVGMLIARRKREHSTLWFPEGFFLKKDTSSNKNRREPVGQDALGMKHMPKTVEESLLADHSDQWIDTDCPEAKRLKVEEPSILSDS-EDAVDSRQWTQHH-------------------LAAADIRM--PPS------MALTPPQGEFDGDCMD------VNVRGPDGFTPLMLASFCGGGLEPEVAEEEEEESSANIISDLIYQG--------ASLGAQTDRTGETALHLAARYARADAAKRLLDAGADANAQDNTGRTPLHAAVASDAQGVFQILI--RTRATDLDARMYDGSTALILAARLAVEGMVEELITCHA----DVNAVDELGKSALHWAAAVNNVEATVALLKNGANKDMQDLKEETPLFLAAREGSCEAVKILLAHFANREITDHMDRLPRDIAQDRMHHDIVQLLDEY-NTVRSPQGH 2035          

HSP 2 Score: 601.282 bits (1549), Expect = 2.168e-175
Identity = 483/1510 (31.99%), Postives = 686/1510 (45.43%), Query Frame = 3
Query:  378 SIGAAILILLFCPIAISLNFCENHK-CKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNV----CQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELP-NSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVG-SYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKP--CKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDY--------------------------------------KCICQRGFEGKMCETSIDNCQKIS--CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVN--GFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKM-ECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIA--GNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLST------KCYNNGSCVNGFGKAICHCNKGSCGEKC-----EITGSACNLA-SIDNSQTYQDEISDCELNKCASKADNK--ICDLECNK--------------YAC----GFDGGECLHRVPKR----IDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCD--PQCNTEACL------------FDGWD---------CMDAIGQCPLQSFCDKHYADGQCQLECNTMECSFDGGDCIESRN 4559
            SI   + IL F   +  L   +  + C+NG  C         C C  GY G  C+    C  +PC NG  CK    N V    C C   + G+ C     CA+SPC NG  C +   H Y C CP  + G NC    + C     C +NG   +   G  +C C  GY+G TC      CA  +   C NGGTC  T   +Y+C C  GF G  CE ++ DC    C NGGTC+D + +Y C CP  + G  C      C ++P  C NGG C +    + C+C N WTG +C +  + C    C N   C       Y                                       C C  GF G  C   +D C   +  C + G C+N +   +C C  G+ G  CEI++NEC + PCQN+A C+D   ++TC C  G TG +CEI+IDEC  NPC+N   C D V  FTC C  GF G  C+   D C   TPC+    C++  N   GY+C C +G +   C+  +  C+   C +G CVD      C C+PG+ G  CE ++NEC +NPCQ+G +C DL N Y+C C  G  G  CEIN ++CA NPC   G C D +  + C C   ++GP C  +LD C+ N C N   C+  +  + +HC C      +    C   VDEC+                      PC++   C      + C+C   + G+ C+   N+C  NPC+N  TC +  +GF C+C  GF G +C++ INEC  +PC N   C+D +  + C+C++ +SG  C      C+ + C  H  C    +  G++C C   + G  C      C SNPC N+G+C N        GY+C+CR G++GP CE  ++ C  NPC   G C   +++F C C   + G RC I+  E C+S               CK+ G C +      + C+C+ G+ G  CE N  DC    C NGG C D    + C C+ GF G +CQ   NEC S  C N G C D + +F C CP+G +G  C+  VD+C+    CQNGG C+    D  C+C  G++G+ C+     C+      G  T+ + +  G C  TG         T +C C   +TG YCE+++D+CE      + PC N   C    +  VG    ++C C  GY G+ C+    +C+ + C+N G C    ID    + C CPPG  G+ CEI+  +    T      KC NNG+CV+  G   C+C  G  G++C     E   + CN A S+D  Q   D +  C+         N+  +C+ +  K              Y C    G+ G  C   +  R     +G   ++ S  + C   +    P     +N+ C   P  N   C+             +GW           ++      L + C     DG C  ECN+M C +DGGDC  + N
Sbjct:    5 SIWIFLSILCFVQNSEGLRCVDTFRPCENGGMCLDS-----RCMCRPGYIGPLCQHLDPCHRSPCLNGAACKSQVANGVPQFTCVCQRGFRGQNCSLIDACATSPCANGARCTNWNNH-YNCSCPPGFQGKNCRNDIDECRKPGKC-LNGGICINTHGSFRCECVSGYSGRTCEVPTQPCAPSQ---CLNGGTCHQTGDHTYECACLPGFGGTNCEVNVDDCPGHKCMNGGTCVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGGHTCVCVNGWTGDDCSENIDDCATAVCFNGATCHDRVASFYCECPVGKTGLLCHLDDACVSNPCNEGAVCDTNPLNGRAICTCPAGFIGGACIQDMDECSIGANPCEHFGKCVNTVGSFQCQCGRGYTGPRCEIDINECLSMPCQNDATCLDRIGEFTCICMPGYTGTHCEIDIDECESNPCVNDGICRDLVNAFTCTCQTGFTGTMCQIDIDECAS-TPCQNGAKCIDRPN---GYECRCAEGFEGRLCESNIDNCQPDPCHHGTCVDGIASYTCNCVPGYTGYRCENQLNECHSNPCQNGGKCVDLVNKYICQCQHGTSGTNCEINYDDCASNPCEY-GMCKDGINRYDCVCKPGFTGPQCNVELDECSSNPCRNGGTCV--DDENGFHCLCPAG---FHEPYCFSHVDECSSS--------------------PCVH-GACREDPDGYRCECEPGWVGKNCDLDRNDCLPNPCQNAGTCIDQLNGFTCKCRQGFRGNQCQVNINECASSPCLNQGTCVDGVASFTCLCEAPYSGPTCAEVLTPCSPNPCSNHAVCTHTPDYFGYQCNCQPGWQGHLCNIDVNECASNPCKNRGTCTN-----TLGGYVCSCRGGYSGPNCETDINDCLPNPCMSGGSCTDGINTFYCTCLPGFTGPRCAIEVDE-CQSAP-------------CKNGGTCTD--YVNSYTCTCKPGFTGLHCETNAMDCTESSCFNGGTCVDKINGFSCTCRVGFTGEHCQYEVNECDSQPCLNGGVCQDGLESFRCSCPKGYTGSRCQVRVDWCRHSNPCQNGGRCRPK--DGSCDCVGGWSGRYCDIPGVSCEMAAMQRGLQTDELCHRGGHCVNTGN--------THYCKCPNDYTGSYCESQVDHCE------DKPCLNGATC----RGYVG---GYTCDCMPGYEGQNCEREINECRSHPCQNGGTC----IDLVGHYICSCPPGTMGVLCEINEDDCATPTRPRGTPKCQNNGTCVDRVGGYRCNCPPGYTGDRCEGDINECHSNPCNAANSLDCIQLPNDYLCVCKPGFTGRGCQNRFGVCESQPCKNGGACSGAGSSPLGYICTCQLGYTGTNCERSMSCRELSCYNGGSCTVTSRGARCSCQQGFAGPQCQHRSNQSCSSKPCRNNGICIEEANFPFFSCQCMEGWKGKRCEQESRMLERPAPTCLIADCHGKANDGVCDKECNSMACRWDGGDCSLAAN 1425          
BLAST of Neurogenic locus notch protein vs. Ensembl Cavefish
Match: notch1b (neurogenic locus notch homolog protein 1-like [Source:NCBI gene;Acc:103025197])

HSP 1 Score: 973.77 bits (2516), Expect = 0.000e+0
Identity = 675/2010 (33.58%), Postives = 978/2010 (48.66%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFC-ESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYC--------KKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEI-------SDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIF-------SIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRK-AEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTT-DSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLI---TILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQHRPL 6341
            ++ C +H+C NG TC   +N  Y C+C   + G +C +  N C + P  CQNGGTC    G   C C+N W GE C  +  +CA + C  G  C    +  + C+CP    G+ C L ++C S NPC     C     +G+  C C  GY G+ C  D+DEC+    P CE+ G C+NT GS+QCKC+ G+ G RCE D+ +C ++ C+N  TCLD+IG + C+C   Y G  CE     C   PC N G C D   +YQC C   ++G  C    + C   PCKN   C +  N   Y C C  G+ G+ CET ID C    C  G  C + + G  C+C  G+ G  CE N+NEC + PCQN   C D  N Y C CP G +G NCEIN+D+C  NPC  G +C D++ G+ C C  G+ G  C    D C  + PC     C++  N   G+ C C DG  +  C+ +L++C +  CI+G C D  N   CIC  G+ G  C+I  NEC +NPC +G  C+D+ + Y+C C  GF G  C+ NINECA NPC   G CID+V G++C C+LPY+G  C   LDPCNP  C N+ +C     Y+S+ C C      ++G  CE D++EC  +                    PC N   C N+ GS+ C C S Y GR CE  +++C+ NPC NG  C +  D F C C+ GF G RCE +INEC  NPC N A C D +N Y C C  GFSG NCE N  DCTESSC   G CVD +N F C C   + G+ C+H    CDS PC+N G+C      Q++ G Y C C  G+ G  C+  ++WC+ +PC + G C     ++ C+C + + G  C++       S  V   +    + ++C++ G C +   T    C CQ+GY GS+CE  +D+C   PC NG  C D  G Y C+C PG+ GVNC    NEC S  C N G CID +N + C CPRG  G  CE  +D C        K+ +C N G C + +G + C CP G+ G+ CE D+NEC  N              PC P GT  C+     + C C+  +TG+ C+T  D C+        PC N G C        G    F C CP G+ G  C+ +++ C    CKN G C    +    + +C C P   G  C+      CLS  CYN G+C         HC   +     +  G  C++     +  +  +I       + CE+ +C +K  NK CD  CN + C +DGG+C            ++   PW NC    S+ + C  +FNN +CD QC++  CL+DG+DC  + G+C PL   +C  HYADG C   CN  EC +DG DC ++       G+++L+     E +    +  L+ L+ +LH+ +   +++ G+ MI+        +R   +  + DS          +  Q    G+ VYLE+DN  C   S  CF ++   A F+ A     +   P  +        P   +  P              + + +    L  F+        K+ R+  ++W+P+G K     TS+        S +KR + +         +G ++ +  S IS   D+ ++ G      T+   Y               E  ML    D+       +  + H+D  + R        ++A     G    +      R        ++        ET    +  + +    N  I     L ++   +GET LHLAA+Y R +AA+ LLEA +D N  +  GR+ L  A+ A A  V    +  +    DL  +  +G+T LI A + A   +++ L+        D+N  D++G++ALHWAA         +LL  G N+D Q+N+E TPL+LA +EG  E  K+L+ + AN +++DH+DRLPRD+A+      IV L+++Y  +        PL
Sbjct:  231 IDDCPDHRCLNGGTCVDGVN-TYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGWTGEDCSKNIDDCADAACNVGATCHD-RVASFFCECPPGRTGLLCHLNDACIS-NPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANP-CEHAGKCLNTKGSFQCKCQQGYVGPRCELDVNECLSNPCQNDATCLDQIGGFHCICMAGYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECPTGFSGNQCQFDNDECASTPCKNGAKCIDGPNM--YTCQCTEGYTGQHCETDIDECLSNPCHYG-LCKDSLAGFTCHCRAGYTGRLCEANINECLSHPCQNGGTCQDRENAYLCVCPRGTSGVNCEINLDDCQSNPCDFG-KCIDKINGYECACEPGYTGKLCSINIDECA-INPCHNGGTCIDGVN---GFMCQCRDGYHDPTCQSQLNECLSNPCIHGHCEDRVNGYNCICDSGWSGNNCDINNNECESNPCMNGGTCKDMTSGYVCSCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGENCETLLDPCNPKPCKNNGVCKESEDYESFSCVCPEG---WQGQTCEIDINECVKN--------------------PCRNGATCQNSIGSYRCSCKSGYTGRNCETDIDDCKPNPCSNGGFCKDGVDVFSCTCLPGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPPGFSGINCENNTPDCTESSCFNGGTCVDGINTFSCLCLAGFTGSYCQHDINECDSKPCMNGGTC------QDSYGTYKCTCPHGYRGFNCQELVNWCKPSPCKNGGTCRQSGTTYTCQCQTGWTGLYCDVPSV----SCEVAAKQQGVEVARLCRNSGLCLDAGNT--HYCQCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSSEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEINLDDCTPFTDPVTKEPKCFNQGRCVDRVGGYHCVCPPGYVGERCEGDVNECLSN--------------PCDPRGTHSCIQLTNNYRCECRTGYTGQRCDTVFDGCK------GKPCRNGGTCAVASNTPHG----FICKCPPGFTGSTCEYDAQACGSLQCKNGGTC----VSGHKNPRCLCSPSFTGPECQYPSDGPCLSNPCYNGGTCEPSTESPYFHCVCPA-----DFNGLLCHILDYGFTGGFGRDITPPPEVEASCEIPECEAKKGNKECDAACNSHECDWDGGDC-----------SLNFRDPWQNC----SDALQCWRYFNNGKCDEQCHSAGCLYDGFDCQRSGGECNPLYDQYCKDHYADGHCDQGCNNAECEWDGLDCADNVPEKRATGLLVLVVHLPPEQLRNNSSGFLRELSRVLHTNIVFRQDTQGELMIYPYYGSPHELRKHNKKRSLDSWSDVYGSGRRDQDQTQVVGSVVYLEIDNRQCYQQSAECFQSATDVAAFLGALASSGNLNLPYVMAVTSESEVPPTTELYP--------------LYVVLASVALLAFVAVGMVASRKRRREHGQLWFPDGFK-----TSE-------PSKKKRREPV-----GEDSVG-LKPLKNSDISLMDDNQNEWGEEEPVDTKRFRY--------------EEQAML----DLDDQQDHRQWTQQHLDAADLR------IPSVAPTPPQGEIENDCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDASANVINDFIYQGANLHNQTDRTGETALHLAARYARSDAAKRLLEASADANIQDNMGRTPLHAAVAADAQGVFQILIRNR--ATDLDARMHDGTTPLILAARLAVEGMVEELINCHA----DVNAIDDFGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLEHFANREITDHMDRLPRDIAQERMHHDIVRLMDEYNLVRSPPMHGAPL 2083          

HSP 2 Score: 613.224 bits (1580), Expect = 1.102e-179
Identity = 433/1245 (34.78%), Postives = 606/1245 (48.67%), Query Frame = 3
Query:  504 ECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNN----VCQCLNEWVGEFCEFSSN--CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDK-IGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCID--LNNDYTCDCPEGLTGKNCEINIDECT--PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCE--TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGN--------ATNLISNPHG----------------PCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIP----CFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEI 4100
             C   + G+ C+  + C   PC NGG C+ +  +N    VCQC   ++   C   ++  C SSPC NGG C+   +  Y+C+CP  + G NC+  + C S NPC   G+C    D    C C   ++G TC  D++ECA    P C NGG C+N VGSY+C C   + G+ CE     C+   C +GGTC+ K   SY C C   + G NCE     C    C NGG C D    Y C C  +WTG+ C +DV     +     NG         Y C+C  G+ G+ C  +ID+C   +C  G +C + +    C C PG          + C + PCQ  + C    +N    C CP G  G  C+ ++DEC+   NPC +  +C +  G F C+C QG+VG RCE   + C    PC+ +  CL   +   G+ CIC  G +   C+    +C ++ C+ NG+C+D  N  +C C  GF G  C+ + +EC + PC++G++C D  N Y C C  G+ G+ CE +I+EC  NPC   G C D + GF C C   Y+G  C   ++ C  + C N   C   ++ ++Y C C        G  CE ++D+C                    Q  PC +  +CI+    + C C   Y G+ C   ++ C  NPC NG TC +  +GF C+C  G+    C+ ++NEC  NPC +   C D +N Y CIC SG+SG NC+IN+N+C  + C+  G C D  +G+ C C   + G NC+     C SNPCLN+G+CI+     +  GY CNC   +TG  CE  +D C   PC + GVC+   D +SF C C   + G+ CEI   E               +   C++   C N    G ++CSC+SGY G  CE +IDDC   PC NGG C DG  ++ C C PGF+G+ C+ + NEC SN C  G  C D +N+++C CP G SG  CE     C +  C NGG C + I  F C C  GF G  C+ DINEC      N         T   + PHG                PC   GT  C     T+ C C+  +TG YC+     CE   K   +     C N+G+CL+             C C  GY G  C+    +C  N C+N   C     D    + CEC PG  G+ C  + +NECLS  C N G+C++      C C +G+ G  CEI
Sbjct:   20 RCPEKFWGSACQFSNPCLPNPCWNGGVCQPVIRDNKVDFVCQCHLGYMDPRCLTPTDNPCRSSPCGNGGTCELTSVRTYKCKCPPGWTGKNCQQADPCAS-NPCANGGQCS-PFDSHYICTCTPFFSGETCKQDVNECALSPFP-CNNGGVCVNEVGSYRCNCPTEYTGKHCETLYQPCSPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVNTYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGWTGEDCSKNIDDCADAACNVGATCHDRVASFFCECPPG-RTGLLCHLNDACISNPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTKGSFQCKCQQGYVGPRCELDVNECLS-NPCQNDATCL---DQIGGFHCICMAGYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECPTGFSGNQCQFDNDECASTPCKNGAKCIDGPNMYTCQCTEGYTGQHCETDIDECLSNPCHY-GLCKDSLAGFTCHCRAGYTGRLCEANINECLSHPCQNGGTCQ--DRENAYLCVCPRGT---SGVNCEINLDDC--------------------QSNPC-DFGKCIDKINGYECACEPGYTGKLCSINIDECAINPCHNGGTCIDGVNGFMCQCRDGYHDPTCQSQLNECLSNPCIH-GHCEDRVNGYNCICDSGWSGNNCDINNNECESNPCMNGGTCKDMTSGYVCSCRAGFSGPNCQTNINECASNPCLNQGTCID-----DVAGYKCNCLLPYTGENCETLLDPCNPKPCKNNGVCKESEDYESFSCVCPEGWQGQTCEIDINE--------------CVKNPCRNGATCQN--SIGSYRCSCKSGYTGRNCETDIDDCKPNPCSNGGFCKDGVDVFSCTCLPGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPPGFSGINCENNTPDCTESSCFNGGTCVDGINTFSCLCLAGFTGSYCQHDINECDSKPCMNGGTCQDSYGTYKCTCPHGYRGFNCQELVNWCKPSPCKNGGT--CRQSGTTYTCQCQTGWTGLYCDVPSVSCEVAAKQQGVEVARLCRNSGLCLDAGNTHY-------CQCQAGYTGSYCEEQVDECIPNPCQNGATC----TDYLGGYSCECVPGYHGVNCSSE-INECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEI 1193          

HSP 3 Score: 478.019 bits (1229), Expect = 9.301e-136
Identity = 359/1025 (35.02%), Postives = 496/1025 (48.39%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGT-------------------------------------CINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNN--DYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCT--------ESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKG--SCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDS---FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNID-DCASQPCINGGECGDGT--GMYFCKCQPGFQGVNCQV 3317
            + +N C ++ C+N ATC   I G + C C  GY+G +CE  ++ C   PC N G C     N  C+C   + G  C+F ++ CAS+PC+NG  C     + Y CQC + Y G +CE        NPC   G C  +  G   CHC  GYTG  C  +I+EC S+    C+NGGT                                     CI+ +  Y+C C+ G+ G+ C  +I +C  + C NGGTC+D +  + C C + Y    C+++   C   PC +G  C D    Y CIC + W+G NCD   N C+ NPC N G C+ +    Y C C+ GF G  C+T+I+ C    C N G+CI+ + G KCNCL  + G NCE  ++ C  KPC+NN  C +  +   ++C CPEG  G+ CEI+I+EC  NPC NGA C++ +G + C C  G+ G  CET  D CK   PC     C +  +    + C C  G +   C++++++C +  C NG  C D  N   C C PGF G  CE    +C  + C +G  C D  N + C+CL GF G  C+ +INEC   PC   G C D    ++C C   Y G  C   ++ C P+ C N   C       +Y C C T    + G  C+     C +   Q    G+ V  +       C N   C++   +  C+C + Y G  CE+ ++ C  NPC+NGATC +   G+ C CV G+ G  C  EINEC   PC N   CID +N Y+C C  G  G +CEIN +DCT        E  C   G+CVD+V G+ C C   Y+G  CE     C SNPC  +G  SCI     Q T  Y C CR G+TG RC+   D C+G PC + G C    ++   F CKC   + G  CE    + C S               CK+ G C +  +    +C C   + G  C+   D  C S PC NGG C   T    + C C   F G+ C +
Sbjct:  424 LDVNECLSNPCQNDATCLDQIGG-FHCICMAGYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECPTGFSGNQCQFDNDECASTPCKNGAKCID-GPNMYTCQCTEGYTGQHCETDIDECLSNPCHY-GLCKDSLAG-FTCHCRAGYTGRLCEANINECLSHP---CQNGGTCQDRENAYLCVCPRGTSGVNCEINLDDCQSNPCDFGKCIDKINGYECACEPGYTGKLCSINIDECAINPCHNGGTCIDGVNGFMCQCRDGYHDPTCQSQLNECLSNPCIHGH-CEDRVNGYNCICDSGWSGNNCDINNNECESNPCMNGGTCKDMT-SGYVCSCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGENCETLLDPCNPKPCKNNGVCKESEDYESFSCVCPEGWQGQTCEIDINECVKNPCRNGATCQNSIGSYRCSCKSGYTGRNCETDIDDCKP-NPCSNGGFCKDGVDV---FSCTCLPGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPPGFSGINCENNTPDCTESSCFNGGTCVDGINTFSCLCLAGFTGSYCQHDINECDSKPCMNGGTCQDSYGTYKCTCPHGYRGFNCQELVNWCKPSPCKNGGTCRQSGT--TYTCQCQTG---WTGLYCDVPSVSCEVAAKQ---QGVEVARL-------CRNSGLCLDAGNTHYCQCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSSEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEINLDDCTPFTDPVTKEPKCFNQGRCVDRVGGYHCVCPPGYVGERCEGDVNECLSNPCDPRGTHSCI-----QLTNNYRCECRTGYTGQRCDTVFDGCKGKPCRNGGTCAVASNTPHGFICKCPPGFTGSTCEY-DAQACGSLQ-------------CKNGGTCVSGHKNP--RCLCSPSFTGPECQYPSDGPCLSNPCYNGGTCEPSTESPYFHCVCPADFNGLLCHI 1399          

HSP 4 Score: 362.073 bits (928), Expect = 6.185e-100
Identity = 278/816 (34.07%), Postives = 383/816 (46.94%), Query Frame = 3
Query:  420 AISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCEL-PNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINT--VGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNP--------NACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPC--LNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATC---DNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEI-NDNDCTESSCLGHGQCVDKVNG--FECKCNENYIGTNCEHL 2801
            +I+++ C  + C NG TC   +NG ++C+C  GY    C+ + N C   PC +G     + G N C C + W G  C+ ++N C S+PC NGG CK +    Y C C   + G NC+   N C S NPC   G CI    G  KC+C   YTG  C   +D C       C+N G C  +    S+ C C  G+ G+ CE DI +C  + C+NG TC + IGSYRC C + Y G NCE     C+  PC NGG C+D  + + C C   + G  C +D+               + VN   Y C C  GF G  CE +  +C + SCFNGG+C++ I    C CL GF G+ C+ ++NEC++KPC N   C D    Y C CP G  G NC+  ++ C P+PC NG  C      +TCQC  G+ GL C+  S  C+     +  E+                            C+N    +G C+D  N   C C  G+ G  CE +++EC  NPCQ+G+ C D    Y C C+PG+ G  C   INEC   PC   G CID V  ++C C     G  C   LD C P          C+N   C+  ++   YHC C      Y G +CE DV+EC                +SN    PC     + CI    ++ C+C + Y G++C+   + C+  PCRNG TC    N   GF C+C  GFTG  CE +   C    C N   C+    + +C+C   F+G  C+  +D  C  + C   G C        F C C  ++ G  C  L
Sbjct:  649 SINIDECAINPCHNGGTCIDGVNG-FMCQCRDGYHDPTCQSQLNECLSNPCIHGHCEDRVNGYN-CICDSGWSGNNCDINNNECESNPCMNGGTCKDM-TSGYVCSCRAGFSGPNCQTNINECAS-NPCLNQGTCIDDVAG-YKCNCLLPYTGENCETLLDPCNPKP---CKNNGVCKESEDYESFSCVCPEGWQGQTCEIDINECVKNPCRNGATCQNSIGSYRCSCKSGYTGRNCETDIDDCKPNPCSNGGFCKDGVDVFSCTCLPGFRGLRCEEDINECDSNPCKNGANCTDCVN--SYTCTCPPGFSGINCENNTPDCTESSCFNGGTCVDGINTFSCLCLAGFTGSYCQHDINECDSKPCMNGGTCQDSYGTYKCTCPHGYRGFNCQELVNWCKPSPCKNGGTCRQSGTTYTCQCQTGWTGLYCDVPSVSCEVAAKQQGVEV-------------------------ARLCRN----SGLCLDAGNTHYCQCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSSEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEINLDDCTPFTDPVTKEPKCFNQGRCV--DRVGGYHCVCPPG---YVGERCEGDVNEC----------------LSN----PCDPRGTHSCIQLTNNYRCECRTGYTGQRCDTVFDGCKGKPCRNGGTCAVASNTPHGFICKCPPGFTGSTCEYDAQACGSLQCKNGGTCVSGHKNPRCLCSPSFTGPECQYPSDGPCLSNPCYNGGTCEPSTESPYFHCVCPADFNGLLCHIL 1400          

HSP 5 Score: 207.223 bits (526), Expect = 1.100e-52
Identity = 176/587 (29.98%), Postives = 238/587 (40.55%), Query Frame = 3
Query:  408 FCPIAISLNFCENHKCKNGATCQSDIN-----------------GKYVCECAYGYKGTYCEQKS-NCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNC-ELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYE-------TPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKIS--------CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPC--QNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC---EDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEIN-ECFNNPCQHGSQCQDLFND--YLCICLPGFKGKKCEI 2039
            FC   + +  C       G  C+ DIN                   Y C C  G+ G  CE  + +C  + C NGGTC        C CL  + G +C+   N C S PC NGG C+      Y+C CP  Y G NC EL N C   +PC   G C  +      C C  G+TG  C      C             LC N G C++   ++ C+C+AG+ G  CE  + +C  + C+NG TC D +G Y C C   Y G NC ++   C  +PC+NGG C D    Y+C                                        C RG +G  CE ++D+C   +        CFN G C++ + G  C C PG+ G  CE +VNEC + PC  +    CI L N+Y C+C  G TG+ C+   D C   PC NG  C    +   GF C+C  GF G  CE  +  C  L                                   +CKN     G CV  +   +C+C P F G  C+   +  C +NPC +G  C+       + C+C   F G  C I
Sbjct:  894 FCKDGVDVFSCTCLPGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPPGFSGINCENNTPDCTESSCFNGGTCVDGINTFSCLCLAGFTGSYCQHDINECDSKPCMNGGTCQD-SYGTYKCTCPHGYRGFNCQELVNWC-KPSPCKNGGTCRQSGT-TYTCQCQTGWTGLYCDVPSVSCEVAAKQQGVEVARLCRNSGLCLDAGNTHYCQCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSSEINECLSQPCQNGGTCIDLVNTYKC---------------------------------------SCPRGTQGVHCEINLDDCTPFTDPVTKEPKCFNQGRCVDRVGGYHCVCPPGYVGERCEGDVNECLSNPCDPRGTHSCIQLTNNYRCECRTGYTGQRCDTVFDGCKGKPCRNGGTCAVASNTPHGFICKCPPGFTGSTCEYDAQACGSL-----------------------------------QCKN----GGTCVSGHKNPRCLCSPSFTGPECQYPSDGPCLSNPCYNGGTCEPSTESPYFHCVCPADFNGLLCHI 1399          
BLAST of Neurogenic locus notch protein vs. Ensembl Cavefish
Match: notch1b (neurogenic locus notch homolog protein 1-like [Source:NCBI gene;Acc:103025197])

HSP 1 Score: 972.23 bits (2512), Expect = 0.000e+0
Identity = 675/2010 (33.58%), Postives = 978/2010 (48.66%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFC-ESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYC--------KKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEI-------SDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIF-------SIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRK-AEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTT-DSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLI---TILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQHRPL 6341
            ++ C +H+C NG TC   +N  Y C+C   + G +C +  N C + P  CQNGGTC    G   C C+N W GE C  +  +CA + C  G  C    +  + C+CP    G+ C L ++C S NPC     C     +G+  C C  GY G+ C  D+DEC+    P CE+ G C+NT GS+QCKC+ G+ G RCE D+ +C ++ C+N  TCLD+IG + C+C   Y G  CE     C   PC N G C D   +YQC C   ++G  C    + C   PCKN   C +  N   Y C C  G+ G+ CET ID C    C  G  C + + G  C+C  G+ G  CE N+NEC + PCQN   C D  N Y C CP G +G NCEIN+D+C  NPC  G +C D++ G+ C C  G+ G  C    D C  + PC     C++  N   G+ C C DG  +  C+ +L++C +  CI+G C D  N   CIC  G+ G  C+I  NEC +NPC +G  C+D+ + Y+C C  GF G  C+ NINECA NPC   G CID+V G++C C+LPY+G  C   LDPCNP  C N+ +C     Y+S+ C C      ++G  CE D++EC  +                    PC N   C N+ GS+ C C S Y GR CE  +++C+ NPC NG  C +  D F C C+ GF G RCE +INEC  NPC N A C D +N Y C C  GFSG NCE N  DCTESSC   G CVD +N F C C   + G+ C+H    CDS PC+N G+C      Q++ G Y C C  G+ G  C+  ++WC+ +PC + G C     ++ C+C + + G  C++       S  V   +    + ++C++ G C +   T    C CQ+GY GS+CE  +D+C   PC NG  C D  G Y C+C PG+ GVNC    NEC S  C N G CID +N + C CPRG  G  CE  +D C        K+ +C N G C + +G + C CP G+ G+ CE D+NEC  N              PC P GT  C+     + C C+  +TG+ C+T  D C+        PC N G C        G    F C CP G+ G  C+ +++ C    CKN G C    +    + +C C P   G  C+      CLS  CYN G+C         HC   +     +  G  C++     +  +  +I       + CE+ +C +K  NK CD  CN + C +DGG+C            ++   PW NC    S+ + C  +FNN +CD QC++  CL+DG+DC  + G+C PL   +C  HYADG C   CN  EC +DG DC ++       G+++L+     E +    +  L+ L+ +LH+ +   +++ G+ MI+        +R   +  + DS          +  Q    G+ VYLE+DN  C   S  CF ++   A F+ A     +   P  +        P   +  P              + + +    L  F+        K+ R+  ++W+P+G K     TS+        S +KR + +         +G ++ +  S IS   D+ ++ G      T+   Y               E  ML    D+       +  + H+D  + R        ++A     G    +      R        ++        ET    +  + +    N  I     L ++   +GET LHLAA+Y R +AA+ LLEA +D N  +  GR+ L  A+ A A  V    +  +    DL  +  +G+T LI A + A   +++ L+        D+N  D++G++ALHWAA         +LL  G N+D Q+N+E TPL+LA +EG  E  K+L+ + AN +++DH+DRLPRD+A+      IV L+++Y  +        PL
Sbjct:  257 IDDCPDHRCLNGGTCVDGVN-TYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGWTGEDCSKNIDDCADAACNVGATCHD-RVASFFCECPPGRTGLLCHLNDACIS-NPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANP-CEHAGKCLNTKGSFQCKCQQGYVGPRCELDVNECLSNPCQNDATCLDQIGGFHCICMAGYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECPTGFSGNQCQFDNDECASTPCKNGAKCIDGPNM--YTCQCTEGYTGQHCETDIDECLSNPCHYG-LCKDSLAGFTCHCRAGYTGRLCEANINECLSHPCQNGGTCQDRENAYLCVCPRGTSGVNCEINLDDCQSNPCDFG-KCIDKINGYECACEPGYTGKLCSINIDECA-INPCHNGGTCIDGVN---GFMCQCRDGYHDPTCQSQLNECLSNPCIHGHCEDRVNGYNCICDSGWSGNNCDINNNECESNPCMNGGTCKDMTSGYVCSCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGENCETLLDPCNPKPCKNNGVCKESEDYESFSCVCPEG---WQGQTCEIDINECVKN--------------------PCRNGATCQNSIGSYRCSCKSGYTGRNCETDIDDCKPNPCSNGGFCKDGVDVFSCTCLPGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPPGFSGINCENNTPDCTESSCFNGGTCVDGINTFSCLCLAGFTGSYCQHDINECDSKPCMNGGTC------QDSYGTYKCTCPHGYRGFNCQELVNWCKPSPCKNGGTCRQSGTTYTCQCQTGWTGLYCDVPSV----SCEVAAKQQGVEVARLCRNSGLCLDAGNT--HYCQCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSSEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEINLDDCTPFTDPVTKEPKCFNQGRCVDRVGGYHCVCPPGYVGERCEGDVNECLSN--------------PCDPRGTHSCIQLTNNYRCECRTGYTGQRCDTVFDGCK------GKPCRNGGTCAVASNTPHG----FICKCPPGFTGSTCEYDAQACGSLQCKNGGTC----VSGHKNPRCLCSPSFTGPECQYPSDGPCLSNPCYNGGTCEPSTESPYFHCVCPA-----DFNGLLCHILDYGFTGGFGRDITPPPEVEASCEIPECEAKKGNKECDAACNSHECDWDGGDC-----------SLNFRDPWQNC----SDALQCWRYFNNGKCDEQCHSAGCLYDGFDCQRSGGECNPLYDQYCKDHYADGHCDQGCNNAECEWDGLDCADNVPEKRATGLLVLVVHLPPEQLRNNSSGFLRELSRVLHTNIVFRQDTQGELMIYPYYGSPHELRKHNKKRSLDSWSDVYGSGRRDQDQTQVVGSVVYLEIDNRQCYQQSAECFQSATDVAAFLGALASSGNLNLPYVMAVTSESEVPPTTELYP--------------LYVVLASVALLAFVAVGMVASRKRRREHGQLWFPDGFK-----TSE-------PSKKKRREPV-----GEDSVG-LKPLKNSDISLMDDNQNEWGEEEPVDTKRFRY--------------EEQAML----DLDDQQDHRQWTQQHLDAADLR------IPSVAPTPPQGEIENDCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDASANVINDFIYQGANLHNQTDRTGETALHLAARYARSDAAKRLLEASADANIQDNMGRTPLHAAVAADAQGVFQILIRNR--ATDLDARMHDGTTPLILAARLAVEGMVEELINCHA----DVNAIDDFGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLEHFANREITDHMDRLPRDIAQERMHHDIVRLMDEYNLVRSPPMHGAPL 2109          

HSP 2 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 441/1266 (34.83%), Postives = 619/1266 (48.89%), Query Frame = 3
Query:  444 NHKCKNGATCQSDINGKY-VCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNN----VCQCLNEWVGEFCEFSSN--CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDK-IGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCID--LNNDYTCDCPEGLTGKNCEINIDECT--PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCE--TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGN--------ATNLISNPHG----------------PCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIP----CFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEI 4100
            + KC+NG TC    +G+   C+C   + G+ C+  + C   PC NGG C+ +  +N    VCQC   ++   C   ++  C SSPC NGG C+   +  Y+C+CP  + G NC+  + C S NPC   G+C    D    C C   ++G TC  D++ECA    P C NGG C+N VGSY+C C   + G+ CE     C+   C +GGTC+ K   SY C C   + G NCE     C    C NGG C D    Y C C  +WTG+ C +DV     +     NG         Y C+C  G+ G+ C  +ID+C   +C  G +C + +    C C PG          + C + PCQ  + C    +N    C CP G  G  C+ ++DEC+   NPC +  +C +  G F C+C QG+VG RCE   + C    PC+ +  CL   +   G+ CIC  G +   C+    +C ++ C+ NG+C+D  N  +C C  GF G  C+ + +EC + PC++G++C D  N Y C C  G+ G+ CE +I+EC  NPC   G C D + GF C C   Y+G  C   ++ C  + C N   C   ++ ++Y C C        G  CE ++D+C                    Q  PC +  +CI+    + C C   Y G+ C   ++ C  NPC NG TC +  +GF C+C  G+    C+ ++NEC  NPC +   C D +N Y CIC SG+SG NC+IN+N+C  + C+  G C D  +G+ C C   + G NC+     C SNPCLN+G+CI+     +  GY CNC   +TG  CE  +D C   PC + GVC+   D +SF C C   + G+ CEI   E               +   C++   C N    G ++CSC+SGY G  CE +IDDC   PC NGG C DG  ++ C C PGF+G+ C+ + NEC SN C  G  C D +N+++C CP G SG  CE     C +  C NGG C + I  F C C  GF G  C+ DINEC      N         T   + PHG                PC   GT  C     T+ C C+  +TG YC+     CE   K   +     C N+G+CL+             C C  GY G  C+    +C  N C+N   C     D    + CEC PG  G+ C  + +NECLS  C N G+C++      C C +G+ G  CEI
Sbjct:   25 SEKCQNGGTCVPTPDGRGGECKCPEKFWGSACQFSNPCLPNPCWNGGVCQPVIRDNKVDFVCQCHLGYMDPRCLTPTDNPCRSSPCGNGGTCELTSVRTYKCKCPPGWTGKNCQQADPCAS-NPCANGGQCS-PFDSHYICTCTPFFSGETCKQDVNECALSPFP-CNNGGVCVNEVGSYRCNCPTEYTGKHCETLYQPCSPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVNTYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGWTGEDCSKNIDDCADAACNVGATCHDRVASFFCECPPG-RTGLLCHLNDACISNPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTKGSFQCKCQQGYVGPRCELDVNECLS-NPCQNDATCL---DQIGGFHCICMAGYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECPTGFSGNQCQFDNDECASTPCKNGAKCIDGPNMYTCQCTEGYTGQHCETDIDECLSNPCHY-GLCKDSLAGFTCHCRAGYTGRLCEANINECLSHPCQNGGTCQ--DRENAYLCVCPRGT---SGVNCEINLDDC--------------------QSNPC-DFGKCIDKINGYECACEPGYTGKLCSINIDECAINPCHNGGTCIDGVNGFMCQCRDGYHDPTCQSQLNECLSNPCIH-GHCEDRVNGYNCICDSGWSGNNCDINNNECESNPCMNGGTCKDMTSGYVCSCRAGFSGPNCQTNINECASNPCLNQGTCID-----DVAGYKCNCLLPYTGENCETLLDPCNPKPCKNNGVCKESEDYESFSCVCPEGWQGQTCEIDINE--------------CVKNPCRNGATCQN--SIGSYRCSCKSGYTGRNCETDIDDCKPNPCSNGGFCKDGVDVFSCTCLPGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPPGFSGINCENNTPDCTESSCFNGGTCVDGINTFSCLCLAGFTGSYCQHDINECDSKPCMNGGTCQDSYGTYKCTCPHGYRGFNCQELVNWCKPSPCKNGGT--CRQSGTTYTCQCQTGWTGLYCDVPSVSCEVAAKQQGVEVARLCRNSGLCLDAGNTHY-------CQCQAGYTGSYCEEQVDECIPNPCQNGATC----TDYLGGYSCECVPGYHGVNCSSE-INECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEI 1219          
BLAST of Neurogenic locus notch protein vs. Ensembl Cavefish
Match: notch1b (neurogenic locus notch homolog protein 1-like [Source:NCBI gene;Acc:103025197])

HSP 1 Score: 972.23 bits (2512), Expect = 0.000e+0
Identity = 675/2010 (33.58%), Postives = 978/2010 (48.66%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITP--CQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL-ANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFC-ESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYC--------KKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEI-------SDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDPQCNTEACLFDGWDCMDAIGQC-PL-QSFCDKHYADGQCQLECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKLLQSLTHLLHSVVRIMRNSNGQQMIF-------SIRVFAENSNSDSSKSRQKRSLSNSVQQGKPGTKVYLEVDNNNCKTISKLCFDNSNSAAEFVTAALHYKSYRPPVPILSVQTYHHPGRKKPEPPNGXXXXXXXXXXXXXXXXXXXXXXXFMQNKSQTDDKKMRK-AEIWYPEGMKRLNQQTSQFNHKRLVNSNRKRNQNLLNCHNASSELGNIQQMTKSKISTT-DSVDDSGSNSLTSTRMTSYXXXXXXXXXXXVAVSENCMLLSNGDMHMNFPPEKRLKLHMDLIEPRNIEAWCFNTIANLLVSGNGLGEFSPTESRDKQIIVEKLLQIAVTNQDETNKFADLFNKNELSNNSLI---TILTSRVPYSGETLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGANPDMSDHLDRLPRDVAKMNNFDSIVALLEDYVNITKENQQHRPL 6341
            ++ C +H+C NG TC   +N  Y C+C   + G +C +  N C + P  CQNGGTC    G   C C+N W GE C  +  +CA + C  G  C    +  + C+CP    G+ C L ++C S NPC     C     +G+  C C  GY G+ C  D+DEC+    P CE+ G C+NT GS+QCKC+ G+ G RCE D+ +C ++ C+N  TCLD+IG + C+C   Y G  CE     C   PC N G C D   +YQC C   ++G  C    + C   PCKN   C +  N   Y C C  G+ G+ CET ID C    C  G  C + + G  C+C  G+ G  CE N+NEC + PCQN   C D  N Y C CP G +G NCEIN+D+C  NPC  G +C D++ G+ C C  G+ G  C    D C  + PC     C++  N   G+ C C DG  +  C+ +L++C +  CI+G C D  N   CIC  G+ G  C+I  NEC +NPC +G  C+D+ + Y+C C  GF G  C+ NINECA NPC   G CID+V G++C C+LPY+G  C   LDPCNP  C N+ +C     Y+S+ C C      ++G  CE D++EC  +                    PC N   C N+ GS+ C C S Y GR CE  +++C+ NPC NG  C +  D F C C+ GF G RCE +INEC  NPC N A C D +N Y C C  GFSG NCE N  DCTESSC   G CVD +N F C C   + G+ C+H    CDS PC+N G+C      Q++ G Y C C  G+ G  C+  ++WC+ +PC + G C     ++ C+C + + G  C++       S  V   +    + ++C++ G C +   T    C CQ+GY GS+CE  +D+C   PC NG  C D  G Y C+C PG+ GVNC    NEC S  C N G CID +N + C CPRG  G  CE  +D C        K+ +C N G C + +G + C CP G+ G+ CE D+NEC  N              PC P GT  C+     + C C+  +TG+ C+T  D C+        PC N G C        G    F C CP G+ G  C+ +++ C    CKN G C    +    + +C C P   G  C+      CLS  CYN G+C         HC   +     +  G  C++     +  +  +I       + CE+ +C +K  NK CD  CN + C +DGG+C            ++   PW NC    S+ + C  +FNN +CD QC++  CL+DG+DC  + G+C PL   +C  HYADG C   CN  EC +DG DC ++       G+++L+     E +    +  L+ L+ +LH+ +   +++ G+ MI+        +R   +  + DS          +  Q    G+ VYLE+DN  C   S  CF ++   A F+ A     +   P  +        P   +  P              + + +    L  F+        K+ R+  ++W+P+G K     TS+        S +KR + +         +G ++ +  S IS   D+ ++ G      T+   Y               E  ML    D+       +  + H+D  + R        ++A     G    +      R        ++        ET    +  + +    N  I     L ++   +GET LHLAA+Y R +AA+ LLEA +D N  +  GR+ L  A+ A A  V    +  +    DL  +  +G+T LI A + A   +++ L+        D+N  D++G++ALHWAA         +LL  G N+D Q+N+E TPL+LA +EG  E  K+L+ + AN +++DH+DRLPRD+A+      IV L+++Y  +        PL
Sbjct:  257 IDDCPDHRCLNGGTCVDGVN-TYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGWTGEDCSKNIDDCADAACNVGATCHD-RVASFFCECPPGRTGLLCHLNDACIS-NPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANP-CEHAGKCLNTKGSFQCKCQQGYVGPRCELDVNECLSNPCQNDATCLDQIGGFHCICMAGYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECPTGFSGNQCQFDNDECASTPCKNGAKCIDGPNM--YTCQCTEGYTGQHCETDIDECLSNPCHYG-LCKDSLAGFTCHCRAGYTGRLCEANINECLSHPCQNGGTCQDRENAYLCVCPRGTSGVNCEINLDDCQSNPCDFG-KCIDKINGYECACEPGYTGKLCSINIDECA-INPCHNGGTCIDGVN---GFMCQCRDGYHDPTCQSQLNECLSNPCIHGHCEDRVNGYNCICDSGWSGNNCDINNNECESNPCMNGGTCKDMTSGYVCSCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGENCETLLDPCNPKPCKNNGVCKESEDYESFSCVCPEG---WQGQTCEIDINECVKN--------------------PCRNGATCQNSIGSYRCSCKSGYTGRNCETDIDDCKPNPCSNGGFCKDGVDVFSCTCLPGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPPGFSGINCENNTPDCTESSCFNGGTCVDGINTFSCLCLAGFTGSYCQHDINECDSKPCMNGGTC------QDSYGTYKCTCPHGYRGFNCQELVNWCKPSPCKNGGTCRQSGTTYTCQCQTGWTGLYCDVPSV----SCEVAAKQQGVEVARLCRNSGLCLDAGNT--HYCQCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSSEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEINLDDCTPFTDPVTKEPKCFNQGRCVDRVGGYHCVCPPGYVGERCEGDVNECLSN--------------PCDPRGTHSCIQLTNNYRCECRTGYTGQRCDTVFDGCK------GKPCRNGGTCAVASNTPHG----FICKCPPGFTGSTCEYDAQACGSLQCKNGGTC----VSGHKNPRCLCSPSFTGPECQYPSDGPCLSNPCYNGGTCEPSTESPYFHCVCPA-----DFNGLLCHILDYGFTGGFGRDITPPPEVEASCEIPECEAKKGNKECDAACNSHECDWDGGDC-----------SLNFRDPWQNC----SDALQCWRYFNNGKCDEQCHSAGCLYDGFDCQRSGGECNPLYDQYCKDHYADGHCDQGCNNAECEWDGLDCADNVPEKRATGLLVLVVHLPPEQLRNNSSGFLRELSRVLHTNIVFRQDTQGELMIYPYYGSPHELRKHNKKRSLDSWSDVYGSGRRDQDQTQVVGSVVYLEIDNRQCYQQSAECFQSATDVAAFLGALASSGNLNLPYVMAVTSESEVPPTTELYP--------------LYVVLASVALLAFVAVGMVASRKRRREHGQLWFPDGFK-----TSE-------PSKKKRREPV-----GEDSVG-LKPLKNSDISLMDDNQNEWGEEEPVDTKRFRY--------------EEQAML----DLDDQQDHRQWTQQHLDAADLR------IPSVAPTPPQGEIENDCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDASANVINDFIYQGANLHNQTDRTGETALHLAARYARSDAAKRLLEASADANIQDNMGRTPLHAAVAADAQGVFQILIRNR--ATDLDARMHDGTTPLILAARLAVEGMVEELINCHA----DVNAIDDFGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLEHFANREITDHMDRLPRDIAQERMHHDIVRLMDEYNLVRSPPMHGAPL 2109          

HSP 2 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 441/1266 (34.83%), Postives = 619/1266 (48.89%), Query Frame = 3
Query:  444 NHKCKNGATCQSDINGKY-VCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNN----VCQCLNEWVGEFCEFSSN--CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDK-IGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNC-DDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCID--LNNDYTCDCPEGLTGKNCEINIDECT--PNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCE--TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGN--------ATNLISNPHG----------------PCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIP----CFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEI 4100
            + KC+NG TC    +G+   C+C   + G+ C+  + C   PC NGG C+ +  +N    VCQC   ++   C   ++  C SSPC NGG C+   +  Y+C+CP  + G NC+  + C S NPC   G+C    D    C C   ++G TC  D++ECA    P C NGG C+N VGSY+C C   + G+ CE     C+   C +GGTC+ K   SY C C   + G NCE     C    C NGG C D    Y C C  +WTG+ C +DV     +     NG         Y C+C  G+ G+ C  +ID+C   +C  G +C + +    C C PG          + C + PCQ  + C    +N    C CP G  G  C+ ++DEC+   NPC +  +C +  G F C+C QG+VG RCE   + C    PC+ +  CL   +   G+ CIC  G +   C+    +C ++ C+ NG+C+D  N  +C C  GF G  C+ + +EC + PC++G++C D  N Y C C  G+ G+ CE +I+EC  NPC   G C D + GF C C   Y+G  C   ++ C  + C N   C   ++ ++Y C C        G  CE ++D+C                    Q  PC +  +CI+    + C C   Y G+ C   ++ C  NPC NG TC +  +GF C+C  G+    C+ ++NEC  NPC +   C D +N Y CIC SG+SG NC+IN+N+C  + C+  G C D  +G+ C C   + G NC+     C SNPCLN+G+CI+     +  GY CNC   +TG  CE  +D C   PC + GVC+   D +SF C C   + G+ CEI   E               +   C++   C N    G ++CSC+SGY G  CE +IDDC   PC NGG C DG  ++ C C PGF+G+ C+ + NEC SN C  G  C D +N+++C CP G SG  CE     C +  C NGG C + I  F C C  GF G  C+ DINEC      N         T   + PHG                PC   GT  C     T+ C C+  +TG YC+     CE   K   +     C N+G+CL+             C C  GY G  C+    +C  N C+N   C     D    + CEC PG  G+ C  + +NECLS  C N G+C++      C C +G+ G  CEI
Sbjct:   25 SEKCQNGGTCVPTPDGRGGECKCPEKFWGSACQFSNPCLPNPCWNGGVCQPVIRDNKVDFVCQCHLGYMDPRCLTPTDNPCRSSPCGNGGTCELTSVRTYKCKCPPGWTGKNCQQADPCAS-NPCANGGQCS-PFDSHYICTCTPFFSGETCKQDVNECALSPFP-CNNGGVCVNEVGSYRCNCPTEYTGKHCETLYQPCSPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVNTYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGWTGEDCSKNIDDCADAACNVGATCHDRVASFFCECPPG-RTGLLCHLNDACISNPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTKGSFQCKCQQGYVGPRCELDVNECLS-NPCQNDATCL---DQIGGFHCICMAGYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECPTGFSGNQCQFDNDECASTPCKNGAKCIDGPNMYTCQCTEGYTGQHCETDIDECLSNPCHY-GLCKDSLAGFTCHCRAGYTGRLCEANINECLSHPCQNGGTCQ--DRENAYLCVCPRGT---SGVNCEINLDDC--------------------QSNPC-DFGKCIDKINGYECACEPGYTGKLCSINIDECAINPCHNGGTCIDGVNGFMCQCRDGYHDPTCQSQLNECLSNPCIH-GHCEDRVNGYNCICDSGWSGNNCDINNNECESNPCMNGGTCKDMTSGYVCSCRAGFSGPNCQTNINECASNPCLNQGTCID-----DVAGYKCNCLLPYTGENCETLLDPCNPKPCKNNGVCKESEDYESFSCVCPEGWQGQTCEIDINE--------------CVKNPCRNGATCQN--SIGSYRCSCKSGYTGRNCETDIDDCKPNPCSNGGFCKDGVDVFSCTCLPGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPPGFSGINCENNTPDCTESSCFNGGTCVDGINTFSCLCLAGFTGSYCQHDINECDSKPCMNGGTCQDSYGTYKCTCPHGYRGFNCQELVNWCKPSPCKNGGT--CRQSGTTYTCQCQTGWTGLYCDVPSVSCEVAAKQQGVEVARLCRNSGLCLDAGNTHY-------CQCQAGYTGSYCEEQVDECIPNPCQNGATC----TDYLGGYSCECVPGYHGVNCSSE-INECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEI 1219          
BLAST of Neurogenic locus notch protein vs. Ensembl Sea Lamprey
Match: JAG1 (jagged canonical Notch ligand 1 [Source:HGNC Symbol;Acc:HGNC:6188])

HSP 1 Score: 271.552 bits (693), Expect = 6.789e-75
Identity = 227/720 (31.53%), Postives = 327/720 (45.42%), Query Frame = 3
Query:  474 QSDINGKYVCE------CAYGYKG-----TYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSP-CRNGGICKSLEIHKYECQCPKNYLGMNCELP-NSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDL-NNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFN-NPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTC-ANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEI 2576
            + D  G Y C+      C  G+ G       C Q  +     C N G C        C+C   W G FC+    C   P C +GG  K      +EC+C  N+ G+ C+   N CG+  PC   G C  A     KC C KGY G  C  D  +  +     C NGG+ + +   Y+C C  G+ G  C  DI +C +  C NGGTCL+ +  +RC CP  + G  C      C+  PC +   C++    Y C C   WTG+NC D+        C N G C+ +   DY C C+ G+ G+ CET ++ C    C NGG C + I+   C C+ GF G++CE++V+ C   PCQN A+C++L N DY C C E   G NC +  D C  +PC     C   V   T +     V       S +C     C        ++     + C+C  G +   C + ++ C    C N G C+D  N  +C+C  G++G  CE ++++C N NPC +G  C DL ND+ C C  G+KGK C   I+ C    C   G+C D    FRC C   + GPTC   +   C PN C N A C+     DSY C C +    +EG+ C +D+++C+                      PC N   C++    + C+C++ + G    +  +          ATC +  +G+RC C  G  G  C  E+
Sbjct:   64 RDDYFGHYACDSNGNKVCLDGWTGGDCKKAICRQGCSTEHGQCDNPGECN-------CRCQYGWQGHFCD---QCIPYPGCVHGGCSK-----PWECRCDTNWGGLLCDKDLNYCGNHQPCRNGGSCSNAQPDSYKCDCQKGYHGVNCEIDYVQHITLNN-TCANGGSSVGSPSGYKCLCAPGWTGANCTEDIDECASSPCGNGGTCLNLVNGFRCTCPPQWTGHTCLVDTDECDDNPCVHARSCKNLFGGYYCGCLPGWTGQNC-DIDVNDCEGKCLNGGTCKDL-VNDYSCECKPGYTGRRCETEVNECASHPCLNGGQCRDAIDSYYCVCMDGFAGDSCELDVDLCVPNPCQNGARCVNLPNGDYFCHCSENFEGTNCTLLKDHCLTSPCQVIDSCTVAVPSNTSESGVAHV------TSTVCGPNGRC--------LSQAGGNFTCMCNSGFRGSFCHENVNDCAEGACHNGGTCLDGINSFQCMCPDGWDGEFCENDVDDCSNHNPCLNGGTCHDLVNDFSCECKNGWKGKTCHSKISHCDEATCNNGGECFDVGDTFRCSCPTGWEGPTCNIAQSIACMPNPCQNGATCVISG--DSYKCICQSG---WEGANCTQDINDCSSH--------------------PCYNGGTCVDGTNWYRCECAAGFAGEDINECQSMPCAKD----ATCIDEINGYRCMCPLGRAGRHCHDEV 722          

HSP 2 Score: 239.58 bits (610), Expect = 1.424e-64
Identity = 214/770 (27.79%), Postives = 335/770 (43.51%), Query Frame = 3
Query: 1077 RCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQC------ICGNQWTGKNCDDVXXXXXXXXXX-----------------XXGFCES-VNY---------QDYKCICQRGFEGKMCETSIDNC-QKISCFNGGSCIN-MIEGGKCNCLPGFXXX--XXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYG-FRCQCMLPYSGPTCANKLDPCNPNACY---NDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCIN-TNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQ-HNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKR-PCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGE 3248
            R +C  +YF TNC     LC+ +         D+   Y C      +C + WTG +C         +                       FC+  + Y         + ++C C   + G +C+  ++ C     C NGGSC N   +  KC+C  G+ G     +   +   N  C N    +   + Y C C  G TG NC  +IDEC  +PC NG  C + V GF C C   + G  C   +D C    PC     C N+     GY C C  G   QNC  +++ C+      G C D+ N+  C C PG+ GR CE E+NEC ++PC +G QC+D  + Y C+C+ GF G  CE++++ C  NPC    +C++   G + C C   + G  C    D C  + C    +  + +P N  +S                                     V  ++++  GP   + +C++   G+F C C+S + G  C + +N+C    C NG TC +  + F+C C  G+ GE CE ++++C  HNPC N   C D +ND+ C C++G+ GK C    + C E++C   G+C D  + F C C   + G  C   +   C  NPC N  +C+      +   Y C C+ G+ G  C   ++ C  +PC + G C    + ++C+C + + GE     ++  C        K+ + I++I              G++C C  G  G  C    D+  +QPC+  G 
Sbjct:   45 RVMCDEHYFSTNCTK---LCKPR--------DDYFGHYACDSNGNKVCLDGWTGGDCKKAICRQGCSTEHGQCDNPGECNCRCQYGWQGHFCDQCIPYPGCVHGGCSKPWECRCDTNWGGLLCDKDLNYCGNHQPCRNGGSCSNAQPDSYKCDCQKGYHGVNCEIDYVQHITLNNTCANGGSSVGSPSGYKCLCAPGWTGANCTEDIDECASSPCGNGGTCLNLVNGFRCTCPPQWTGHTCLVDTDECDD-NPCVHARSCKNL---FGGYYCGCLPGWTGQNCDIDVNDCEGKCLNGGTCKDLVNDYSCECKPGYTGRRCETEVNECASHPCLNGGQCRDAIDSYYCVCMDGFAGDSCELDVDLCVPNPCQNGARCVNLPNGDYFCHCSENFEGTNCTLLKDHCLTSPCQVIDSCTVAVPSNTSES------------------------------------GVAHVTSTVCGP---NGRCLSQAGGNFTCMCNSGFRGSFCHENVNDCAEGACHNGGTCLDGINSFQCMCPDGWDGEFCENDVDDCSNHNPCLNGGTCHDLVNDFSCECKNGWKGKTCHSKISHCDEATCNNGGECFDVGDTFRCSCPTGWEGPTCNIAQSIACMPNPCQNGATCV-----ISGDSYKCICQSGWEGANCTQDINDCSSHPCYNGGTCVDGTNWYRCECAAGFAGEDINECQSMPCA-------KDATCIDEI-------------NGYRCMCPLGRAGRHCH---DEVPTQPCVASGR 732          

HSP 3 Score: 230.72 bits (587), Expect = 1.044e-61
Identity = 223/787 (28.34%), Postives = 332/787 (42.19%), Query Frame = 3
Query: 1887 ICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPC-NPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLD-SFKCKCNSEYIGERCEIKK----TETCK-----SYAVEKFKNES----LINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNS--CNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICL---NKYQNE-----VGRNYN-------------------FSCICPNGYGGERCKIN-------------------SKKCQLNVCKNNGI-CRPFEIDDRMSFKCECPPGV------GGLFCEIDYVNECLSTKCYNNGSCV 4037
            +C+ G+ G  C+  I  C         QC D   +  C C  G++G  C+    +C   P  ++G C      + C+C   + G  C   L+ C N   C N   C    + DSY C+C      Y G  CE D               +  ++++N+    C N    + +   + C C+  + G  C + ++ C ++PC NG TC NL +GFRC C   +TG  C ++ +EC  NPC +   C +    Y C C  G++G+NC+I+ NDC E  CL  G C D VN + C+C   Y G  CE     C S+PCLN G C +         Y C C  GF G  CE+ +D C  NPC +   C    +  + C C+  + G  C + K    T  C+     + AV    +ES    + + +C  +G C +    G F C C SG+ GSFC  N++DCA   C NGG C DG   + C C  G+ G  C+ + ++C +++   N G C D +N+FSC C  G  G+ C + + +C +  C NGG C +V   F C+CP G+ G  C             N    I+    PC    T  C+    ++ C C+  + G  C   I+ C         PC+N G C+   N Y+ E      G + N                   + C+CP G  G  C                       ++C +  C N  I C      +++                 GL C       CL+  C+  G C+
Sbjct:   80 VCLDGWTGGDCKKAI--CRQGCSTEHGQC-DNPGECNCRCQYGWQGHFCD----QCIPYPGCVHGGCSKP---WECRCDTNWGGLLCDKDLNYCGNHQPCRNGGSC-SNAQPDSYKCDCQKG---YHGVNCEIDY--------------VQHITLNNT----CANGGSSVGSPSGYKCLCAPGWTGANCTEDIDECASSPCGNGGTCLNLVNGFRCTCPPQWTGHTCLVDTDECDDNPCVHARSCKNLFGGYYCGCLPGWTGQNCDIDVNDC-EGKCLNGGTCKDLVNDYSCECKPGYTGRRCETEVNECASHPCLNGGQCRDA-----IDSYYCVCMDGFAGDSCELDVDLCVPNPCQNGARCVNLPNGDYFCHCSENFEGTNCTLLKDHCLTSPCQVIDSCTVAVPSNTSESGVAHVTSTVCGPNGRCLSQ-AGGNFTCMCNSGFRGSFCHENVNDCAEGACHNGGTCLDGINSFQCMCPDGWDGEFCENDVDDCSNHNPCLNGGTCHDLVNDFSCECKNGWKGKTCHSKISHCDEATCNNGGECFDVGDTFRCSCPTGWEGPTC-------------NIAQSIACMPNPCQNGAT--CVISGDSYKCICQSGWEGANCTQDINDCSSH------PCYNGGTCVDGTNWYRCECAAGFAGEDINECQSMPCAKDATCIDEINGYRCMCPLGRAGRHCHDEVPTQPCVASGRNHSHGSSWKEECNMCHCSNGNINCTKVWCGNKLCLLSPAAASAERDGCPAGLSCHAMRHESCLAGSCFRQGECL 806          

HSP 4 Score: 197.978 bits (502), Expect = 2.536e-51
Identity = 140/403 (34.74%), Postives = 201/403 (49.88%), Query Frame = 3
Query:  429 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTC-KLIAGNNVCQCLNEWVGEFCE-FSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTN-DTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGAR 1625
            +N C +H C NG  C+  I+  Y C C  G+ G  CE   + C   PCQNG  C  L  G+  C C   + G  C     +C +SPC+         I       P N      E   +  +   CG NG+C+    G   C CN G+ G+ C  ++++CA      C NGGTC++ + S+QC C  G++GE CEND+ DC+N + C NGGTC D +  + C C N + G  C +K + C+   C NGG C D  + ++C C   W G  C+  ++   +     NG    ++   YKCICQ G+EG  C   I++C    C+NGG+C++     +C C  GF       ++NEC++ PC  +A CID  N Y C CP G  G++C    DE    PC+   R
Sbjct:  353 VNECASHPCLNGGQCRDAID-SYYCVCMDGFAGDSCELDVDLCVPNPCQNGARCVNLPNGDYFCHCSENFEGTNCTLLKDHCLTSPCQ--------VIDSCTVAVPSN----TSESGVAHVTSTVCGPNGRCLSQAGGNFTCMCNSGFRGSFCHENVNDCAE---GACHNGGTCLDGINSFQCMCPDGWDGEFCENDVDDCSNHNPCLNGGTCHDLVNDFSCECKNGWKGKTCHSKISHCDEATCNNGGECFDVGDTFRCSCPTGWEGPTCNIAQSIACMPNPCQNGATCVISGDSYKCICQSGWEGANCTQDINDCSSHPCYNGGTCVDGTNWYRCECAAGF----AGEDINECQSMPCAKDATCIDEINGYRCMCPLGRAGRHCH---DEVPTQPCVASGR 732          

HSP 5 Score: 191.815 bits (486), Expect = 2.257e-49
Identity = 167/558 (29.93%), Postives = 240/558 (43.01%), Query Frame = 3
Query: 2535 CVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPC-DSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIK--MDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYC----------------EKFRKSG-----NIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDN 4136
            C+ G+TG  C+  I  C+   CS +    D+  +  C CQ G+ G  C+     C       HG C      +EC+C+ N+ G  C+     C +  PC N GSC N + +     Y C+C++G+ G  CEI         N C + G        +KC C   + G  C  +  + C S               C + G C N     GF+C+C   + G  C V+ D+C   PC++   C +  G Y+C C PG+ G NC ++ N+C     N G C D +N++SC C  G +GR CET V+ C    C NGG C++ I  + C C  GFAG  CE D++ C  N   N    ++ P+               G + C C + F G  C    D+C                    +SG     +  C  NG CL++         NF+C+C +G+ G  C  N   C    C N G C    +D   SF+C CP G  G FCE D  +      C N G+C +      C C  G  G+ C    S C+ A+ +N
Sbjct:   81 CLDGWTGGDCKKAI--CRQG-CSTEHGQCDNPGECNCRCQYGWQGHFCD----QCIPYPGCVHGGCSKP---WECRCDTNWGGLLCDKDLNYCGNHQPCRNGGSCSNAQPDS----YKCDCQKGYHGVNCEIDYVQHITLNNTCANGGSSVGSPSGYKCLCAPGWTGANC-TEDIDECAS-------------SPCGNGGTCLN--LVNGFRCTCPPQWTGHTCLVDTDECDDNPCVHARSCKNLFGGYYCGCLPGWTGQNCDIDVNDCEGKCLNGGTCKDLVNDYSCECKPGYTGRRCETEVNECASHPCLNGGQCRDAIDSYYCVCMDGFAGDSCELDVDLCVPNPCQNGARCVNLPN---------------GDYFCHCSENFEGTNCTLLKDHCLTSPCQVIDSCTVAVPSNTSESGVAHVTSTVCGPNGRCLSQAGG------NFTCMCNSGFRGSFCHENVNDCAEGACHNGGTC----LDGINSFQCMCPDGWDGEFCENDVDDCSNHNPCLNGGTCHDLVNDFSCECKNGWKGKTCHSKISHCDEATCNN 583          
BLAST of Neurogenic locus notch protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000962.1 (pep scaffold:Pmarinus_7.0:GL477031:38805:53470:-1 gene:ENSPMAG00000000874.1 transcript:ENSPMAT00000000962.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 245.358 bits (625), Expect = 1.605e-67
Identity = 185/601 (30.78%), Postives = 271/601 (45.09%), Query Frame = 3
Query:  429 LNFCENH-KCKNGATCQSDINGKYVCECAYGYKGTY----CEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCEL-----------PNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXX-----------------------------GFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQ 2084
            LN+C  H  C+NG TC +    +Y         G         +  C   PC N G+C        C C   W G  C +   +CAS PC NGG C+   ++ +EC+CP  ++G  C+L           P  C S+  C V           + C  ++ +  +     I++C       C+NGGTC + V  Y C C  G+ G  C+ ++ +C +  C N G C D++ S+RC+CP  + G  C+     CE  PC+NG  C + + DY C C   + GKNC  +++ C+ +                                  G C S     + C C  GF G  C  +I++C    C NGG+CI+ ++  +C C  G+EG+ CEI+ N+C    CQN  +C DL ND+ C+C  G  GK C     +C    C NGA C DR   F C C  G+ G  C    +     +PC     C+   ++   + C+C +G +   C +  + C    C N G CVD  N  +C C PGF G  C I +NEC +NPC  G+ C D  N + C+C  G  G +C+    +    PC  NG+
Sbjct:   46 LNYCGTHTPCRNGGTCANTEPDEYTRRSPLSPVGLREIPSHTAEHACLSDPCANDGSCHETPSGFECVCALGWTGLTCAYDIDDCASDPCGNGGTCRD-RLNDFECRCPPQWMGRTCQLGTHAKVREERVPAPCESRRICKVP-----RAQAYLPCRPSRPWQLHQLPPHINDCHGQ----CQNGGTCTDLVNGYHCTCPPGYTGRGCQQEVDECVSSPCLNNGQCQDQLNSFRCLCPAGFSGHLCQLDVDYCEPNPCQNGAPCFNLNMDYFCSCSEDYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQGGGKFTCSCDEGFTGTYCHENINDCTVNPCKNGGTCIDGVKSYQCICHEGWEGDVCEIDTNDCSPNLCQNRGRCRDLVNDFYCECRNGWKGKTCHSRERQCDEATCNNGATCYDRGDSFACLCPMGWEGATCSIVRNSSCASSPCMNTATCVGSGDS---FTCVCKEGWEGPTCSENTNDCNPHPCYNGGTCVDGENWYRCDCAPGFAGPDCRINVNECQSNPCAFGATCVDEINGFRCLCPHGRSGFRCQ----DVYAKPCPWNGK 629          

HSP 2 Score: 239.58 bits (610), Expect = 1.281e-65
Identity = 210/660 (31.82%), Postives = 294/660 (44.55%), Query Frame = 3
Query:  504 ECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNC--ASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQ----NPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCE---------------------------------------------NDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKIS-----------------------------CFNGGSCINMIEGGK--CNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKEL---SKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCAN-KLDPCNPNACYNDAICIPGNKYD 2222
             C YG++G YC+Q   C   P    GTC        C C   W G  C+   N     +PCRNGG C + E  +Y  + P + +G+  E+P+         +PC  +G C     G  +C C  G+TG TC+ DID+CAS     C NGGTC + +  ++C+C   + G  C+                                               I DC +  C+NGGTC D +  Y C CP  Y G  C+ +   C   PC N G C+D    ++C+C   ++G  C    + C+ NPC+N   C ++N  DY C C   +EGK C    D+C+  +                             C   G C++   GGK  C+C  GF G  C  N+N+C   PC+N   CID    Y C C EG  G  CEI+ ++C+PN C N  RC D V  F C+C  G+ G  C ++   C + T C     C +  ++   + C+CP G +     +   S C +  C+N   CV   +   C+C  G+EG TC    N+C  +PC +G  C D  N Y C C PGF G  C IN+NEC  NPC     C+DE+ GFRC C    SG  C +    PC     +N  +   G K++
Sbjct:    1 RCQYGWQGAYCDQ---CTPYPGCVRGTCHEPW---QCSCETNWGGLLCDKDLNYCGTHTPCRNGGTCANTEPDEYTRRSPLSPVGLR-EIPSHTAEHACLSDPCANDGSCHETPSG-FECVCALGWTGLTCAYDIDDCASDP---CGNGGTCRDRLNDFECRCPPQWMGRTCQLGTHAKVREERVPAPCESRRICKVPRAQAYLPCRPSRPWQLHQLPPHINDC-HGQCQNGGTCTDLVNGYHCTCPPGYTGRGCQQEVDECVSSPCLNNGQCQDQLNSFRCLCPAGFSGHLCQLDVDYCEPNPCQNGAPCFNLN-MDYFCSCSEDYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQ-GGGKFTCSCDEGFTGTYCHENINDCTVNPCKNGGTCIDGVKSYQCICHEGWEGDVCEIDTNDCSPNLCQNRGRCRDLVNDFYCECRNGWKGKTCHSRERQCDEAT-CNNGATCYDRGDS---FACLCPMGWEGATCSIVRNSSCASSPCMNTATCVGSGDSFTCVCKEGWEGPTCSENTNDCNPHPCYNGGTCVDGENWYRCDCAPGFAGPDCRINVNECQSNPCAFGATCVDEINGFRCLCPHGRSGFRCQDVYAKPCP----WNGKLYASGAKWE 638          

HSP 3 Score: 232.261 bits (591), Expect = 3.446e-63
Identity = 177/623 (28.41%), Postives = 281/623 (45.10%), Query Frame = 3
Query: 1296 YQDYKCICQRGFEGKMCETSIDNC-QKISCFNGGSCINMIEGGKCNCLP----GFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCE--TKSDICKQLT--PCKTEEICLNVNNTRSGYKCIC--PDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCN----PNACYND-AICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDE--CNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDN-DCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETC----KSYAV-EKFKNE 3092
            ++ ++C C+  + G +C+  ++ C     C NGG+C N          P    G          + C + PC N+  C +  + + C C  G TG  C  +ID+C  +PC NG  C DR+  F C+C   ++G  C+  T + + ++    PC++  IC  V   ++   C    P  +      ++ C       G C D+ N   C C PG+ GR C+ E++EC ++PC +  QCQD  N + C+C  GF G  C+++++ C  NPC     C +    + C C   Y G  C+   D C     P A  +   + +  N   S     S+ +    G    +   +  C+ D      Y     ++++  + PC N   CI+   S+ C C   +EG  CE   N+C  N C+N   C +L + F C C  G+ G+ C     +C    C+N A C D  + + C+C  G+ G  C I  N  C  S C+    CV   + F C C E + G  C      C+ +PC N G+C++ +       Y C+C  GF GP C I ++ C+ NPC     C  +++ F+C C     G RC+    + C    K YA   K+++E
Sbjct:   26 HEPWQCSCETNWGGLLCDKDLNYCGTHTPCRNGGTCANTEPDEYTRRSPLSPVGLREIPSHTAEHACLSDPCANDGSCHETPSGFECVCALGWTGLTCAYDIDDCASDPCGNGGTCRDRLNDFECRCPPQWMGRTCQLGTHAKVREERVPAPCESRRIC-KVPRAQAYLPCRPSRPWQLHQLPPHINDCHGQCQNGGTCTDLVNGYHCTCPPGYTGRGCQQEVDECVSSPCLNNGQCQDQLNSFRCLCPAGFSGHLCQLDVDYCEPNPCQNGAPCFNLNMDYFCSCSEDYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQGGGKFTCSCDEGFTGTY--CHENINDCTVNPCKNGGTCIDGVKSYQCICHEGWEGDVCEIDTNDCSPNLCQNRGRCRDLVNDFYCECRNGWKGKTCHSRERQCDEATCNNGATCYDRGDSFACLCPMGWEGATCSIVRNSSCASSPCMNTATCVGSGDSFTCVCKEGWEGPTCSENTNDCNPHPCYNGGTCVDGEN-----WYRCDCAPGFAGPDCRINVNECQSNPCAFGATCVDEINGFRCLCPHGRSGFRCQDVYAKPCPWNGKLYASGAKWEDE 640          

HSP 4 Score: 224.557 bits (571), Expect = 1.324e-60
Identity = 188/630 (29.84%), Postives = 259/630 (41.11%), Query Frame = 3
Query: 1491 PCQNNAKCIDLNND-YTCDCP---EGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCIC--------IPGFEGRTCEIE-----INECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFIC----KCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEI-KMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQ 3314
            PC+N   C +   D YT   P    GL           C  +PC N   C +   GF C C  G+ GL C    D C    PC     C +  N    ++C CP        +L     +     + V    E + IC        +P    R  ++      IN+C    CQ+G  C DL N Y C C PG+ G+ C+  ++EC  +PC  NGQC D++  FRC C   +SG  C   +D C PN C N A C   N    Y C+CS     YEG  C +  D C       A+     ++++++           +    S +C    +C SQ  G+                          F C C  GFTG  C   IN+C  NPC N   CID +  YQCIC  G+ G  CEI+ NDC+ + C   G+C D VN F C+C   + G  C   +R CD   C N  +C +R  +     + C C  G+ G  C I +   C  +PC +   C    DSF C C   + G  C  + T  C  +              C + G C +      ++C C  G+ G  C +N+++C S PC  G  C D    + C C  G  G  CQ
Sbjct:   54 PCRNGGTCANTEPDEYTRRSPLSPVGLREIPSHTAEHACLSDPCANDGSCHETPSGFECVCALGWTGLTCAYDIDDCAS-DPCGNGGTCRDRLND---FECRCPPQWMGRTCQLGTHAKV---REERVPAPCESRRICKVPRAQAYLPCRPSRPWQLHQLPPHINDCHGQ-CQNGGTCTDLVNGYHCTCPPGYTGRGCQQEVDECVSSPCLNNGQCQDQLNSFRCLCPAGFSGHLCQLDVDYCEPNPCQNGAPCF--NLNMDYFCSCSE---DYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNST------QSGMRYISSGVCGPHGRCVSQGGGK--------------------------FTCSCDEGFTGTYCHENINDCTVNPCKNGGTCIDGVKSYQCICHEGWEGDVCEIDTNDCSPNLCQNRGRCRDLVNDFYCECRNGWKGKTCHSRERQCDEATCNNGATCYDRGDS-----FACLCPMGWEGATCSIVRNSSCASSPCMNTATCVGSGDSFTCVCKEGWEGPTCS-ENTNDCNPHP-------------CYNGGTCVDG--ENWYRCDCAPGFAGPDCRINVNECQSNPCAFGATCVDEINGFRCLCPHGRSGFRCQ 617          

HSP 5 Score: 200.29 bits (508), Expect = 1.064e-52
Identity = 182/643 (28.30%), Postives = 265/643 (41.21%), Query Frame = 3
Query: 2532 RCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDC-TESSCLGHGQCVD-KVNGFECKCNENYIGTN---CEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLC-------------ETDINECKYNIAGNATNL--------ISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEID---------------------------------DRM-SFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQD--EISDCELNKCASKADNKICDLECNKYACGFDGGECLHRV 4271
            RC  G+ G  C+    +C   P      C +    +QC C++ + G  C+ + N C T + C   G C + + + +  +   + +G         +  C S+PC N GSC     ++   G+ C C  G+TG  C   +D C  +PCG+ G C   L+ F+C+C  +++G  C++      +   V        I K+ +               C     +       +I+DC  Q C NGG C D    Y C C PG+ G  CQ   +EC S+ C N G+C DQ+N+F C+CP G SG  C+  VDYC+   CQNG  C N+  D+ C+C + + GK C                I+ C   +A N+T          +  PHG C   G        G F CSC + FTG YC   I+ C         PC N G C++  ++       + CIC  G+ G+ C+I++  C  N+C+N G CR    D                                 DR  SF C CP G  G  C I   + C S+ C N  +CV       C C +G  G  C    + CN     N  T  D      C+     +  D +I   EC    C F G  C+  +
Sbjct:    1 RCQYGWQGAYCD----QCTPYPGCVRGTCHE---PWQCSCETNWGGLLCDKDLNYCGTHTPCRNGGTCANTEPDEYTRRSPLSPVGLREIPSHTAEHACLSDPCANDGSC-----HETPSGFECVCALGWTGLTCAYDIDDCASDPCGNGGTCRDRLNDFECRCPPQWMGRTCQLGTHAKVREERVPAPCESRRICKVPRAQAY---------LPCRPSRPWQLHQLPPHINDCHGQ-CQNGGTCTDLVNGYHCTCPPGYTGRGCQQEVDECVSSPCLNNGQCQDQLNSFRCLCPAGFSGHLCQLDVDYCEPNPCQNGAPCFNLNMDYFCSCSEDYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQGG-------GKFTCSCDEGFTGTYCHENINDCTVN------PCKNGGTCIDGVKS-------YQCICHEGWEGDVCEIDTNDCSPNLCQNRGRCRDLVNDFYCECRNGWKGKTCHSRERQCDEATCNNGATCYDRGDSFACLCPMGWEGATCSIVRNSSCASSPCMNTATCVGSGDSFTCVCKEGWEGPTCSENTNDCNPHPCYNGGTCVDGENWYRCDCAPGFAGPDCRINVNECQSNPCAF-GATCVDEI 600          

HSP 6 Score: 196.823 bits (499), Expect = 1.365e-51
Identity = 191/732 (26.09%), Postives = 278/732 (37.98%), Query Frame = 3
Query: 2199 CIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCS--SQYEGRQCEKXXXXXXXXXX--XXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEIND---------------------------------------------NDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVC-ETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNES----------------LINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINE-CKYNIAGNATNLIS-------------------------NPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCK-INSKKCQLN----------------------------------VCKNNGICRPFEIDDR--MSFKCECPPGVGGLFCEIDYVNECL 4004
            C+ G  ++ + C+C T  G   G  C+KD++ C                       PC N   C NT      + S  S    R+                N  +C     GF C C  G+TG  C  +I++C  +PC N   C D +ND++C C   + G+ C++                                               NDC    C   G C D VNG+ C C   Y G  C+     C S+PCLN G C + ++N     + C C  GF+G  C++ +D+C  NPC +   C   ++D F C C+ +Y G+ C  +  + C++    +   +S                + + +C  HG C +    G F CSC  G+ G++C  NI+DC   PC NGG C DG   Y C C  G++G  C+++TN+C  N C N G+C D +N+F C C  G  G+ C +    C +  C NG  C +    F C CP G+ G  C    N  C  +   N    +                          NPH PC   GT  C+D    + C C   F G  C   ++ C+      + PC     C+++          F C+CP+G  G RC+ + +K C  N                                  +C  +G   P     R     KC   P    L    DY  ECL
Sbjct:   20 CVRGTCHEPWQCSCETNWG---GLLCDKDLNYCGTHT-------------------PCRNGGTCANTEPDEYTRRSPLSPVGLREIPSHTAEHACLSDPCANDGSCHETPSGFECVCALGWTGLTCAYDIDDCASDPCGNGGTCRDRLNDFECRCPPQWMGRTCQLGTHAKVREERVPAPCESRRICKVPRAQAYLPCRPSRPWQLHQLPPHINDC-HGQCQNGGTCTDLVNGYHCTCPPGYTGRGCQQEVDECVSSPCLNNGQCQD-QLNS----FRCLCPAGFSGHLCQLDVDYCEPNPCQNGAPCFNLNMDYF-CSCSEDYEGKNCS-RLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQ-GGGKFTCSCDEGFTGTYCHENINDCTVNPCKNGGTCIDGVKSYQCICHEGWEGDVCEIDTNDCSPNLCQNRGRCRDLVNDFYCECRNGWKGKTCHSRERQCDEATCNNGATCYDRGDSFACLCPMGWEGATCSIVRNSSCASSPCMNTATCVGSGDSFTCVCKEGWEGPTCSENTNDCNPH-PCYNGGT--CVDGENWYRCDCAPGFAGPDCRINVNECQ------SNPCAFGATCVDEING-------FRCLCPHGRSGFRCQDVYAKPCPWNGKLYASGAKWEDECNLCQCLNGRTNCTKLWCGGTLCLTSGKVVPGPDAHRCPTGQKCMATPASACLAAPCDYWGECL 704          

HSP 7 Score: 193.741 bits (491), Expect = 1.345e-50
Identity = 148/441 (33.56%), Postives = 220/441 (49.89%), Query Frame = 3
Query:  450 KCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCE--------------LPNSCG---------------SQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCE-INIDECTPNPCL--NGARCEDRVGGFTCQCLQG 1670
            +C+NG TC   +NG Y C C  GY G  C+Q+ + C  +PC N G C+    +  C C   + G  C+   + C  +PC+NG  C +L +  Y C C ++Y G NC               + +SC                S   CG +G+C+    G+  C C++G+TG  C  +I++C       C+NGGTCI+ V SYQC C  G+ G+ CE D  DC+ + C+N G C D +  + C C N + G  C ++   C+   C NG  C D  + + C+C   W G  C  V+N    +    N      +   + C+C+ G+EG  C  + ++C    C+NGG+C++     +C+C PGF G +C INVNEC++ PC   A C+D  N + C CP G +G  C+ +    C  N  L  +GA+ ED      CQCL G
Sbjct:  216 QCQNGGTCTDLVNG-YHCTCPPGYTGRGCQQEVDECVSSPCLNNGQCQDQLNSFRCLCPAGFSGHLCQLDVDYCEPNPCQNGAPCFNLNM-DYFCSCSEDYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQGGGKFTCSCDEGFTGTYCHENINDCTVNP---CKNGGTCIDGVKSYQCICHEGWEGDVCEIDTNDCSPNLCQNRGRCRDLVNDFYCECRNGWKGKTCHSRERQCDEATCNNGATCYDRGDSFACLCPMGWEGATCSIVRNSSCASSPCMNTATCVGSGDSFTCVCKEGWEGPTCSENTNDCNPHPCYNGGTCVDGENWYRCDCAPGFAGPDCRINVNECQSNPCAFGATCVDEINGFRCLCPHGRSGFRCQDVYAKPCPWNGKLYASGAKWEDECN--LCQCLNG 649          

HSP 8 Score: 187.578 bits (475), Expect = 1.434e-48
Identity = 180/638 (28.21%), Postives = 249/638 (39.03%), Query Frame = 3
Query:  420 AISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNC-----------------------------PITP----------------CQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETP--------------------------LCENGGTCINT-VGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSID-NCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAH---NPCGLNGQCIDEVY 2102
            A  ++ C +  C NG TC+  +N  + C C   + G  C+  ++                              P  P                CQNGGTC  +     C C   + G  C+   + C SSPC N G C+  +++ + C CP  + G  C+L       NPC     C   N  +  C C++ Y G  CS   D C +   P                          +C   G C++   G + C C  GF G  C  +I DCT + CKNGGTC+D + SY+C+C   + G  CE     C    C+N G CRD   D+ C C N W GK C   +  C    C N   C       + C+C  G+EG  C    + +C    C N  +C+   +   C C  G+EG  C  N N+C   PC N   C+D  N Y CDC  G  G +C IN++EC  NPC  GA C D + GF C C  G  G RC+   D+  +  P   +              C C +G  NC K    C   +C+    V          +PG +   C     +C   P    S C     DY   CLP  +  + +   N   H    PC      +D  +
Sbjct:  124 AYDIDDCASDPCGNGGTCRDRLN-DFECRCPPQWMGRTCQLGTHAKVREERVPAPCESRRICKVPRAQAYLPCRPSRPWQLHQLPPHINDCHGQCQNGGTCTDLVNGYHCTCPPGYTGRGCQQEVDECVSSPCLNNGQCQD-QLNSFRCLCPAGFSGHLCQLDVDYCEPNPCQNGAPCFNLN-MDYFCSCSEDYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQGGGKFTCSCDEGFTGTYCHENINDCTVNPCKNGGTCIDGVKSYQCICHEGWEGDVCEIDTNDCSPNLCQNRGRCRDLVNDFYCECRNGWKGKTCHSRERQCDEATCNNGATCYDRG-DSFACLCPMGWEGATCSIVRNSSCASSPCMNTATCVGSGDSFTCVCKEGWEGPTCSENTNDCNPHPCYNGGTCVDGENWYRCDCAPGFAGPDCRINVNECQSNPCAFGATCVDEINGFRCLCPHGRSGFRCQ---DVYAKPCPWNGKLYASGAKWEDECNLCQCLNGRTNCTKLW--CGGTLCLTSGKV----------VPGPDAHRCPTG-QKCMATP---ASACLAAPCDYWGECLPRPEPTRVKCRPNHPGHADTEPCARLALTLDPFH 738          
BLAST of Neurogenic locus notch protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002643.1 (pep scaffold:Pmarinus_7.0:GL478752:33855:40482:1 gene:ENSPMAG00000002413.1 transcript:ENSPMAT00000002643.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.045 bits (484), Expect = 7.282e-54
Identity = 131/344 (38.08%), Postives = 170/344 (49.42%), Query Frame = 3
Query:  663 CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCIC-GNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEG---GKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGL 1682
            CAS PC +GG C       + C+C   Y G NCE      +  PC +N    +   G  KC+C  G+ G  C  DI+ECAS     C +GGTC N    Y C C  GF GERC+ D  +C +  C NG TC+D  G + CVCP  Y G  CE +   CE  PC+NGG+C D  + Y C C    + GK+C+     C  NPC++N  C      ++ CIC  GF G  CE  ++ C    C NGG CI + +    GK + LPG                            + +TC C  G TG+NC +N+DEC   PCLNG  C D +G F+C+C  GF GL
Sbjct:    1 CASGPCLHGGTCLPAADGGFSCRCAPGYSGDNCEASVGGCASGPC-LNDAVCVDEPGGYKCYCVPGFQGRHCEIDINECASEP---CLHGGTCTNGRDRYSCACPDGFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECESGPCQNGGVCIDLVDSYTCDCLETGYEGKDCELEILECASNPCRHNSTCIE-GILNFTCICWPGFAGDACEEDVNECGDEPCMNGGQCIELSKPDFYGKLSELPGTFHYANA---------------------SGFTCRCLPGTTGENCSVNLDECESQPCLNGGSCIDNIGSFSCECAPGFTGL 318          

HSP 2 Score: 177.178 bits (448), Expect = 5.127e-49
Identity = 114/321 (35.51%), Postives = 156/321 (48.60%), Query Frame = 3
Query: 2364 GPCLNDNQCI-NTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNC-RRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVE-----KFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGV 3305
            GPCL+   C+   +G F C+C+  Y G  CE  +  C + PC N A C +   G++C CV GF G  CEI+INEC   PC +   C +  + Y C C  GF+G+ C+++ N+C    C     CVD    FEC C   Y G  CE     C+S PC N G CI+         Y C+C   G+ G  CE+++  C  NPC     C   + +F C C   + G+ CE    E      +      +        K+ +  G  F+     GF C C  G  G  C VN+D+C SQPC+NGG C D  G + C+C PGF G+
Sbjct:    4 GPCLHGGTCLPAADGGFSCRCAPGYSGDNCEASVGGCASGPCLNDAVCVDEPGGYKCYCVPGFQGRHCEIDINECASEPCLHGGTCTNGRDRYSCACPDGFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECESGPCQNGGVCIDL-----VDSYTCDCLETGYEGKDCELEILECASNPCRHNSTCIEGILNFTCICWPGFAGDACEEDVNECGDEPCMNGGQCIELSKPDFYGKLSELPGT-FHYANASGFTCRCLPGTTGENCSVNLDECESQPCLNGGSCIDNIGSFSCECAPGFTGL 318          

HSP 3 Score: 174.481 bits (441), Expect = 3.619e-48
Identity = 129/364 (35.44%), Postives = 169/364 (46.43%), Query Frame = 3
Query: 2940 CRGNPCGDFGVCETDLDS-FKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDP----ETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPK-GFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEV-------------GRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGL 3971
            C   PC   G C    D  F C+C   Y G+ CE      C S                   G C ND     E GG+KC C  G+ G  CE++I++CAS+PC++GG C +G   Y C C  GF G  CQ++TNEC S  C+ G  C+D    F CVCPRG +G  CET VD C+   CQNGG+C +++  + C+C + G+ GK CE +I EC  N              PC    T  C++    F C C   F G  CE  ++ C      G+ PC N G C+   + +                   F+C C  G  GE C +N  +C+   C N G C    ID+  SF CEC PG  GL
Sbjct:    1 CASGPCLHGGTCLPAADGGFSCRCAPGYSGDNCE-ASVGGCAS-------------------GPCLNDAVCVDEPGGYKCYCVPGFQGRHCEIDINECASEPCLHGGTCTNGRDRYSCACPDGFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECESGPCQNGGVCIDLVDSYTCDCLETGYEGKDCELEILECASN--------------PCRHNST--CIEGILNFTCICWPGFAGDACEEDVNEC------GDEPCMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVNLDECESQPCLNGGSC----IDNIGSFSCECAPGFTGL 318          

HSP 4 Score: 168.703 bits (426), Expect = 3.419e-46
Identity = 119/340 (35.00%), Postives = 166/340 (48.82%), Query Frame = 3
Query:  438 CENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQK-SNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCEL-PNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKC-KAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGF 1445
            C +  C +G TC    +G + C CA GY G  CE     C   PC N   C    G   C C+  + G  CE   N CAS PC +GG C +    +Y C CP  + G  C+L  N C SQ PC  NG   +  DG+ +C C +GYTG  C  ++DEC   E+  C+NGG CI+ V SY C C + G+ G+ CE +I++C ++ C++  TC++ I ++ C+C   + G  CE     C  +PC NGG C +  +         + GK              +  G     N   + C C  G  G+ C  ++D C+   C NGGSCI+ I    C C PGF
Sbjct:    1 CASGPCLHGGTCLPAADGGFSCRCAPGYSGDNCEASVGGCASGPCLNDAVCVDEPGGYKCYCVPGFQGRHCEIDINECASEPCLHGGTCTNGR-DRYSCACPDGFAGERCQLDTNECASQ-PC-HNGATCVDLDGKFECVCPRGYTGAMCETEVDEC---ESGPCQNGGVCIDLVDSYTCDCLETGYEGKDCELEILECASNPCRHNSTCIEGILNFTCICWPGFAGDACEEDVNECGDEPCMNGGQCIELSKP-------DFYGK------------LSELPGTFHYANASGFTCRCLPGTTGENCSVNLDECESQPCLNGGSCIDNIGSFSCECAPGF 315          

HSP 5 Score: 168.703 bits (426), Expect = 3.519e-46
Identity = 117/343 (34.11%), Postives = 163/343 (47.52%), Query Frame = 3
Query: 3111 CKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKY-FTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGIC----RP------------FEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCG 4085
            C H G C    + GGF C C  GY G  CE ++  CAS PC+N   C D  G Y C C PGFQG +C+++ NEC S  C + G C +  + +SC CP G +G  C+   + C    C NG  C ++ G FEC CP+G+ G +CET+++EC+               GPC   G   C+D   ++ C C +  + GK CE  I  C       + PC +N  C+           NF+CIC  G+ G+ C+ +  +C    C N G C    +P            F   +   F C C PG  G  C ++ ++EC S  C N GSC++  G   C C  G  G
Sbjct:    6 CLHGGTCLPAAD-GGFSCRCAPGYSGDNCEASVGGCASGPCLNDAVCVDEPGGYKCYCVPGFQGRHCEIDINECASEPCLHGGTCTNGRDRYSCACPDGFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECE--------------SGPCQNGGV--CIDLVDSYTCDCLETGYEGKDCELEILEC------ASNPCRHNSTCIEGI-------LNFTCICWPGFAGDACEEDVNECGDEPCMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVN-LDECESQPCLNGGSCIDNIGSFSCECAPGFTG 317          

HSP 6 Score: 168.318 bits (425), Expect = 4.689e-46
Identity = 118/339 (34.81%), Postives = 161/339 (47.49%), Query Frame = 3
Query: 1722 PCKTEEICLNVNNTRSGYKCICPDGVQ--NCKKELSKCKNIVCIN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNL--------------------ADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSG 2669
            PC     CL   +   G+ C C  G    NC+  +  C +  C+N   CVD     KC C+PGF+GR CEI+INEC + PC HG  C +  + Y C C  GF G++C+++ NECA  PC     C+D    F C C   Y+G  C  ++D C    C N  +CI  +  DSY C+C      YEG  CE ++ EC  +                    PC +++ CI    +F C C   + G  CE+ +N C + PC NG  C  L                    A GF CRC+ G TGE C + ++EC+  PC N   CID+I  + C C  GF+G
Sbjct:    5 PCLHGGTCLPAAD--GGFSCRCAPGYSGDNCEASVGGCASGPCLNDAVCVDEPGGYKCYCVPGFQGRHCEIDINECASEPCLHGGTCTNGRDRYSCACPDGFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECESGPCQNGGVCI--DLVDSYTCDCLET--GYEGKDCELEILECASN--------------------PCRHNSTCIEGILNFTCICWPGFAGDACEEDVNECGDEPCMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVNLDECESQPCLNGGSCIDNIGSFSCECAPGFTG 317          

HSP 7 Score: 163.696 bits (413), Expect = 2.073e-44
Identity = 107/312 (34.29%), Postives = 164/312 (52.56%), Query Frame = 3
Query: 1275 GFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDG---VQNCKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDL--------------------FNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSG 2138
            G C       + C C  G+ G  CE S+  C    C N   C++   G KC C+PGF+G +CEI++NEC ++PC +   C +  + Y+C CP+G  G+ C+++ +EC   PC NGA C D  G F C C +G+ G  CET+ D C+   PC+   +C+++ ++   Y C C +     ++C+ E+ +C +  C  N  C++      CIC PGF G  CE ++NEC + PC +G QC +L                     + + C CLPG  G+ C +N++EC   PC   G CID +  F C+C   ++G
Sbjct:   10 GTCLPAADGGFSCRCAPGYSGDNCEASVGGCASGPCLNDAVCVDEPGGYKCYCVPGFQGRHCEIDINECASEPCLHGGTCTNGRDRYSCACPDGFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECES-GPCQNGGVCIDLVDS---YTCDCLETGYEGKDCELEILECASNPCRHNSTCIEGILNFTCICWPGFAGDACEEDVNECGDEPCMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVNLDECESQPCLNGGSCIDNIGSFSCECAPGFTG 317          

HSP 8 Score: 161.384 bits (407), Expect = 1.288e-43
Identity = 114/347 (32.85%), Postives = 164/347 (47.26%), Query Frame = 3
Query: 1938 CFNNPCQHGSQCQDLFN-DYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCV-AGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVD--------------------KVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTG 2912
            C + PC HG  C    +  + C C PG+ G  CE ++  CA  PC  +  C+DE  G++C C+  + G  C   ++ C    C +   C   N  D Y C C      + G +C+ D +EC                   SQ  PC N   C++ +G F C C   Y G  CE  ++ C + PC+NG  C +L D + C C+  G+ G+ CE+EI EC  NPC +++ CI+ I ++ CIC  GF+G  CE + N+C +  C+  GQC++                      +GF C+C     G NC      C+S PCLN GSCI+     N   + C C  GFTG
Sbjct:    1 CASGPCLHGGTCLPAADGGFSCRCAPGYSGDNCEASVGGCASGPCLNDAVCVDEPGGYKCYCVPGFQGRHCEIDINECASEPCLHGGTCT--NGRDRYSCACPDG---FAGERCQLDTNEC------------------ASQ--PCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECESGPCQNGGVCIDLVDSYTCDCLETGYEGKDCELEILECASNPCRHNSTCIEGILNFTCICWPGFAGDACEEDVNECGDEPCMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVNLDECESQPCLNGGSCID-----NIGSFSCECAPGFTG 317          

HSP 9 Score: 143.665 bits (361), Expect = 1.936e-37
Identity = 110/337 (32.64%), Postives = 150/337 (44.51%), Query Frame = 3
Query: 3216 CASQPCINGGECGDGT-GMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCV-----NGFGKA---------------ICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEI 4160
            CAS PC++GG C     G + C+C PG+ G NC+ +   C S  C N   C+D+   + C C  G  GR CE  ++ C    C +GG C N    + C CP GFAG+ C+ D NEC                 PC    T  C+D  G F C C + +TG  CET +D CE        PC N G+C++   +     Y   C+   GY G+ C++   +C  N C++N  C    I+  ++F C C PG  G  CE D VNEC    C N G C+     + +GK                 C C  G+ GE C +    C      N  +  D I
Sbjct:    1 CASGPCLHGGTCLPAADGGFSCRCAPGYSGDNCEASVGGCASGPCLNDAVCVDEPGGYKCYCVPGFQGRHCEIDINECASEPCLHGGTCTNGRDRYSCACPDGFAGERCQLDTNECASQ--------------PCHNGAT--CVDLDGKFECVCPRGYTGAMCETEVDECESG------PCQNGGVCIDLVDS-----YTCDCL-ETGYEGKDCELEILECASNPCRHNSTC----IEGILNFTCICWPGFAGDACEED-VNECGDEPCMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVNLDECESQPCLNGGSCIDNI 304          

HSP 10 Score: 111.309 bits (277), Expect = 2.111e-26
Identity = 83/251 (33.07%), Postives = 115/251 (45.82%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKN-YLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINT--------------------VGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFG 1106
            I +N C +  C +G TC +  + +Y C C  G+ G  C+  +N C   PC NG TC  + G   C C   + G  CE   + C S PC+NGG+C  L +  Y C C +  Y G +CEL     + NPC  N  CI        C C  G+ G+ C  D++EC       C NGG CI                         + C+C  G  GE C  ++ +C +  C NGG+C+D IGS+ C C   + G
Sbjct:   73 IDINECASEPCLHGGTCTNGRD-RYSCACPDGFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECESGPCQNGGVCIDL-VDSYTCDCLETGYEGKDCELEILECASNPCRHNSTCIEGIL-NFTCICWPGFAGDACEEDVNECGDEP---CMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVNLDECESQPCLNGGSCIDNIGSFSCECAPGFTG 317          
BLAST of Neurogenic locus notch protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008695.1 (pep scaffold:Pmarinus_7.0:GL501129:36413:70075:1 gene:ENSPMAG00000007872.1 transcript:ENSPMAT00000008695.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.178 bits (448), Expect = 2.160e-47
Identity = 155/524 (29.58%), Postives = 222/524 (42.37%), Query Frame = 3
Query: 2517 DGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHI-----NDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKV-NGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPG-YLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCN-TGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSC----KKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDR---MSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNG 4043
            + FRCRC   + G  CE     C  NPC N A C+        + Y+C C  GF G NC      C E  C  HG CVD   + F C+C+  Y+G  C      C S PC N G+CI        PG ++C C +G  G RCE+ ++ C  +PCG   +C   +  ++C C   +I     +  T       + KF     I    K+   C N      + C     + G+ C+ + D+C S PC NG  C +    + C+C PGFQG  C+   NEC S+ C+  G CID ++ + C+CP G++          C++   +N   C        C    G  G     + +      A   T+L +         G+L    R G    +         TG +CE  ID C      G+ PC +   CL+     +G  Y   C C   +    C    K C    C+N  +CR  E+D     M   C CP G  GL+CE +  ++C S  C N+G C +G
Sbjct:    1 NAFRCRCREPYAGPHCEAAAGACSPNPCGNGAICVPRTEGGAGSGYRCKCAEGFVGWNCSEAVGACNEQRCE-HGSCVDVTPSTFVCECHAGYMGPTCSAPIDRCASLPCTNGGTCIE------VPGSFVCICPKGLMGRRCELDINECASDPCGPLSLCINSVGGYRCFCAPGFIA----VFATSKVADCQLLKFPKFCFI----KNANQCHNR-RISIYICPAVFHHKGARCDSDADECLSSPCWNGASCSNLRNGFSCECLPGFQGGLCEQEVNECSSSPCHHDGSCIDLVDGYICLCPPGLTEVSRGNAQPMCQRTPARNQSYCIQRTQKQSCIFQDGAQGLTVLYNTD------ASRRTSLQT--------YGSL----REGAVAIAVGGCVSLSLTGPHCEMDIDEC------GSSPCLHGATCLDL----IGGYY---CQCLAPFKAIVCPRQIKICMSVPCENAAVCRQ-EVDLAVYPMGSSCSCPAGFAGLYCETN-TDDCASAPC-NHGFCYDG 474          

HSP 2 Score: 174.866 bits (442), Expect = 1.120e-46
Identity = 158/563 (28.06%), Postives = 235/563 (41.74%), Query Frame = 3
Query: 1071 SYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGG-KCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHIN------DYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVD 2738
            ++RC C   Y G +CE     C   PC NG IC    E      G   +G                            Y+C C  GF G  C  ++  C +  C +G SC+++      C C  G+ G  C   ++ C + PC N   CI++   + C CP+GL G+ CE++I+EC  +PC   + C + VGG+ C C  GF+ +   +K   C+ L   K  + C   N  +            N +  +  C  +                      +G  C+ + +EC ++PC +G+ C +L N + C CLPGF+G  CE  +NEC+ +PC  +G CID V G+ C C    +  +  N    C      N + CI   +  S    C    G  +G     + D     RT L  YG          +G C+                S    G  CE  ++ C ++PC +GATC +L  G+ C+C+A F    C  +I  C   PC N A C   ++         C C +GF+G  CE N +DC  + C  HG C D
Sbjct:    2 AFRCRCREPYAGPHCEAAAGACSPNPCGNGAICVPRTE------GGAGSG----------------------------YRCKCAEGFVGWNCSEAVGACNEQRCEHG-SCVDVTPSTFVCECHAGYMGPTCSAPIDRCASLPCTNGGTCIEVPGSFVCICPKGLMGRRCELDINECASDPCGPLSLCINSVGGYRCFCAPGFIAVFATSKVADCQLL---KFPKFCFIKNANQ----------CHNRRISIYICPAVF-------------------HHKGARCDSDADECLSSPCWNGASCSNLRNGFSCECLPGFQGGLCEQEVNECSSSPCHHDGSCIDLVDGYICLCPPGLTEVSRGNAQPMCQRTPARNQSYCIQRTQKQS----CIFQDGA-QGLTVLYNTDASR--RTSLQTYGSLREGAVAIAVGGCV----------------SLSLTGPHCEMDIDECGSSPCLHGATCLDLIGGYYCQCLAPFKAIVCPRQIKICMSVPCENAAVCRQEVDLAVYPMGSSCSCPAGFAGLYCETNTDDCASAPC-NHGFCYD 473          

HSP 3 Score: 170.244 bits (430), Expect = 4.128e-45
Identity = 153/512 (29.88%), Postives = 208/512 (40.62%), Query Frame = 3
Query:  717 KYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEV----KCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQW-----TGKNCD-DVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEV------YGFRCQCMLPYSGPTCANKLD-----PCNPNACYN 2189
             + C+C + Y G +CE      S NPCG    C+   +G      +C C +G+ G  CS  +  C       CE+G     T  ++ C+C AG+ G  C   I  C +  C NGGTC++  GS+ C+CP    G  CE     C   PC    +C +    Y+C C   +     T K  D  +    K    KN   C +     Y C      +G  C++  D C    C+NG SC N+  G  C CLPGF+G  CE  VNEC + PC ++  CIDL + Y C CP GLT  +       C   P  N + C  R    +C    G  GL     +D  ++ +            + R G   I                      G CV ++            G  CE++I+EC ++PC HG+ C DL   Y C CL  FK   C   I  C   PC     C  EV       G  C C   ++G  C    D     PCN   CY+
Sbjct:    2 AFRCRCREPYAGPHCEAAAGACSPNPCGNGAICVPRTEGGAGSGYRCKCAEGFVGWNCSEAVGACNEQR---CEHGSCVDVTPSTFVCECHAGYMGPTCSAPIDRCASLPCTNGGTCIEVPGSFVCICPKGLMGRRCELDINECASDPCGPLSLCINSVGGYRCFCAPGFIAVFATSKVADCQLLKFPKFCFIKNANQCHNRRISIYICPAVFHHKGARCDSDADECLSSPCWNGASCSNLRNGFSCECLPGFQGGLCEQEVNECSSSPCHHDGSCIDLVDGYICLCPPGLTEVSRGNAQPMCQRTPARNQSYCIQRTQKQSCIFQDGAQGLTVLYNTDASRRTS-------LQTYGSLREGAVAI--------------------AVGGCVSLS----------LTGPHCEMDIDECGSSPCLHGATCLDLIGGYYCQCLAPFKAIVCPRQIKICMSVPCENAAVCRQEVDLAVYPMGSSCSCPAGFAGLYCETNTDDCASAPCNHGFCYD 473          

HSP 4 Score: 147.132 bits (370), Expect = 2.647e-37
Identity = 140/517 (27.08%), Postives = 198/517 (38.30%), Query Frame = 3
Query:  492 KYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLI----AGNNV-CQCLNEWVGEFC-EFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDT------CKNGGTCLD-KIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEG----------------------------------------LTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEIC---LNVNNTRSGYKCICPDGVQN--CKKELSKCKNIVCINGQCVD 1865
             + C C   Y G +CE  +  C   PC NG  C       AG+   C+C   +VG  C E    C    C +G  C  +    + C+C   Y+G  C  P    +  PC   G CI    G   C C KG  G  C  DI+ECAS     C     CIN+VG Y+C C  GF      + + DC           KN   C + +I  Y C    ++ G  C++    C   PC NG  C +    + C C                                         GF+G +CE  ++ C    C + GSCI++++G  C C PG    +       C+  P +N + CI      +C   +G                                        LTG +CE++IDEC  +PCL+GA C D +GG+ CQCL  F  + C  +  IC  + PC+   +C   +++     G  C CP G     C+     C +  C +G C D
Sbjct:    2 AFRCRCREPYAGPHCEAAAGACSPNPCGNGAICVPRTEGGAGSGYRCKCAEGFVGWNCSEAVGACNEQRCEHGS-CVDVTPSTFVCECHAGYMGPTCSAPIDRCASLPCTNGGTCIEV-PGSFVCICPKGLMGRRCELDINECASDP---CGPLSLCINSVGGYRCFCAPGFIAVFATSKVADCQLLKFPKFCFIKNANQCHNRRISIYICPAVFHHKGARCDSDADECLSSPCWNGASCSNLRNGFSCEC---------------------------------------LPGFQGGLCEQEVNECSSSPCHHDGSCIDLVDGYICLCPPGLTEVSRGNAQPMCQRTPARNQSYCIQRTQKQSCIFQDGAQGLTVLYNTDASRRTSLQTYGSLREGAVAIAVGGCVSLSLTGPHCEMDIDECGSSPCLHGATCLDLIGGYYCQCLAPFKAIVCPRQIKICMSV-PCENAAVCRQEVDLAVYPMGSSCSCPAGFAGLYCETNTDDCASAPCNHGFCYD 473          

HSP 5 Score: 144.821 bits (364), Expect = 1.761e-36
Identity = 120/418 (28.71%), Postives = 180/418 (43.06%), Query Frame = 3
Query:  426 SLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQK-SNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGM-------NCEL---PNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCE--SVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKC---IDLN---NDYTCDCPEGLTGKNCEINIDECTPNPCLNG 1619
            ++  C   +C++G +C       +VCEC  GY G  C      C   PC NGGTC  + G+ VC C    +G  CE   N CAS PC    +C +  +  Y C C   ++ +       +C+L   P  C  +N      +C         C     + G  C +D DEC S     C NG +C N    + C+C  GF G  CE ++ +C++  C + G+C+D +  Y C+CP      +  N + +C+  P +N   C    +   CI  +   G       +  +    +  G     +V      C+      G  CE  ID C    C +G +C+++I G  C CL  F+   C   +  C + PC+N A C   +DL       +C CP G  G  CE N D+C   PC +G
Sbjct:   62 AVGACNEQRCEHG-SCVDVTPSTFVCECHAGYMGPTCSAPIDRCASLPCTNGGTCIEVPGSFVCICPKGLMGRRCELDINECASDPCGPLSLCIN-SVGGYRCFCAPGFIAVFATSKVADCQLLKFPKFCFIKN----ANQCHNRRISIYICPAVFHHKGARCDSDADECLSSP---CWNGASCSNLRNGFSCECLPGFQGGLCEQEVNECSSSPCHHDGSCIDLVDGYICLCPPGLTEVSRGNAQPMCQRTPARNQSYCIQRTQKQSCIFQDGAQGLTVLYNTDASRRTSLQTYGSLREGAVAIAVGGCV-SLSLTGPHCEMDIDECGSSPCLHGATCLDLIGGYYCQCLAPFKAIVCPRQIKICMSVPCENAAVCRQEVDLAVYPMGSSCSCPAGFAGLYCETNTDDCASAPCNHG 469          

HSP 6 Score: 144.05 bits (362), Expect = 3.045e-36
Identity = 134/504 (26.59%), Postives = 201/504 (39.88%), Query Frame = 3
Query: 2103 GFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIP---GNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCT----ESSCL--GHGQCVDK-VNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKC----------NSEYIGERCEIKKTETCKSYAVEKFKNESLI------------------NKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKC--------------------------------------------QPGFQGVNCQVNTNECYSNSCNTGKCID 3368
             FRC+C  PY+GP C      C+PN C N AIC+P   G     Y C C+     + G  C + V  CN  R +                G C++      T  +F+C+C + Y G  C  P++ C + PC NG TC  +   F C C  G  G RCE++INEC  +PC   + CI+ +  Y+C C  GF          DC        C      QC ++ ++ + C    ++ G  C+     C S+PC N  SC N +      G+ C C  GF G  CE +++ C  +PC   G C   +D + C C          N++ + +R   +     +SY +++ + +S I                      + +G+                   G  CE++ID+C S PC++G  C D  G Y+C+C                                              GF G+ C+ NT++C S  CN G C D
Sbjct:    2 AFRCRCREPYAGPHCEAAAGACSPNPCGNGAICVPRTEGGAGSGYRCKCAEG---FVGWNCSEAVGACNEQRCEH---------------GSCVD-----VTPSTFVCECHAGYMGPTCSAPIDRCASLPCTNGGTCIEVPGSFVCICPKGLMGRRCELDINECASDPCGPLSLCINSVGGYRCFCAPGFIAVFATSKVADCQLLKFPKFCFIKNANQCHNRRISIYICPAVFHHKGARCDSDADECLSSPCWNGASCSNLRN-----GFSCECLPGFQGGLCEQEVNECSSSPCHHDGSCIDLVDGYICLCPPGLTEVSRGNAQPMCQRTPARN----QSYCIQRTQKQSCIFQDGAQGLTVLYNTDASRRTSLQTYGSLREGAVAIAVGGCVSLSLTGPHCEMDIDECGSSPCLHGATCLDLIGGYYCQCLAPFKAIVCPRQIKICMSVPCENAAVCRQEVDLAVYPMGSSCSCPAGFAGLYCETNTDDCASAPCNHGFCYD 473          

HSP 7 Score: 143.665 bits (361), Expect = 4.213e-36
Identity = 108/317 (34.07%), Postives = 141/317 (44.48%), Query Frame = 3
Query: 3153 GFKCSCQSGYGGSFCEVNIDDCASQPCINGGEC------GDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQI-NNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYG--GERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKG 4076
             F+C C+  Y G  CE     C+  PC NG  C      G G+G Y CKC  GF G NC      C    C  G C+D   + F C C  G  G  C   +D C  + C NGG C  V G F C CPKG  G+ CE DINEC            S+P GP S      C++  G + C C   F   +  +++  C+  +     P F    C  K  N+         ICP  +   G RC  ++ +C  + C N   C     + R  F CEC PG  G  CE + VNEC S+ C+++GSC++     IC C  G
Sbjct:    2 AFRCRCREPYAGPHCEAAAGACSPNPCGNGAICVPRTEGGAGSG-YRCKCAEGFVGWNCSEAVGACNEQRCEHGSCVDVTPSTFVCECHAGYMGPTCSAPIDRCASLPCTNGGTCIEVPGSFVCICPKGLMGRRCELDINECA-----------SDPCGPLS-----LCINSVGGYRCFCAPGFIAVFATSKVADCQLLK----FPKF----CFIKNANQCHNRRISIYICPAVFHHKGARCDSDADECLSSPCWNGASCS----NLRNGFSCECLPGFQGGLCEQE-VNECSSSPCHHDGSCIDLVDGYICLCPPG 288          

HSP 8 Score: 133.265 bits (334), Expect = 1.125e-32
Identity = 114/452 (25.22%), Postives = 175/452 (38.72%), Query Frame = 3
Query: 2367 PCLNDNQCI-----NTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGT-------NCEHLKRP--------------------------------------CDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKC----------NSEYIGERCEIKKTETCKSYAVEKFKNESLI------------------NKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQIN------NFSCVCPRGVSGRFCETIVDYCKKMECQNG 3467
            PC N   C+          + CKC+  + G  C + +  C    C +G+  D     F C C AG+ G  C   I+ C   PC+N   CI+    + CIC  G  G+ CE++ N+C    C     C++ V G+ C C   +I         +C+ LK P                                      C S+PC N  SC N +      G+ C C  GF G  CE +++ C  +PC   G C   +D + C C          N++ + +R   +     +SY +++ + +S I                      + +G+                   G  CE++ID+C S PC++G  C D  G Y+C+C   F+ + C      C S  C N   C  +++        SC CP G +G +CET  D C    C +G
Sbjct:   27 PCGNGAICVPRTEGGAGSGYRCKCAEGFVGWNCSEAVGACNEQRCEHGSCVDVTPSTFVCECHAGYMGPTCSAPIDRCASLPCTNGGTCIEVPGSFVCICPKGLMGRRCELDINECASDPCGPLSLCINSVGGYRCFCAPGFIAVFATSKVADCQLLKFPKFCFIKNANQCHNRRISIYICPAVFHHKGARCDSDADECLSSPCWNGASCSNLRN-----GFSCECLPGFQGGLCEQEVNECSSSPCHHDGSCIDLVDGYICLCPPGLTEVSRGNAQPMCQRTPARN----QSYCIQRTQKQSCIFQDGAQGLTVLYNTDASRRTSLQTYGSLREGAVAIAVGGCVSLSLTGPHCEMDIDECGSSPCLHGATCLDLIGGYYCQCLAPFKAIVCPRQIKICMSVPCENAAVCRQEVDLAVYPMGSSCSCPAGFAGLYCETNTDDCASAPCNHG 469          

HSP 9 Score: 130.183 bits (326), Expect = 1.378e-31
Identity = 121/449 (26.95%), Postives = 174/449 (38.75%), Query Frame = 3
Query: 2745 NGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNEC----YSNSC---NTGKCIDQ-INNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHC 4067
            N F C+C E Y G +CE     C  NPC N   C+ R       GY C C  GF G  C   +  C    C      +    +F C+C++ Y+G  C     + C S               C + G C   P  G F C C  G  G  CE++I++CAS PC     C +  G Y C C PGF  V       +C    +   C   N  +C ++ I+ + C       G  C++  D C    C NG  C N+   F C C  GF G LCE ++NEC  +              PC   G+  C+D    + C C    T          C++       P  N   C+ + Q +       SCI  +G  G     N+   +    +  G  R   +   +         + G  CE+D ++EC S+ C +  +C++  G   C C
Sbjct:    1 NAFRCRCREPYAGPHCEAAAGACSPNPCGNGAICVPRTEGGAGSGYRCKCAEGFVGWNCSEAVGACNEQRCEHGSCVDVTPSTFVCECHAGYMGPTCS-APIDRCASLP-------------CTNGGTCIEVP--GSFVCICPKGLMGRRCELDINECASDPCGPLSLCINSVGGYRCFCAPGFIAVFATSKVADCQLLKFPKFCFIKNANQCHNRRISIYICPAVFHHKGARCDSDADECLSSPCWNGASCSNLRNGFSCECLPGFQGGLCEQEVNECSSS--------------PCHHDGS--CIDLVDGYICLCPPGLTEVSRGNAQPMCQR------TPARNQSYCIQRTQKQ-------SCIFQDGAQGLTVLYNTDASRRTSLQTYGSLREGAVAIAVGGCVSL--SLTGPHCEMD-IDECGSSPCLHGATCLDLIGGYYCQC 401          

HSP 10 Score: 77.0258 bits (188), Expect = 2.160e-14
Identity = 75/260 (28.85%), Postives = 105/260 (40.38%), Query Frame = 3
Query:  438 CENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN--CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGV-----NGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIG------SYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRD 1175
            C +  C NGA+C +  NG + CEC  G++G  CEQ+ N C  +PC + G+C  +    +C C    + E    ++   C  +P RN   C      K  C       G+          +           G   +A  G V    +   TG  C  DIDEC S     C +G TC++ +G Y C+C A F    C   I  C +  C+N   C  ++          C CP  + G  CE     C   PC N G C D
Sbjct:  225 CLSSPCWNGASCSNLRNG-FSCECLPGFQGGLCEQEVNECSSSPCHHDGSCIDLVDGYICLC-PPGLTEVSRGNAQPMCQRTPARNQSYCIQ-RTQKQSCIFQDGAQGLTVLYNTDASRRTSLQTYGSLREGAVAIAVGGCV----SLSLTGPHCEMDIDECGSSP---CLHGATCLDLIGGYYCQCLAPFKAIVCPRQIKICMSVPCENAAVCRQEVDLAVYPMGSSCSCPAGFAGLYCETNTDDCASAPC-NHGFCYD 473          

HSP 11 Score: 58.151 bits (139), Expect = 1.761e-8
Identity = 46/150 (30.67%), Postives = 64/150 (42.67%), Query Frame = 3
Query: 3654 TFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMS-FKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEI 4100
             F C C++ + G +CE     C         PC N  IC+ + +   G  Y   C C  G+ G  C      C    C++ G C    +D   S F CEC  G  G  C    ++ C S  C N G+C+   G  +C C KG  G +CE+
Sbjct:    2 AFRCRCREPYAGPHCEAAAGACSPN------PCGNGAICVPRTEGGAGSGYR--CKCAEGFVGWNCSEAVGACNEQRCEH-GSC----VDVTPSTFVCECHAGYMGPTCSAP-IDRCASLPCTNGGTCIEVPGSFVCICPKGLMGRRCEL 137          
BLAST of Neurogenic locus notch protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002704.1 (pep scaffold:Pmarinus_7.0:GL476354:513769:588114:-1 gene:ENSPMAG00000002318.1 transcript:ENSPMAT00000002704.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.711 bits (439), Expect = 2.983e-43
Identity = 322/1179 (27.31%), Postives = 475/1179 (40.29%), Query Frame = 3
Query:  885 DIDECASYETPLCENGGTCINTVGSYQCKCKAGF----NGERCENDIVDCTN-DTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGF------------CESVNYQDYKCIC---QRGFEGKMC---ETSIDNCQKIS--CFNGGSCINMIEGGKCNCLPGFXXXXXXXXXX-----XXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCE--INIDECTPNPCL-NGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLN--VNNTRSGYKCICPDGVQ-----NC--KKELSKCKNIVCINGQCVDVNNEEKCICIPGFE----GRTCEIEINEC--FNNPCQHGSQCQDLFNDYLCICLPGFKGKKCE-ININECA-HNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYND---AICIPGNKYDSYH--CNCSTALGRYEGSKCEKDVDECNLDRTQLA-LYGLAVL---SMSNSQIGPCLND------NQCINTNGSFICKCSSQY----EGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTG---ERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGK----------NCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRP-----CDSNPC-LNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETD-LDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFND-------PETGGFKCSCQSGYGGSFCEVNIDDCASQPCI-NGGECGDGTGMYFCKCQPGFQGVNCQ---VNTNECYSN--SCNTGKCIDQINNFSCVCPRGV----SGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCE-TDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKC-QLNVCKNNGICRPFEIDDRM-SFKCECPPGV------GGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKG 4076
            DIDEC   E P    GG C NT GS++C C+ GF    +  +CE DI +C N  T    GTC + +G+Y CVCP +Y   N               G  C D  + +   C   +    CD+  +           +            C +++ + +  +C     G+E  +       ID C KI   C NG  C+N+    +C C  GF  N+ +I            K CQ NA+CI+    Y C+C  G T       I+ DEC+  P + +  RC+D  G + C C  G+   +     ++C  +  C+ +  C N    NT   + C+C  G +     +C  K E       VC  G C++     KC+C  GFE     + C  +INEC  F   C  G+ CQ+L   + C+C PG++ K+    +I+EC+      + G C++    F C+C   +       K      N C+++     C     +++    C CS   G   G  CE    +   +  +L   YG   +     S   +  CL +       +CINT+GSF C C   Y     G +C         NPC NG TC N+  GF C C  GF       CE ++NEC  NP     +C+++   Y+C+C +G+  +           CE   ++C   + +    C + +  + C C   Y        +RP      D N C L  G C N +   N   Y C C  GFT     +  D             ET+ +DS +  C +E I   C++          V   +N    ++ C   G  +         P T  +K  C  G G +    +ID+C   P + + G+C +  G Y C C  G+     +   V+ +EC  +   CN   C +   ++ C CPRG      GR C  + D C   +     +C N IG F C CP GF        D NEC           +S P G C   G   C + PG+F C C+K F+    +     CE   +     C  N  C +  QN +G    + C CP+GY          +C   N C N  +C      + + SFKC CP G       GG     + VNEC  +K   N  C N  G  +C C  G
Sbjct: 1547 DIDECT--ELPGLCQGGNCQNTFGSFKCVCQPGFRFNEDNRQCE-DIDECANFPTVCGPGTCYNIVGNYTCVCPPDYMQVN--------------GGNNCMDMRKSF---CYKTYDAAGCDNELSFNLTEKECCCSYNVGKAWNRPCVPCPTISTKAHNQLCGGVPPGYEIDINTGERIDIDECSKIQGICTNG-MCVNLPGSFRCECPMGFLYNDIQIICEDINECASAEKMCQRNAECINSVGSYRCECSPGYTQTPFGLCIDRDECSEKPEICSPGRCQDTEGSYRCMCPNGY---KATEDQNMCMDVDECERQP-CGNGTCRNTVGSFNCLCFPGFEISANNDCMDKDECVSLAAHVCKFGSCINNVGSFKCLCNEGFELTADKKNCR-DINECQQFRGMCAPGT-CQNLEGSFRCMCPPGYEVKEEACTDIDECSSEEDLCMMGSCLNTFGSFECRCPSGFILSETGRKCYDVRVNYCFSEFAQGKCSTPKPFNTSKAGCCCSMMPGDGWGDPCEPCPKQNEEEAYRLLCPYGPGTVVGRDDSREDLDECLANPGICANGRCINTDGSFRCDCPMGYNLEAAGFKCVDANECSIGNPCGNG-TCLNVPGGFECTCDDGFEPGPMMTCE-DLNECSLNPLLCAFRCVNNFGSYECMCPTGYVLREDRRMCKDQDECEEGLDNCASRNMI----CKNLIGTYMCICPPGYT-------RRPDGEGCIDENECRLKPGICENGRCINNVGSYKCVCNEGFT-----LNQD-------------ETECVDSRRGFCFTEVIQSLCQM----------VSSSRNLVTKSECCCDGGRGWGQQCDICPLPGTAQYKKLCPHGPGYTTDGRDIDECTVMPGMCHHGQCINSEGSYHCMCNNGYTTDITRTGCVDLDECAQSPKPCNF-ICKNTEGSYQCACPRGYIMQEDGRTCRDL-DECASKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNEC-----------VSQP-GTCGSKGV--CQNSPGSFSCECQKGFS---LDNSGSNCEDMDE-----CSGNHRCQHGCQNMLG---GYRCGCPSGYLQH---FQWNQCVDENECTNPQVCGSASCYNTLGSFKCACPNGYNFDQFSGGC----NDVNECSHSKAPCNFGCSNTEGGYLCGCPPG 2623          

HSP 2 Score: 137.502 bits (345), Expect = 2.817e-32
Identity = 266/1026 (25.93%), Postives = 384/1026 (37.43%), Query Frame = 3
Query:  885 DIDECASYETPLCENGGTCINTVGSYQCKCKAGF----NGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICR-----DFDEDYQCICGN----QWTGKNCDDVXXXXXXXXXXXXG-----------------------------FCESVNYQDYKCICQR-GFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQ----NNAKCIDLNNDYTCDCPEGLTGKN----CEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEIC----------LNVNNTRSGYKC-------------------ICPDGVQNCK----KELSKCKNI--VCINGQCVDVNNEEKCICIPGF----EGRTC-EIEINEC---FNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCN-------------PNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEG-----RQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGF----TGERCEIEINEC--QHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHG---QCVDKVNGFECKCNENYI----GTNCEHLKRPCDSNPCL-NKGSCINRKVNQNTPG-YLCNCRRGFTGP----------RCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCE-VNIDDCA--SQPCINGGECGDGTGMYFCKCQPGFQGVNCQ-VNTNECYSNS--CNTGKCIDQINNFSCVCPRG----VSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGF 3521
            DIDEC  Y   +C+NG  C+NT GS+QC C AGF    +G  C +     T + C N G C+++ GS++C+C   ++     + R   ++  C+  GIC      + +  ++C C         G+ C D             G                              C +VN  DYK +C   GF+    + +        C N G C N +   +C C  G+E +       + +    +    +N  C +    YTC CP G   K+    CE ++DEC  NPC+NG  C++ VG FTC CL         +K D  K +    T+  C          +NVN      +C                   ICP G    K    +++++C+    +C+N +C++     KC C PG      GRTC ++ +  C   +            L +D  C  L    G +CE          C   G      Y F C       GP  +N+ DP               P  C N       N   S+ CNC          K   D+DEC +      +                     C+NT GSF C+C   +E      + C       RN     G TC N    F+C C  G      G  C ++++EC    N C N  +C++ I  YQC C +G+S         D  E + +  G    C +    +EC C   Y       +C  +   C+ NP L + G C       N PG Y C C  GF              CE+  + C        G CE    SF C C   +      +KK  T             +    C  H  C N    G FKC+C  GY G   +  ++D+CA  +  CI   +C +  G + C C+ GF G     V+ +EC  N   C  G+C++    + C C  G    V GR C+ I D C        G C+NV G F C C  G+
Sbjct:  472 DIDECV-YNGQVCKNG-RCVNTEGSFQCICNAGFELTADGRNCLDHDECSTTNMCLN-GMCINEDGSFKCICKPGFYLV--PSGRYCLDIDECQTHGICMNGRCINTEGSFKCECPPGMIVSMDGRLCIDTHMRSTCYGDYMMGKCLTPFPGANTKSECCCANPNFAFGEPCLPCPAVNSDDYKMLCPTPGFDNGGKDINECALNPEICTN-GQCENQLGTYRCVCNIGYESDITGKKCVDVDECMLRAHLCDNGSCRNTPGSYTCACPAGYLFKHETEMCE-DVDECESNPCING-NCQNTVGSFTCVCLP-------TSKLDQTKTICIESTKGTCWLNIIDNRCEVNVNGATLKSECCSTLGAAWGSPCEPCELDTICPKGFSRAKGTQCEDVNECEVFAGICVNSRCINTAGSFKCECPPGHTLESTGRTCIDLRLENCYLSYEEEECEEPLAVRLRSDVCCCSLGKAWGPECE---------GCPEKGS---SEYAFLCP-----RGPGYSNRGDPVGRHFFKDINECKVFPQMCSNGKC---RNTIGSFKCNCENGFVLDAEGKNCTDIDECKISHDICGM-------------------GTCVNTPGSFDCECMEGFESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFKCLCPPGHDLNEDGTVC-LDVDECSLSGNLCRN-GRCVNMIGSYQCSCNTGYSATPDRQGCVDIDECTIMNGGCDTHCSNSDGSYECSCERGYALLPDTRSCSDIDE-CEDNPYLCDGGQCT------NVPGEYRCLCYDGFISSVDMKTCSDVNECELNPNICI------HGKCENTRGSFICHCKVGFT-----VKKGST----GCTDVDECEIGAHNCDMHATCAN--VQGSFKCTCIEGYFGDGVKCQDVDECANGTHNCIPEAKCVNIPGTFTCVCRDGFSGDGQTCVDMDECAENVNLCEFGQCLNSAGGYRCECEMGFVPTVDGRSCKDI-DECMFDNICVFGKCENVPGMFRCVCDPGY 1416          

HSP 3 Score: 134.806 bits (338), Expect = 2.206e-31
Identity = 256/976 (26.23%), Postives = 401/976 (41.09%), Query Frame = 3
Query:  690 GICKSLEIHKYECQCPKNYL----GMNCELPNSCGS-QNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCEN---DIVDCTNDTCKNGGTCLDKIGSYRCVC-PNNYFGTN--CENKRTLCELKP--CKNGGICRDFDEDYQCIC--GNQWTG--KNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKM--------CETSIDNCQKISCFNG-GS-------------------------CINMIEGGKCNCLPGFXXXXX----XXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEG---LTGKN-CEINIDECTPNP--CLNGARCEDRVGGFTCQCLQGF----VGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCK----KELSKCK-NIVCINGQCVDVNNEEKCICIPGF----EGRTC--EIEINECFNNPCQHGSQCQDLFNDYLCICLPGFK----GKKCEININECAHNPCGL--NGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAI-----CIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLS----MSNSQIGPCL-NDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGF----SGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNK-GSCINRKVNQNTPG-YLCNCRRGFT----GPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGY-----GGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGF 3296
            G+C +L    + C+CP  +L     + CE  N C S +  C  N +CI  + G  +C C+ GYT       ID     E P   + G C +T GSY+C C  G+     +N   D+ +C    C NG TC + +GS+ C+C P      N  C +K     L    CK G  C +    ++C+C  G + T   KNC D+    +       G C+++    ++C+C  G+E K         C +  D C   SC N  GS                         C +    GKC+    F  +       +   +    PC+   K  +    Y   CP G   + G++    ++DEC  NP  C NG RC +  G F C C  G+     G +C   ++ C    PC     CLNV     G++C C DG +       ++L++C  N +    +CV+     +C+C  G+    + R C  + E  E  +N       C++L   Y+CIC PG+     G+ C I+ NEC   P G+  NG+CI+ V  ++C C   ++      +        C+ + I      +  ++       C    GR  G +C+           +L  +G    +    +    + P + +  QCIN+ GS+ C C++ Y                           D  R  CV          +++EC  +P   +  C +    YQC C  G+     G+ C   D +C          CV+ + GF CKC   +     +H     D+N C+++ G+C ++ V QN+PG + C C++GF+    G  CE  MD C GN     G C+  L  ++C C S Y+    +  +   C        +NE    ++C    +C+N    G FKC+C +GY      G   +VN    +  PC  G  C +  G Y C C PG+
Sbjct: 1720 GMCVNLP-GSFRCECPMGFLYNDIQIICEDINECASAEKMCQRNAECI-NSVGSYRCECSPGYTQTPFGLCIDRDECSEKPEICSPGRCQDTEGSYRCMCPNGYKATEDQNMCMDVDECERQPCGNG-TCRNTVGSFNCLCFPGFEISANNDCMDKDECVSLAAHVCKFGS-CINNVGSFKCLCNEGFELTADKKNCRDINECQQFRGMCAPGTCQNLE-GSFRCMCPPGYEVKEEACTDIDECSSEEDLCMMGSCLNTFGSFECRCPSGFILSETGRKCYDVRVNYCFSEFAQGKCSTPKPFNTSKAGCCCSMMPGDGWGDPCEPCPK-QNEEEAYRLLCPYGPGTVVGRDDSREDLDECLANPGICANG-RCINTDGSFRCDCPMGYNLEAAGFKC-VDANECSIGNPCGNG-TCLNV---PGGFECTCDDGFEPGPMMTCEDLNECSLNPLLCAFRCVNNFGSYECMCPTGYVLREDRRMCKDQDECEEGLDNCASRNMICKNLIGTYMCICPPGYTRRPDGEGC-IDENECRLKP-GICENGRCINNVGSYKCVCNEGFTLNQDETECVDSRRGFCFTEVIQSLCQMVSSSRNLVTKSECCCDGGRGWGQQCDICPLPGTAQYKKLCPHGPGYTTDGRDIDECTVMPGMCHHGQCINSEGSYHCMCNNGY-------------------------TTDITRTGCV----------DLDECAQSPKPCNFICKNTEGSYQCACPRGYIMQEDGRTCRDLD-ECASKQHNCQFLCVNTIGGFTCKCPPGFT----QHHTACIDNNECVSQPGTCGSKGVCQNSPGSFSCECQKGFSLDNSGSNCE-DMDECSGNHRCQHG-CQNMLGGYRCGCPSGYL----QHFQWNQCVD------ENECTNPQVCGS-ASCYN--TLGSFKCACPNGYNFDQFSGGCNDVNECSHSKAPCNFG--CSNTEGGYLCGCPPGY 2624          

HSP 4 Score: 131.339 bits (329), Expect = 2.242e-30
Identity = 334/1321 (25.28%), Postives = 494/1321 (37.40%), Query Frame = 3
Query:  717 KYECQCPKNY-----LGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGN---TCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGG---TCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKN------GGICRDFDEDYQCICGNQWTG----KNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGF---EGKMCETSIDNCQ--KISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQN---NAKCIDLNNDYTCDCPEGLTGKNCE-INIDECTPN-------PCLNGA-----------------------------------RCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLN--VNNTRSGYKCICP------------------------------DGVQNCKKELS---KCKNIVCINGQ--------CVDVNNEEKCICIPGFEG-----RTCEIE-INECFNNP--CQHGSQCQDLFNDYLCICLPGFK----GKKCEININECAHNP--CGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYH-----CNCSTALGRYEGSKCEKDVDECNLDRTQL-----ALYGLAVLSMSNSQIGPCL------NDNQCINTNGSFICKCSSQYEGRQ----CEKXXXXXXXXXX-XXGATCDNLADGFRCRCVAGFTGERCE--IEINECQHNP--CSNDAKCIDHINDYQCICQSGFSG---KNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENY-IGTNCEHLKRPCDSNPCLNKGSCINRKVN--------QNTPGYLCNCRRGFTGPRCEIKMDW--CRG-NPCGDF------GVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGY-----GGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRG---VSGRF-CETIVDYCKKME--CQNGGICKNVIGDFECNCPKGF----AGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGY---GGERCKINSKKCQL---NVCKNNGICRPFEIDDRMSFKCECPPGV----GGLFCEIDYVNEC-LSTKCYNNGSCVNGFGKAICHCNKG 4076
             ++C+C + +     +  NC   + C  +NP    G   +  +G  KC C  G+  N   T   D+DEC S    LC NG  C+N +GSYQC C  G++        VD    T  NGG    C +  GSY C C   Y      + R+  ++  C++      GG C +   +Y+C+C + +      K C DV           +G CE+     + C C+ GF   +G    T +D C+    +C    +C N+    KC C+ G+ G+  +    +       N    AKC+++   +TC C +G +G     +++DEC  N        CLN A                                   +CE+  G F C C  G+     +     C     C     C N    NT+  + C CP                              DG  +C  E+       +  C  G+        C  VN  E  I  PG EG      T  +E I+EC   P  CQ G  CQ+ F  + C+C PGF+     ++CE +I+ECA+ P  CG  G C + V  + C C   Y      N       + CY        +   S++     C CS  +G+     C            QL       Y + + +     I  C        +  C+N  GSF C+C   +        CE            +  A C N    +RC C  G+T       I+ +EC   P  CS   +C D    Y+C+C +G+     +N  ++ ++C    C G+G C + V  F C C   + I  N          N C++K  C++   +         N   + C C  GF     E+  D   CR  N C  F      G C+    SF+C C   Y     E+K+ E C    +++  +E  +  +    G+C N    G F+C C SG+     G    +V ++ C S+     G+C         K      G  C +   + + + C      ++   +  +CP G   V GR      +D C      C NG  C N  G F C+CP G+    AG  C  D NEC                   +P G   CL+ PG F C+C   F      T    CE   +    P      C+N + +       + C+CP GY      R   +  +C+    N    N IC+        ++ C CPPG      G  C ID  NEC L      NG C+N  G   C CN+G
Sbjct: 1032 SFDCECMEGFESGFMMMKNCMDIDEC-ERNPLLCRGGTCVNTEGSFKCLCPPGHDLNEDGTVCLDVDEC-SLSGNLCRNG-RCVNMIGSYQCSCNTGYSATPDRQGCVDIDECTIMNGGCDTHCSNSDGSYECSCERGY--ALLPDTRSCSDIDECEDNPYLCDGGQCTNVPGEYRCLCYDGFISSVDMKTCSDVNECELNPNICIHGKCENTR-GSFICHCKVGFTVKKGSTGCTDVDECEIGAHNCDMHATCANVQGSFKCTCIEGYFGDGVKCQDVDECANGTHNCIPEAKCVNIPGTFTCVCRDGFSGDGQTCVDMDECAENVNLCEFGQCLNSAGGYRCECEMGFVPTVDGRSCKDIDECMFDNICVFGKCENVPGMFRCVCDPGY---EIDETGGNCTDKDECADPSNCFNGICTNTQGSFLCTCPADYQMSPSGQGCVGTDYRVGKCFLESTERGDGTLSCNVEIGIGISRSSCCCSLGRAWGAPCELCPVVNTTEYRILCPGGEGFRPNPYTVILEDIDECTELPGLCQ-GGNCQNTFGSFKCVCQPGFRFNEDNRQCE-DIDECANFPTVCG-PGTCYNIVGNYTCVCPPDYMQVNGGNNCMDMRKSFCYKTYDAAGCDNELSFNLTEKECCCSYNVGKAWNRPCVPCPTISTKAHNQLCGGVPPGYEIDINTGERIDIDECSKIQGICTNGMCVNLPGSFRCECPMGFLYNDIQIICEDINECASAEKMCQRNAECINSVGSYRCECSPGYTQTPFGLCIDRDECSEKPEICS-PGRCQDTEGSYRCMCPNGYKATEDQNMCMDVDECERQPC-GNGTCRNTVGSFNCLCFPGFEISAN----------NDCMDKDECVSLAAHVCKFGSCINNVGSFKCLCNEGF-----ELTADKKNCRDINECQQFRGMCAPGTCQNLEGSFRCMCPPGY-----EVKE-EACTD--IDECSSEEDLCMM----GSCLN--TFGSFECRCPSGFILSETGRKCYDVRVNYCFSE--FAQGKCSTPKPFNTSK-----AGCCCSMMPGDGWGDPCEPCPKQNEEEAYRLLCPYGPGTVVGRDDSREDLDECLANPGICANG-RCINTDGSFRCDCPMGYNLEAAGFKC-VDANECSIG----------------NPCGNGTCLNVPGGFECTCDDGFEPGPMMT----CEDLNECSLNPLLCAFRCVNNFGS-------YECMCPTGYVLREDRRMCKDQDECEEGLDNCASRNMICKNL----IGTYMCICPPGYTRRPDGEGC-IDE-NECRLKPGICENGRCINNVGSYKCVCNEG 2267          

HSP 5 Score: 116.701 bits (291), Expect = 6.117e-26
Identity = 266/1017 (26.16%), Postives = 378/1017 (37.17%), Query Frame = 3
Query:  801 VNGKCILANDGEVKCHCNKGYTGNTCS---NDIDECASYETPLCENGGTCINTVGSYQCKCKAGFN----GERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNG----GSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQN------NAKCIDLNNDYTCDCPEGLTGKNCE-INIDECTP--NPCLNGARCEDRVGGFTCQCLQGFV----GLRC----------ETKSDICKQLTPCKTEEI---CLNVNNTRSGYKC-ICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNP--CQHGSQCQDLFNDYLCICLPGF----KGKKCEININECA-HNPCGLNGQCIDEVYGFRCQC---MLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQY----EGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIE---------INECQHNPCSNDAKCIDHINDYQCICQSGFS-GKNCEI---------------------NDNDCTESSCL----GHGQCVDKVNGFECKCNENYIG----TNCEHLKRPCDS-NPCLNKGSCINRKVNQNTPG-YLCNCRRGFT----GPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYG----GSFCEVNIDDCA-SQPCINGGECGDGTGMYFCKCQPG----FQGVNCQVNTNECYS-NSCNTGKCIDQINNFSCVCPRGVS-GRFCE--TIVDYCKKMECQNGGICKNVIGDFECNCPKGF 3521
             NG C+    G  +C C  G+  N       DI+ECAS E  +C+    CIN+VGSY+C+C  G+     G   + D      + C  G  C D  GSYRC+CPN Y  T  +N              +C D DE  +  CGN                      G C +     + C+C  GFE       +D  + +S        GSCIN +   KC C  GFE    + N  +     CQ          C +L   + C CP G   K     +IDEC+   + C+ G+ C +  G F C+C  GF+    G +C          E     C    P  T +    C  +     G  C  CP      K+   +   ++C  G    V  ++               +++EC  NP  C +G +C +    + C C  G+     G KC ++ NEC+  NPCG NG C++   GF C C     P    TC + L+ C+ N       C+  N + SY C C T     E  +  KD DEC     +  L   A  +M             C N  G+++C C   Y    +G  C                 C N    ++C C  GFT  + E E           E   + C   +   + +   +C C  G   G+ C+I                     +  D  E + +     HGQC++    + C CN  Y      T C  L     S  PC          + +NT G Y C C RG+     G  C   +D C         +C   +  F CKC   +            C S               C   G C N P  G F C CQ G+     GS CE ++D+C+ +  C +G  C +  G Y C C  G    FQ   C V+ NEC +   C +  C + + +F C CP G +  +F      V+ C   +      C N  G + C CP G+
Sbjct: 1718 TNGMCVNL-PGSFRCECPMGFLYNDIQIICEDINECASAEK-MCQRNAECINSVGSYRCECSPGYTQTPFGLCIDRDECSEKPEICSPG-RCQDTEGSYRCMCPNGYKATEDQN--------------MCMDVDECERQPCGN----------------------GTCRNT-VGSFNCLCFPGFEISANNDCMDKDECVSLAAHVCKFGSCINNVGSFKCLCNEGFELTADKKNCRDI--NECQQFRGMCAPGTCQNLEGSFRCMCPPGYEVKEEACTDIDECSSEEDLCMMGS-CLNTFGSFECRCPSGFILSETGRKCYDVRVNYCFSEFAQGKCSTPKPFNTSKAGCCCSMMPGDGWGDPCEPCP------KQNEEEAYRLLCPYGPGTVVGRDDS------------REDLDECLANPGICANG-RCINTDGSFRCDCPMGYNLEAAGFKC-VDANECSIGNPCG-NGTCLNVPGGFECTCDDGFEPGPMMTCED-LNECSLNPLLCAFRCV--NNFGSYECMCPTGYVLREDRRMCKDQDEC-----EEGLDNCASRNMI------------CKNLIGTYMCICPPGYTRRPDGEGCIDENECRLKPGICENGRCINNVGSYKCVCNEGFTLNQDETECVDSRRGFCFTEVIQSLCQMVSSSRNLVTKSECCCDGGRGWGQQCDICPLPGTAQYKKLCPHGPGYTTDGRDIDECTVMPGMCHHGQCINSEGSYHCMCNNGYTTDITRTGCVDLDECAQSPKPC--------NFICKNTEGSYQCACPRGYIMQEDGRTCR-DLDECASKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNECVSQP-----------GTCGSKGVCQNSP--GSFSCECQKGFSLDNSGSNCE-DMDECSGNHRCQHG--CQNMLGGYRCGCPSGYLQHFQWNQC-VDENECTNPQVCGSASCYNTLGSFKCACPNGYNFDQFSGGCNDVNECSHSKAPCNFGCSNTEGGYLCGCPPGY 2624          

HSP 6 Score: 114.005 bits (284), Expect = 4.515e-25
Identity = 358/1449 (24.71%), Postives = 530/1449 (36.58%), Query Frame = 3
Query:  420 AISLNFCENHKCKNGATCQSDINGKYVCECAYGYK----GTYCEQKSNCPITP--CQNGGTCKLIAGNNVCQCLNEWV----GEFCEFSSNCASSPCRNGG----------IC---------KSLEIHKYECQCPKNYLGMNCE-------LPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYT---GNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTC---------------------------KNGGT----CLDKIGS-YRCVCPN--------NYFGTNCENKRTLCELKP--CKNGGICRDFDEDYQCICGNQWT----GKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCE----TSIDNCQKISCF-NGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDEC--TPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVN--NTRSGYKCICPDG------VQNCKKELSKCKN--IVCINGQCVDVNNEEKCICIPGF----EGRTCEIEINECFNNP--CQHGSQCQDLFNDYLCICLPGFKGKKCE---ININEC---AHNPCGLNGQCIDEVYGFRCQCMLPYSG--------PTCANKLDPCNPNA-CYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQY----EGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENY---------IGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPR----CEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVN-----IDDCASQPCING-GECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC----NTGKCIDQIN----NFSCVCPRGVSGRF------CETI---------------------------VDYCKKME--CQNGGICKNVIGDFECNCPKGFAGK----LCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGIC-LNKYQNEVGRNYNFSCICPNGYGGERCK---INSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNEC--------LSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQ 4151
            A++   C N +C+N         G Y C C  GY+    G  C     C +    C NG +C+   G+  C C   ++     E CE    C S+PC NG           +C         K++ I   +  C  N +   CE       L + C S         C      E+   C KG++   G  C  D++EC  +   +C N   CINT GS++C+C  G   E      +D   + C                           K  G     C +K  S Y  +CP         +  G +       C++ P  C NG  CR+    ++C C N +     GKNC D+      +     G C +     + C C  GFE           ID C++      GG+C+N     KC C PG                         DLN D          G  C +++DEC  + N C NG RC + +G + C C  G+           C  +  C       + +  N+   Y+C C  G       ++C  ++ +C++   +C  GQC +V  E +C+C  GF    + +TC  ++NEC  NP  C HG +C++    ++C C  GF  KK      +++EC   AHN C ++  C +    F+C C+  Y G          CAN    C P A C N    IPG    ++ C C       +G  C  D+DEC  +   L  +G                  QC+N+ G + C+C   +    +GR C+       +N C  G  C+N+   FRC C  G+       EI+E                           +G NC   D +C + S   +G C +    F C C  +Y         +GT+                G C      +      CN   G    R    C +   W  G PC    V  T      C     +              +  +E     + +  +C+  GNC N    G FKC CQ G+   F E N     ID+CA+ P + G G C +  G Y C C P +  VN   N  +   + C    +   C ++++       C C   V   +      C TI                           +D C K++  C N G+C N+ G F C CP GF       +CE DINEC      +A  +              EC++  G++ C C   +T    +T    C    +    P     IC   + Q+  G   ++ C+CPNGY     +   ++  +C+   C  NG CR    +   SF C C PG      EI   N+C        L+      GSC+N  G   C CN+G      E+T    N   I+  Q ++
Sbjct:  669 ALNPEICTNGQCENQL-------GTYRCVCNIGYESDITGKKCVDVDECMLRAHLCDNG-SCRNTPGSYTCACPAGYLFKHETEMCEDVDECESNPCINGNCQNTVGSFTCVCLPTSKLDQTKTICIESTKGTCWLNIIDNRCEVNVNGATLKSECCSTLGAAWGSPC---EPCELDTICPKGFSRAKGTQCE-DVNECEVFAG-ICVN-SRCINTAGSFKCECPPGHTLESTGRTCIDLRLENCYLSYEEEECEEPLAVRLRSDVCCCSLGKAWGPECEGCPEKGSSEYAFLCPRGPGYSNRGDPVGRHFFKDINECKVFPQMCSNGK-CRNTIGSFKCNCENGFVLDAEGKNCTDIDECKISHDICGMGTCVNTP-GSFDCECMEGFESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFKCLCPPGH------------------------DLNED----------GTVC-LDVDECSLSGNLCRNG-RCVNMIGSYQCSCNTGYSAT---PDRQGCVDIDECTIMNGGCDTHCSNSDGSYECSCERGYALLPDTRSC-SDIDECEDNPYLCDGGQCTNVPGEYRCLCYDGFISSVDMKTCS-DVNECELNPNICIHG-KCENTRGSFICHCKVGFTVKKGSTGCTDVDECEIGAHN-CDMHATCANVQGSFKCTCIEGYFGDGVKCQDVDECANGTHNCIPEAKCVN----IPG----TFTCVCRDGFSG-DGQTC-VDMDEC-AENVNLCEFG------------------QCLNSAGGYRCECEMGFVPTVDGRSCKDIDECMFDNICVFGK-CENVPGMFRCVCDPGY-------EIDE---------------------------TGGNCTDKD-ECADPSNCFNGICTNTQGSFLCTCPADYQMSPSGQGCVGTD-------------YRVGKCFLESTERGDGTLSCNVEIGIGISRSSCCCSLGRAW--GAPCELCPVVNTTEYRILCPGGEGF---------RPNPYTVILEDIDECTELPGLCQ-GGNCQN--TFGSFKCVCQPGF--RFNEDNRQCEDIDECANFPTVCGPGTCYNIVGNYTCVCPPDYMQVNGGNNCMDMRKSFCYKTYDAAGCDNELSFNLTEKECCCSYNVGKAWNRPCVPCPTISTKAHNQLCGGVPPGYEIDINTGERIDIDECSKIQGICTN-GMCVNLPGSFRCECPMGFLYNDIQIICE-DINEC-----ASAEKMCQR---------NAECINSVGSYRCECSPGYT----QTPFGLCIDRDECSEKP----EICSPGRCQDTEG---SYRCMCPNGYKATEDQNMCMDVDECERQPC-GNGTCR----NTVGSFNCLCFPGF-----EISANNDCMDKDECVSLAAHVCKFGSCINNVGSFKCLCNEGF-----ELTADKKNCRDINECQQFR 1922          

HSP 7 Score: 85.1149 bits (209), Expect = 2.446e-16
Identity = 221/909 (24.31%), Postives = 330/909 (36.30%), Query Frame = 3
Query:  453 CKNGATCQSDINGKYVCECAYGYKGT---YCEQKSNCPITP-CQNGGTCKLIAGNNVCQCLNEWVGE----FCEFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGV-------NGKCILANDGEVKCHCNKGYTGNTCS---NDIDECASYETPLCENGGTCINTVGSYQCKCKAGFN-GERCENDIVDCTN--DTCKNGGTCLDKIGSYRCVCPNNYF----GTNCENKRTLCELKPCKNG--GICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQD----YKCICQRGFEGKM----CETSIDNCQKIS--CFNGGSCINMIEGGKCNCLPGFXXXXX----XXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTG---KNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLR-----CETKSDICKQLTPCKTEE-ICLNVNNTRSGYKCICPDGV------QNCKKELS-KCKNIVCINGQCVDVNNEEKCICIPGFEGRTCEIE---------INECFNNPCQHGSQCQDLFNDYLCICLPGFK-GKKCEI------------------------NINECAHNPCGL--NGQCIDEVYGFRCQCMLPYSGPT----------CANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGP--------CLNDNQCI-------------NTNGSFICKCSSQYE----GRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAG----FTGERCEIE----------------------------------------INECQHNPCSNDAKCIDHINDYQCICQSGF 2663
            C+  A C + + G Y CEC+ GY  T    C  +  C   P   + G C+   G+  C C N +        C     C   PC NG  C++  +  + C C   + G      N C  ++ C          G CI  N G  KC CN+G+          DI+EC  +   +C  G TC N  GS++C C  G+   E    DI +C++  D C  G +CL+  GS+ C CP+ +     G  C + R          G     + F+      C +   G    D               CE    Q+    Y+ +C  G    +        +D C      C NG  CIN     +C+C  G+                   PC  N  C+++   + C C +G        CE +++EC+ NP L   RC +  G + C C  G+V LR     C+ + +  + L  C +   IC N+  T   Y CICP G       + C  E   + K  +C NG+C++     KC+C  GF     E E           E   + CQ  S  ++L     C C  G   G++C+I                        +I+EC   P G+  +GQCI+    + C C   Y+             CA    PCN        IC   N   SY C C       E  +  +D+DEC   +       +  +     +  P        C+++N+C+             N+ GSF C+C   +     G  CE       N+ C++G  C N+  G+RC C +G    F   +C  E                                        +NEC H+    +  C +    Y C C  G+
Sbjct: 1759 CQRNAECINSV-GSYRCECSPGYTQTPFGLCIDRDECSEKPEICSPGRCQDTEGSYRCMCPNGYKATEDQNMCMDVDECERQPCGNG-TCRNT-VGSFNCLC---FPGFEISANNDCMDKDECVSLAAHVCKFGSCI-NNVGSFKCLCNEGFELTADKKNCRDINECQQFRG-MCAPG-TCQNLEGSFRCMCPPGYEVKEEACTDIDECSSEEDLCMMG-SCLNTFGSFECRCPSGFILSETGRKCYDVRVNYCFSEFAQGKCSTPKPFNTSKAGCCCSMMPGDGWGDP--------------CEPCPKQNEEEAYRLLCPYGPGTVVGRDDSREDLDECLANPGICANG-RCINTDGSFRCDCPMGYNLEAAGFKCVDANECSIGNPC-GNGTCLNVPGGFECTCDDGFEPGPMMTCE-DLNECSLNPLLCAFRCVNNFGSYECMCPTGYV-LREDRRMCKDQDECEEGLDNCASRNMICKNLIGT---YMCICPPGYTRRPDGEGCIDENECRLKPGICENGRCINNVGSYKCVCNEGFTLNQDETECVDSRRGFCFTEVIQSLCQMVSSSRNLVTKSECCCDGGRGWGQQCDICPLPGTAQYKKLCPHGPGYTTDGRDIDECTVMP-GMCHHGQCINSEGSYHCMCNNGYTTDITRTGCVDLDECAQSPKPCN-------FIC--KNTEGSYQCACPRGYIMQEDGRTCRDLDECASKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNECVSQPGTCGSKGVCQNSPGSFSCECQKGFSLDNSGSNCEDMDECSGNHRCQHG--CQNMLGGYRCGCPSGYLQHFQWNQCVDENECTNPQVCGSASCYNTLGSFKCACPNGYNFDQFSGGCNDVNECSHSKAPCNFGCSNTEGGYLCGCPPGY 2624          

HSP 8 Score: 81.2629 bits (199), Expect = 3.246e-15
Identity = 218/899 (24.25%), Postives = 335/899 (37.26%), Query Frame = 3
Query: 1758 NTRSGYKCICPDGVQ------NCKKELSKCKNIVCINGQCVDVNNEEKCICIPGF----EGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPG----FKGKKCEININECAHNPCGLNGQCIDEVYG--FRCQCMLPYSGPTCANKLDPCNPNACYNDA-ICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYE----GRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFT----GERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCN----CRRGFTGPRCEIKMDWCRGNPCGDFGVCET------------DLDSFKCKC----NSEYIGERCEIKKTETCK-SYA--------VEKFKNESLINKICKHHG-NCFNDPETG----GFKCSCQSGYG------GSFCEVNIDDCASQPCI-NGGECGDGTGMYFCKCQPGF----QGVNCQVNTNEC--YSNSCNTGKCIDQINNFSCVCPRGVSGRFCETI----VDYCKK--MECQNGGICKNVIGDFECNCPKGF----AGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCE---TRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQ-LNVCKNNGICRPFEIDDRM------SFKCECPPGVGGLFCEIDY-----VNEC-LSTKCYNNGSCVNGFGKAICHC------NKGSCG----EKCEITGSACNLASI 4130
            NT   ++CIC  G +      NC          +C+NG C++ +   KCIC PGF     GR C ++I+EC  +      +C +    + C C PG      G+ C             ++       YG     +C+ P+ G    ++    NPN  + +  +  P    D Y   C T      G    KD++EC L                N +I  C N  QC N  G++ C C+  YE    G++C             +  +C N    + C C AG+      E CE +++EC+ NPC N   C + +  + C+C           +  D T++ C+   +    +N  + +C  N  G     LK  C          C        +P   C     C +GF+           +G  C D   CE                SFKC+C      E  G  C   + E C  SY           + +++     + K  G  C   PE G     F C    GY       G     +I++C   P + + G+C +  G + C C+ GF    +G NC  + +EC    + C  G C++   +F C C  G    F        +D C++  + C+ GG C N  G F+C CP G      G +C  D++EC       + NL  N            C++  G++ CSC   ++          ID C             NG C     N  G   ++ C C  GY       +++ C  ++ C++N    P+  D          ++C C     G    +D      VNEC L+     +G C N  G  ICHC       KGS G    ++CEI    C++ + 
Sbjct:  490 NTEGSFQCICNAGFELTADGRNCLDHDECSTTNMCLNGMCINEDGSFKCICKPGFYLVPSGRYC-LDIDECQTHGICMNGRCINTEGSFKCECPPGMIVSMDGRLC-------------IDTHMRSTCYGDYMMGKCLTPFPGANTKSECCCANPNFAFGEPCLPCPAVNSDDYKMLCPTPGFDNGG----KDINECAL----------------NPEI--CTN-GQCENQLGTYRCVCNIGYESDITGKKCVDVDECMLRAHLCDNGSCRNTPGSYTCACPAGYLFKHETEMCE-DVDECESNPCIN-GNCQNTVGSFTCVCLP--------TSKLDQTKTICIESTKGTCWLNIIDNRCEVNVNGAT---LKSEC----------CSTLGAAWGSPCEPCELDTICPKGFS---------RAKGTQCEDVNECEVFAGICVNSRCINTAGSFKCECPPGHTLESTGRTCIDLRLENCYLSYEEEECEEPLAVRLRSDVCCCSLGKAWGPECEGCPEKGSSEYAFLCPRGPGYSNRGDPVGRHFFKDINECKVFPQMCSNGKCRNTIGSFKCNCENGFVLDAEGKNC-TDIDECKISHDICGMGTCVNTPGSFDCECMEGFESGFMMMKNCMDIDECERNPLLCR-GGTCVNTEGSFKCLCPPGHDLNEDGTVC-LDVDECSL-----SGNLCRNGR----------CVNMIGSYQCSCNTGYSATPDRQGCVDIDECTIM----------NGGCDTHCSNSDG---SYECSCERGYA---LLPDTRSCSDIDECEDN----PYLCDGGQCTNVPGEYRCLC---YDGFISSVDMKTCSDVNECELNPNICIHGKCENTRGSFICHCKVGFTVKKGSTGCTDVDECEIGAHNCDMHAT 1278          

HSP 9 Score: 64.6994 bits (156), Expect = 3.483e-10
Identity = 79/235 (33.62%), Postives = 105/235 (44.68%), Query Frame = 3
Query:  444 NHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPI--TPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGS-----QNPCGVNGKCILANDGEVKCH-CNKGYTGNTCS---NDIDECASYETPLCENGGTCINTVGSYQCKCKAGFN----GERCENDIVDC-TNDTCKNGGTCLDKIGSYRCVCPNNY 1100
            N +C NG +C  D      C C  GY GT+C Q    P+  T CQNGG C    G N C C+  + G  CE   +  + PC         ++    CQ      G+ C     C +      +PC V            + H C +G+  N  +    D+DEC +   P    GGTC+NTVGSY+CKC  G       ++CE DI +C T     NGG C + IGSY C CP  +
Sbjct:   65 NIRCMNGGSCADDH-----CSCGKGYTGTHCGQ----PVCDTGCQNGGRC---IGPNRCACVYGFTGPHCE--RDYRTGPCFT-------QVSNQMCQ--GQVSGIVCTKGLCCATIGRAWGHPCEVC---------PAQPHPCRRGFIPNIRTGACQDVDECQA--IPGMCKGGTCVNTVGSYECKCPLGHKQSELSQQCE-DIDECETIPGICNGGECKNTIGSYFCNCPAGF 264          
BLAST of Neurogenic locus notch protein vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 56.6102 bits (135), Expect = 4.420e-8
Identity = 44/163 (26.99%), Postives = 68/163 (41.72%), Query Frame = 3
Query: 5724 TLLHLAAKYNRKEAARFLLEAGSDPNKLELNGRSCLMTAIDAGALEVVAFFLEQQTFVIDLHQKGPNGSTCLIQAVKEAXXXXXXXXXXXXXXXXCDLNVTDEYGRTALHWAAITGQAAVVHLLLSYGLNRDAQDNEEATPLYLACKEGVIEVCKILIANGAN 6212
            T LH AA+Y       FLL+ G+DP   +  G + L  ++++  + +V + L       ++  KG                               D++  D  GRT+L WAA  G +  V  LL +G +    D E  TPL+    +G   V K LI +GA+
Sbjct:  145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVL------FNVVSKG-----------------------------LLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGAD 272          

HSP 2 Score: 50.8322 bits (120), Expect = 2.456e-6
Identity = 24/63 (38.10%), Postives = 39/63 (61.90%), Query Frame = 3
Query: 6042 TALHWAAITGQAAVVHLLLSYGLNRDAQDNE-EATPLYLACKEGVIEVCKILIANGANPDMSD 6227
            T LHWA+I  + +VV  L+S G + +A+     ATPL+ A + G + +   L+ +GA+P M+D
Sbjct:  111 TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTD 173          
BLAST of Neurogenic locus notch protein vs. Ensembl Nematostella
Match: EDO39165 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB01])

HSP 1 Score: 585.104 bits (1507), Expect = 4.713e-178
Identity = 402/1163 (34.57%), Postives = 569/1163 (48.93%), Query Frame = 3
Query:  801 VNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAV----------------------LSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKIC 4211
            +NG         + C C  G+TG +C  D+DEC   +   C NG TCI+ V S++C C  GF+G  CE +  DC ++ C+N  TC D I  + C CP    G  C      C+  PCK+ G C+++   + C+C + ++G  C+   N C  +PC N G C      +YKCIC  GF G+ C+ +ID C    C NG +C ++++  +C C PGF+G NCE N+NEC    C N + CIDL N Y C C  G TG++C+++IDEC  NPC +G+ C D V  + C C  G+ G  C    D C    PC    +CL++    S + C CP G   ++C   +  C +  C +G  C+D+ N+ KC C+ G+ G+ C I+INEC +NPCQ+G  C +L N Y C+C+ G+ G  CE +I++C  NPC  NG C D V  ++C C       TCA     C+   C N   C   N    Y C C      Y G  CE  ++ C       + YG A                       +++   +  PC N   C +    F C C + ++GR C   +N C  +PC N A C ++  G+RC C +G+TG RCE +I+EC  +PC N   C+D+ N ++C+C  G+ G  CEIN +DC    CL +G C D VN F C C   Y G  CE     C  +PC + GSC +  VN    GYLC+C  GF G +CE  +D C  NPC + G C   + S+ C C   + G RCE    +   S  +       LIN                 F C+C +GY G  C +N+DDC  QPC  GG C D    Y C C PGF G+NC +  +EC S  C N G C+D  N  +C C  G +G+FCE  +D C    CQN G C++++ DF C+C  GF G+ C T I+ C+ +              PC    T   +D    + CSC    TG++C+  I          + PC NNG C       V     + C+C + +   +C+ +   C+   C N   C    +D   ++KC C  G  G  CE+  ++ C S  C N  +CV+  G   C C  G  G  CE   + C +   D + T+   I   +   C SK    +C
Sbjct:   24 LNGGTCSEGSNSLLCSCLPGFTGQSCETDVDECKLVQ---CHNGATCIDQVNSFKCICPVGFHGILCETNYNDCHSNPCQNNATCQDLINDFSCQCPQGITGQTCNTDIDECQSSPCKHQGTCQNYLGGFNCLCRHGYSGITCEVDVNECSSSPCVNGGVCAD-GLGEYKCICPSGFSGENCQVNIDECASSPCKNGATCEDLVDEFRCQCQPGFKGQNCETNINECIGAACANGSTCIDLVNAYQCTCLPGFTGRHCDVDIDECQSNPCQHGSACMDGVSSYQCICQPGYTGQYCHIDIDECLS-RPCLNNGMCLDL---VSDFHCTCPTGFSGKDCSVNIDDCADAPCQHGSTCIDLVNDYKCSCLQGYTGKDCHIDINECSSNPCQYGGTCLNLLNGYACLCIDGYTGLNCEKDIDDCLFNPCH-NGTCEDLVNNYKCVCPDNRQERTCAGNSSVCDTYLCRNGGSCFSNNST-YYTCECPKG---YTGHDCESKINYCK----SSSCYGNATCLDGANNYTCICPRGFTGTLCDVNVDECEDSPCANGASCEDLINDFRCHCPAGFQGRTCAVDINECATSPCLNEAKCTDVVSGYRCTCRSGYTGTRCERDIDECSSSPCVNGGLCVDYTNYFECLCHPGYGGDRCEINIDDCANKPCLHNGNCTDYVNYFTCACAVGYTGRTCEVNIDDCSPSPCRHGGSCQDL-VN----GYLCHCPAGFKGSKCETDIDECATNPCDNNGTCVDRVASYDCVCKPGFTGTRCEANIDDCATSPCLNNAICTDLIND----------------FHCACPAGYQGQTCAINVDDCTPQPCKQGGTCVDAVSGYTCLCMPGFTGINCSIEMDECGSYPCLNNGTCVDGRNRVTCTCAVGFTGQFCEVNIDDCDPAPCQNYGTCQDLVADFTCHCYPGFTGETCATPIDLCEAH--------------PCQNNATCR-MDPLKGYSCSCPTGVTGRHCDVSI--------CDSKPCRNNGSC-------VLTQSGYQCLCASSFTSPQCQRSIDDCEHAHCLNGATC----VDSDNAYKCSCLEGYYGKHCEL--IDRCHSQPCQNGATCVDDDGVVFCKCAMGFTGTHCEKEFNHCIVRVADTNLTFPSRICG-DHGTCVSKPTGFLC 1111          

HSP 2 Score: 584.334 bits (1505), Expect = 9.073e-178
Identity = 405/1172 (34.56%), Postives = 565/1172 (48.21%), Query Frame = 3
Query:  417 IAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQ-----------------------------------------NCKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTE----------TCKSYAVE-------KFKNESLINKI-------CKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEK 3725
            I  S  FC++  C NG TC    N   +C C  G+ G  CE   + C +  C NG TC     +  C C   + G  CE + N C S+PC+N   C+ L I+ + CQCP+   G  C         +PC   G C     G   C C  GY+G TC  D++EC+S     C NGG C + +G Y+C C +GF+GE C+ +I +C +  CKNG TC D +  +RC C   + G NCE     C    C NG  C D    YQC C   +TG++CD V      +    +G         Y+CICQ G+ G+ C   ID C    C N G C++++    C C  GF G +C +N+++C + PCQ+ + CIDL NDY C C +G TGK+C I+I+EC+ NPC  G  C + + G+ C C+ G+ GL CE   D C    PC        VNN    YKC+CPD  Q                                         +C+ +++ CK+  C  N  C+D  N   CIC  GF G  C++ ++EC ++PC +G+ C+DL ND+ C C  GF+G+ C ++INECA +PC    +C D V G+RC C   Y+G  C   +D C+ + C N  +C+    Y  + C C    G   G +CE ++D+C                       PCL++  C +    F C C+  Y GR CE  +++C  +PCR+G +C +L +G+ C C AGF G +CE +I+EC  NPC N+  C+D +  Y C+C+ GF+G  CE N +DC  S CL +  C D +N F C C   Y G  C      C   PC   G+C++        GY C C  GFTG  C I+MD C   PC + G C    +   C C   + G+ CE+   +          TC+    +        F  E+    I       C+++  C  DP   G+ CSC +G  G  C+V+I  C S+PC N G C      Y C C   F    CQ + ++C    C N   C+D  N + C C  G  G+ CE ++D C    CQNG  C +  G   C C  GF G  CE + N C   +A   TNL + P   C   GT  C+ +P  F C C+  FTG  C+T ID C  
Sbjct:   11 IGASGRFCQHDSCLNGGTCSEGSN-SLLCSCLPGFTGQSCETDVDECKLVQCHNGATCIDQVNSFKCICPVGFHGILCETNYNDCHSNPCQNNATCQDL-INDFSCQCPQGITGQTCNTDIDECQSSPCKHQGTC-QNYLGGFNCLCRHGYSGITCEVDVNECSSSP---CVNGGVCADGLGEYKCICPSGFSGENCQVNIDECASSPCKNGATCEDLVDEFRCQCQPGFKGQNCETNINECIGAACANGSTCIDLVNAYQCTCLPGFTGRHCD-VDIDECQSNPCQHGSACMDGVSSYQCICQPGYTGQYCHIDIDECLSRPCLNNGMCLDLVSDFHCTCPTGFSGKDCSVNIDDCADAPCQHGSTCIDLVNDYKCSCLQGYTGKDCHIDINECSSNPCQYGGTCLNLLNGYACLCIDGYTGLNCEKDIDDCL-FNPCHNGTCEDLVNN----YKCVCPDNRQERTCAGNSSVCDTYLCRNGGSCFSNNSTYYTCECPKGYTGHDCESKINYCKSSSCYGNATCLDGANNYTCICPRGFTGTLCDVNVDECEDSPCANGASCEDLINDFRCHCPAGFQGRTCAVDINECATSPCLNEAKCTDVVSGYRCTCRSGYTGTRCERDIDECSSSPCVNGGLCVDYTNY--FECLCHPGYG---GDRCEINIDDC--------------------ANKPCLHNGNCTDYVNYFTCACAVGYTGRTCEVNIDDCSPSPCRHGGSCQDLVNGYLCHCPAGFKGSKCETDIDECATNPCDNNGTCVDRVASYDCVCKPGFTGTRCEANIDDCATSPCLNNAICTDLINDFHCACPAGYQGQTCAINVDDCTPQPCKQGGTCVDA-----VSGYTCLCMPGFTGINCSIEMDECGSYPCLNNGTCVDGRNRVTCTCAVGFTGQFCEVNIDDCDPAPCQNYGTCQDLVADFTCHCYPGFTGETCATPIDLCEAHPCQNNATCRMDP-LKGYSCSCPTGVTGRHCDVSI--CDSKPCRNNGSCVLTQSGYQCLCASSFTSPQCQRSIDDCEHAHCLNGATCVDSDNAYKCSCLEGYYGKHCE-LIDRCHSQPCQNGATCVDDDGVVFCKCAMGFTGTHCEKEFNHCIVRVAD--TNL-TFPSRICGDHGT--CVSKPTGFLCVCQPGFTGLLCQTDIDDCSS 1131          

HSP 3 Score: 507.294 bits (1305), Expect = 5.945e-151
Identity = 347/979 (35.44%), Postives = 506/979 (51.69%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCI-LANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCI-NGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLD--------------RTQLALYGLA----VLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKC-IDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCIN-GGECGDGTGMYFCK 3281
            ++++ C +  CKNGATC+ D+  ++ C+C  G+KG  CE   N C    C NG TC  +     C CL  + G  C+   + C S+PC++G  C    +  Y+C C   Y G  C +        PC  NG C+ L +D    C C  G++G  CS +ID+CA  + P C++G TCI+ V  Y+C C  G+ G+ C  DI +C+++ C+ GGTCL+ +  Y C+C + Y G NCE     C   PC N G C D   +Y+C+C +    + C    + C    C+N G C S N   Y C C +G+ G  CE+ I+ C+  SC+   +C++      C C  GF G  C++NV+ECE+ PC N A C DL ND+ C CP G  G+ C ++I+EC  +PCLN A+C D V G+ C C  G+ G RCE   D C   +PC    +C++  N    ++C+C  G     C+  +  C N  C+ NG C D  N   C C  G+ GRTCE+ I++C  +PC+HG  CQDL N YLC C  GFKG KCE +I+ECA NPC  NG C+D V  + C C   ++G  C   +D C  + C N+AIC   +  + +HC C      Y+G  C  +VD+C                  T L + G       + M      PCLN+  C++      C C+  + G+ CE  +++C   PC+N  TC +L   F C C  GFTGE C   I+ C+ +PC N+A C +D +  Y C C +G +G++C++  + C    C  +G CV   +G++C C  ++    C+     C+   CLN  +C++         Y C+C  G+ G  CE+ +D C   PC +   C  D     CKC   + G  CE K+   C     +   N +  ++IC  HG C + P   GF C CQ G+ G  C+ +IDDC+S PC+     C DG   + C+
Sbjct:  203 VNIDECASSPCKNGATCE-DLVDEFRCQCQPGFKGQNCETNINECIGAACANGSTCIDLVNAYQCTCLPGFTGRHCDVDIDECQSNPCQHGSACMD-GVSSYQCICQPGYTGQYCHIDIDECLSRPCLNNGMCLDLVSD--FHCTCPTGFSGKDCSVNIDDCA--DAP-CQHGSTCIDLVNDYKCSCLQGYTGKDCHIDINECSSNPCQYGGTCLNLLNGYACLCIDGYTGLNCEKDIDDCLFNPCHN-GTCEDLVNNYKCVCPDNRQERTCAGNSSVCDTYLCRNGGSCFSNNSTYYTCECPKGYTGHDCESKINYCKSSSCYGNATCLDGANNYTCICPRGFTGTLCDVNVDECEDSPCANGASCEDLINDFRCHCPAGFQGRTCAVDINECATSPCLNEAKCTDVVSGYRCTCRSGYTGTRCERDIDECSS-SPCVNGGLCVDYTNY---FECLCHPGYGGDRCEINIDDCANKPCLHNGNCTDYVNYFTCACAVGYTGRTCEVNIDDCSPSPCRHGGSCQDLVNGYLCHCPAGFKGSKCETDIDECATNPCDNNGTCVDRVASYDCVCKPGFTGTRCEANIDDCATSPCLNNAICT--DLINDFHCACPAG---YQGQTCAINVDDCTPQPCKQGGTCVDAVSGYTCLCMPGFTGINCSIEMDECGSYPCLNNGTCVDGRNRVTCTCAVGFTGQFCEVNIDDCDPAPCQNYGTCQDLVADFTCHCYPGFTGETCATPIDLCEAHPCQNNATCRMDPLKGYSCSCPTGVTGRHCDV--SICDSKPCRNNGSCVLTQSGYQCLCASSFTSPQCQRSIDDCEHAHCLNGATCVDSD-----NAYKCSCLEGYYGKHCEL-IDRCHSQPCQNGATCVDDDGVVFCKCAMGFTGTHCE-KEFNHCIVRVAD--TNLTFPSRICGDHGTCVSKPT--GFLCVCQPGFTGLLCQTDIDDCSSDPCVGINVTCVDGIDTFTCQ 1151          

HSP 4 Score: 385.571 bits (989), Expect = 3.084e-110
Identity = 276/829 (33.29%), Postives = 388/829 (46.80%), Query Frame = 3
Query: 1797 VQNCKKELSKCKNIVCING-QCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQP-------------------------------------CINGGECGDGTGMYF-CKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEIS 4163
            V N       C++  C+NG  C + +N   C C+PGF G++CE +++EC    C +G+ C D  N + CIC  GF G  CE N N+C  NPC  N  C D +  F CQC    +G TC   +D C  + C +   C   N    ++C C      Y G  CE DV+EC+                      PC+N   C +  G + C C S + G  C+  ++ C ++PC+NGATC++L D FRC+C  GF G+ CE  INEC    C+N + CID +N YQC C  GF+G++C+++ ++C  + C     C+D V+ ++C C   Y G  C      C S PCLN G C++   +     + C C  GF+G  C + +D C   PC     C   ++ +KC C   Y G+ C I   E C S               C++ G C N     G+ C C  GY G  CE +IDDC   P                                     C NGG C      Y+ C+C  G+ G +C+   N C S+SC     C+D  NN++C+CPRG +G  C+  VD C+   C NG  C+++I DF C+CP GF G+ C  DINEC  +              PC      +C D    + C+C+  +TG  CE  ID C         PC N G+C++        NY F C+C  GYGG+RC+IN   C    C +NG C     D    F C C  G  G  CE++ +++C  + C + GSC +     +CHC  G  G KCE     C     DN+ T  D ++
Sbjct:    8 VMNIGASGRFCQHDSCLNGGTCSEGSNSLLCSCLPGFTGQSCETDVDECKLVQCHNGATCIDQVNSFKCICPVGFHGILCETNYNDCHSNPCQNNATCQDLINDFSCQCPQGITGQTCNTDIDECQSSPCKHQGTC--QNYLGGFNCLCRHG---YSGITCEVDVNECS--------------------SSPCVNGGVCADGLGEYKCICPSGFSGENCQVNIDECASSPCKNGATCEDLVDEFRCQCQPGFKGQNCETNINECIGAACANGSTCIDLVNAYQCTCLPGFTGRHCDVDIDECQSNPCQHGSACMDGVSSYQCICQPGYTGQYCHIDIDECLSRPCLNNGMCLDLVSD-----FHCTCPTGFSGKDCSVNIDDCADAPCQHGSTCIDLVNDYKCSCLQGYTGKDCHIDINE-CSS-------------NPCQYGGTCLN--LLNGYACLCIDGYTGLNCEKDIDDCLFNPCHNGTCEDLVNNYKCVCPDNRQERTCAGNSSVCDTYLCRNGGSCFSNNSTYYTCECPKGYTGHDCESKINYCKSSSCYGNATCLDGANNYTCICPRGFTGTLCDVNVDECEDSPCANGASCEDLINDFRCHCPAGFQGRTCAVDINECATS--------------PC--LNEAKCTDVVSGYRCTCRSGYTGTRCERDIDECSSS------PCVNGGLCVDY------TNY-FECLCHPGYGGDRCEINIDDCANKPCLHNGNC----TDYVNYFTCACAVGYTGRTCEVN-IDDCSPSPCRHGGSCQDLVNGYLCHCPAGFKGSKCETDIDECATNPCDNNGTCVDRVA 756          

HSP 5 Score: 308.531 bits (789), Expect = 3.040e-85
Identity = 212/640 (33.12%), Postives = 309/640 (48.28%), Query Frame = 3
Query: 2331 LAVLSMSNS----QIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYA 4235
            L V+++  S    Q   CLN   C   + S +C C   + G+ CE  ++ C+   C NGATC +  + F+C C  GF G  CE   N+C  NPC N+A C D IND+ C C  G +G+ C  + ++C  S C   G C + + GF C C   Y G  CE     C S+PC+N G C +         Y C C  GF+G  C++ +D C  +PC +   CE  +D F+C+C   + G+ CE    E               I   C +   C +      ++C+C  G+ G  C+V+ID+C S PC +G  C DG   Y C CQPG+ G  C ++ +EC S  C N G C+D +++F C CP G SG+ C   +D C    CQ+G  C +++ D++C+C +G+ GK C  DINEC  N              PC   GT  CL+    + C C   +TG  CE  ID C  F      PC +NG C +          N+ C+CP+      C  NS  C   +C+N G C     ++   + CECP G  G  CE   +N C S+ CY N +C++G     C C +G  G  C++    C  +   N  + +D I+D   + C +    + C ++ N+ A
Sbjct:    6 LPVMNIGASGRFCQHDSCLNGGTCSEGSNSLLCSCLPGFTGQSCETDVDECKLVQCHNGATCIDQVNSFKCICPVGFHGILCETNYNDCHSNPCQNNATCQDLINDFSCQCPQGITGQTCNTDIDECQSSPCKHQGTCQNYLGGFNCLCRHGYSGITCEVDVNECSSSPCVNGGVCAD-----GLGEYKCICPSGFSGENCQVNIDECASSPCKNGATCEDLVDEFRCQCQPGFKGQNCETNINE--------------CIGAACANGSTCID--LVNAYQCTCLPGFTGRHCDVDIDECQSNPCQHGSACMDGVSSYQCICQPGYTGQYCHIDIDECLSRPCLNNGMCLDLVSDFHCTCPTGFSGKDCSVNIDDCADAPCQHGSTCIDLVNDYKCSCLQGYTGKDCHIDINECSSN--------------PCQYGGT--CLNLLNGYACLCIDGYTGLNCEKDIDDC-LFN-----PC-HNGTCEDLVN-------NYKCVCPDNRQERTCAGNSSVCDTYLCRNGGSCFS---NNSTYYTCECPKGYTGHDCE-SKINYCKSSSCYGNATCLDGANNYTCICPRGFTGTLCDVNVDECEDSPCANGASCEDLINDFRCH-CPAGFQGRTCAVDINECA 589          

HSP 6 Score: 286.96 bits (733), Expect = 2.315e-78
Identity = 213/583 (36.54%), Postives = 285/583 (48.89%), Query Frame = 3
Query:  420 AISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKC-IDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKEL-SKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECF-----------NNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPC-GLNGQCIDEVYGFRCQ 2117
            A+ +N C    C N A C +D+   Y C C  GY GT CE+  + C  +PC NGG C        C C   + G+ CE +  +CA+ PC + G C    ++ + C C   Y G  CE+     S +PC   G C    +G + CHC  G+ G+ C  DIDECA   T  C+N GTC++ V SY C CK GF G RCE +I DC    C N   C D I  + C CP  Y G  C      C  +PCK GG C D    Y C+C   +TG NC    + C   PC NNG C         C C  GF G+ CE +ID+C    C N G+C +++    C+C PGF G  C   ++ CE  PCQNNA C +D    Y+C CP G+TG++C+++I  C   PC N   C     G+ C C   F   +C+   D C+    C     C++ +N    YKC C +G      EL  +C +  C NG  CVD +    C C  GF G  CE E N C            +  C     C      +LC+C PGF G  C+ +I++C+ +PC G+N  C+D +  F CQ
Sbjct:  582 AVDINECATSPCLNEAKC-TDVVSGYRCTCRSGYTGTRCERDIDECSSSPCVNGGLCVDYTNYFECLCHPGYGGDRCEINIDDCANKPCLHNGNCTDY-VNYFTCACAVGYTGRTCEVNIDDCSPSPCRHGGSCQDLVNGYL-CHCPAGFKGSKCETDIDECA---TNPCDNNGTCVDRVASYDCVCKPGFTGTRCEANIDDCATSPCLNNAICTDLINDFHCACPAGYQGQTCAINVDDCTPQPCKQGGTCVDAVSGYTCLCMPGFTGINCSIEMDECGSYPCLNNGTCVD-GRNRVTCTCAVGFTGQFCEVNIDDCDPAPCQNYGTCQDLVADFTCHCYPGFTGETCATPIDLCEAHPCQNNATCRMDPLKGYSCSCPTGVTGRHCDVSI--CDSKPCRNNGSCVLTQSGYQCLCASSFTSPQCQRSIDDCEH-AHCLNGATCVDSDN---AYKCSCLEGYYGKHCELIDRCHSQPCQNGATCVDDDGVVFCKCAMGFTGTHCEKEFNHCIVRVADTNLTFPSRICGDHGTCVSKPTGFLCVCQPGFTGLLCQTDIDDCSSDPCVGINVTCVDGIDTFTCQ 1151          

HSP 7 Score: 224.557 bits (571), Expect = 7.119e-59
Identity = 161/471 (34.18%), Postives = 217/471 (46.07%), Query Frame = 3
Query: 2766 NENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKI------------------------CKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNP--HGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCE 4097
            N N    N     R C  + CLN G+C     ++ +   LC+C  GFTG  CE  +D C+   C +   C   ++SFKC C   + G  CE    +   +        + LIN                          CKH G C N    GGF C C+ GY G  CEV++++C+S PC+NGG C DG G Y C C  GF G NCQVN +EC S+ C  G  C D ++ F C C  G  G+ CET ++ C    C NG  C +++  ++C C  GF G+ C+ DI+EC+           SNP  HG         C+D   ++ C C+  +TG+YC   ID C         PC NNG+CL+          +F C CP G+ G+ C +N   C    C++   C    ID    +KC C  G  G  C ID +NEC S  C   G+C+N      C C  G  G  CE
Sbjct:    3 NNNLPVMNIGASGRFCQHDSCLNGGTC-----SEGSNSLLCSCLPGFTGQSCETDVDECKLVQCHNGATCIDQVNSFKCICPVGFHGILCETNYNDCHSNPCQNNATCQDLINDFSCQCPQGITGQTCNTDIDECQSSPCKHQGTCQN--YLGGFNCLCRHGYSGITCEVDVNECSSSPCVNGGVCADGLGEYKCICPSGFSGENCQVNIDECASSPCKNGATCEDLVDEFRCQCQPGFKGQNCETNINECIGAACANGSTCIDLVNAYQCTCLPGFTGRHCDVDIDECQ-----------SNPCQHGS-------ACMDGVSSYQCICQPGYTGQYCHIDIDECLSR------PCLNNGMCLDLVS-------DFHCTCPTGFSGKDCSVNIDDCADAPCQHGSTC----IDLVNDYKCSCLQGYTGKDCHID-INECSSNPCQYGGTCLNLLNGYACLCIDGYTGLNCE 430          

HSP 8 Score: 201.06 bits (510), Expect = 1.517e-51
Identity = 160/497 (32.19%), Postives = 226/497 (45.47%), Query Frame = 3
Query:  423 ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICR-DFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCE-------------------------------------------------INIDECTPNPCLN-GARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNV 1754
            ++++ C    C++G +CQ  +NG Y+C C  G+KG+ CE   + C   PC N GTC     +  C C   + G  CE +  +CA+SPC N  IC  L I+ + C CP  Y G  C +     +  PC   G C+ A  G   C C  G+TG  CS ++DEC SY    C N GTC++      C C  GF G+ CE +I DC    C+N GTC D +  + C C   + G  C     LCE  PC+N   CR D  + Y C C    TG++CD   + C   PC+NNG C  +    Y+C+C   F    C+ SID+C+   C NG +C++     KC+CL G+ G +CE+       +PCQN A C+D +    C C  G TG +CE                                                  +ID+C+ +PC+     C D +  FTCQ  +     + +  +D      P      CL V
Sbjct:  697 VNIDDCSPSPCRHGGSCQDLVNG-YLCHCPAGFKGSKCETDIDECATNPCDNNGTCVDRVASYDCVCKPGFTGTRCEANIDDCATSPCLNNAICTDL-INDFHCACPAGYQGQTCAINVDDCTPQPCKQGGTCVDAVSG-YTCLCMPGFTGINCSIEMDECGSYP---CLNNGTCVDGRNRVTCTCAVGFTGQFCEVNIDDCDPAPCQNYGTCQDLVADFTCHCYPGFTGETCATPIDLCEAHPCQNNATCRMDPLKGYSCSCPTGVTGRHCD--VSICDSKPCRNNGSC-VLTQSGYQCLCASSFTSPQCQRSIDDCEHAHCLNGATCVDSDNAYKCSCLEGYYGKHCELIDRCHS-QPCQNGATCVDDDGVVFCKCAMGFTGTHCEKEFNHCIVRVADTNLTFPSRICGDHGTCVSKPTGFLCVCQPGFTGLLCQTDIDDCSSDPCVGINVTCVDGIDTFTCQSSKSTTSAKRQRDADSKSYWIPVSITLSCLVV 1183          
BLAST of Neurogenic locus notch protein vs. Ensembl Nematostella
Match: EDO48851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHH9])

HSP 1 Score: 585.104 bits (1507), Expect = 9.517e-176
Identity = 460/1380 (33.33%), Postives = 642/1380 (46.52%), Query Frame = 3
Query:  393 ILILLFCPIA-ISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNND---YTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVG---------------------------------LRCETKSDICKQL--------TPCKTEEICLNVNNTRS-----GYKCICPDGVQNCK-----KELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXX--XXXXXXXXGATCDNLADGFRCRCV-AGFTGERCE-------------------------------IEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGG----------------------LFCEIDYV-------NECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISD 4166
            +  L +C  A   +N C  + CKNG  C+++ +G Y C C  G+ G  CEQ  N C + PC+NGG CK   G   C C   + G+ CE   N C+ +PC+NGG+CK+ E   Y C C   + G NCE   +  S NPC   G C   + G   C C  G+TG  C  D++EC+  + P C+NGG C N  G Y C CKAGF G+ CE D+ +C+ + CKNGG C ++ G Y C C   + G NCE     C   PC+NGG+C++    Y C C   + GKNC+   N C  NPCKN G C++  +  Y C C+ GF GK CE  ++ C K  C NGG C N   G  C C  GF G NCE +  +        + KC    N+   Y+C C  G TGKNCE +++EC+ NPC NG  C++  GG++C C  GF G                                 L+C+ K  + K          +   T  + +N   T +     G      +G+   K      ++++C    C NG  C + +    C C  GF G+ CE ++NEC  NPCQ+G  C++    Y C C  GF GK CE ++NEC  NPC   G C +E  G+ C C   ++G  C   ++ CN N C N  +C   N++  Y C C      + G  CE+DV+EC+ +                    PC N   C N +G + C C + + G+ CE+ +      + P     +   +A+G   R V   ++G+ C                                 E   C   PC N   C +    Y C C+SGF+GKNCE + N+C+++ C   G C ++  G+ C C   + G NCE     C+ NPC N G C N        GY C C+ GFTG  CE  M+ C  NPC + GVC+ +   + C C + + G+ CE    E  K+               CK+ G C N  E GG+ C+C++G+ G  CE ++++C+  PC NGG C +  G Y C C+ GF G NC+ + NEC  N C N G C ++   +SC C  G +G+ CE  V+ C K  C+NGG+CKN  G + C C  GF GK CE D+NEC  N              PC   G   C +  G + C+CK  FTGK CE  ++ C K       PC N G+C N++         +SC C  G+ G+ C+ +  +C  N CKN G+C+    ++   + C C  G  G                      L    D V       NEC    C NNG C+N  G   C+C         E TG  C  A       Y+D  +D
Sbjct:  204 VCHLRYCGNAEFDVNECSKNPCKNGGVCKNE-HGGYSCACKVGFTGKNCEQDVNECSVNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSVNPCKNGGVCKN-EHGGYSCACKVGFTGKNCEQDVNECSVNPCKNGGVCKNEHGG-YSCACKAGFTGKNCEQDVNECS--KNP-CKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCQNGGVCKNEHGGYSCACKAGFMGKNCEQDVNECSKNPCKNGGVCKN-EHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDGLKTIIH--LQSIKCGVCKNEHGGYSCACKAGFTGKNCEQDVNECSVNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQAPSKPRECRSYKKLDTADRAAGRPRGNVLKCDQKEILTKAWYRFEGAAGSAMPTSLVPINRCGTHAPGWMEGSHPTVAEGIVTRKVCYHWSDVNECSKNPCQNGGVCKNEHGGYSCACKAGFTGKICEQDVNECNKNPCQNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECNKNPCQNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECNKNPCQNGGVCK--NEHGGYSCTCKAG---FTGKNCEQDVNECSKN--------------------PCKNGGVCKNEHGGYSCACKAGFTGKICEQEICEICGTHAPGWMEGSHPTVAEGIVTRKVCYHWSGKTCHWNNAIRVRNCGGFYVYELNRPPVCHLRYCGNAEFETCSSKPCKNGGTCREVNGAYSCTCKSGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECNKNPCQNGGVCKNEH-----GGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKN--------------PCKNGGVCKN--EHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNKHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKICEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKN--------------PCKNGGV--CKNEHGGYSCTCKAGFTGKNCEQDVNECSKN------PCKNGGVCKNEHGG-------YSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCK----NEHGGYSCTCKAGFTGKTANKMLTNVPASTRVIMAESALTAMEDTVVNARPDKNECKVNPCLNNGKCINTPGSYKCNCID-------EYTGKHCETAKYKELGCYKDNGND 1488          

HSP 2 Score: 538.88 bits (1387), Expect = 7.004e-160
Identity = 473/1461 (32.38%), Postives = 665/1461 (45.52%), Query Frame = 3
Query:  552 CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEIN-IDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQCVDVNN-------------EEKCICIPG---FEGR------TCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKC---EININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCE--------INDNDCTESS--CLGHGQCVDKV----NGFECKCNENYIGTNCE-----HLKRP---------------CDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNWFNNKRCDP-QCNTEACLFDGWDCMDAIGQCPLQSFCDKHYADGQCQ-LECNTMECSFDGGDCIESRNSTIPGGIILLLPVSTTEFVARYRTKL-LQSLTHLLHSVVRIMRNSNGQQMIFSIRVFAE 4733
            C   PC+NGG CK   G   C C   + G+ CE   N C+ +PC+NGG+CK+ E   Y C C   + G NCE   +  S NPC   G C   + G   C C  G+TG  C  D++EC+      C+NGG C N  G Y C CKAGF G+ CE D+ +C+ + CKNGG C ++ G Y C C   + G NCE     C   PCKNGG+C++    Y C C   +TGKNC+   N C  NPC+N G C++  +  Y C C+ GF GK CE  ++ C K  C NGG C N   G  C C  GF G NCE +VNEC   PC+N   C + +  Y+C C  G TGKNCE + +        +    C++  GG++C C  GF G  CE   + C  + PCK   +C    N   GY C C  G   +NC++  SK +   C + + +D  +             ++K I       FEG       T  + IN C       G+               G   +K      ++NEC+ NPC   G C +E  G+ C C   ++G  C   ++ CN N C N  +C   N++  Y C C      + G  CE+DV+ECN +                    PC N   C N +G + C C + + G+ CE+ +N C  NPC+NG  C N   G+ C C AGFTG+ CE ++NEC  NPC N   C +    Y C C++GF+GK CE         +     E S   +  G    KV    +G  C  N      NC       L RP               C S PC N G+C  R+VN     Y C C+ GFTG  CE  ++ C  NPC + GVC+ +   + C C + + G+ CE    E  K+               C++ G C N  E GG+ C+C++G+ G  CE ++++C+  PC NGG C +  G Y C C+ GF G NC+ + NEC  N C N G C ++   +SC C  G +G+ CE  ++ C K  CQNGG+CKN  G + C C  GF GK CE D+NEC  N              PC   G   C +  G + C+CK  FTGK CE  ++ C K       PC N G+C N++         +SC C  G+ G+ C+ +  +C  N CKN G+C+    ++   + C C  G  G  CE D VNEC    C N G C N  G   C C  G  G+ CE                   ++++C  N C +     +C  E   Y+C    G       K +     S     +   +   E+        N R D  +C    CL +G  C++  G    +  C   Y    C+  +   + C  D G+       TIP            E +A +R ++    ++  ++   +  +    +  IF ++ + E
Sbjct:  220 CSKNPCKNGGVCKNEHGGYSCACKVGFTGKNCEQDVNECSVNPCKNGGVCKN-EHGGYSCACKAGFTGKNCEQDVNECSVNPCKNGGVCKNEHGG-YSCACKVGFTGKNCEQDVNECS---VNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCQNGGVCKN-EHGGYSCACKAGFMGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDGLKTIIHLQSIKCGVCKNEHGGYSCACKAGFTGKNCEQDVNEC-SVNPCKNGGVC---KNEHGGYSCACKAGFTGKNCEQAPSKPRE--CRSYKKLDTADRAAGRPRGNVLKCDQKEILTKAWYRFEGAAGSAMPTSLVPINRC-------GTHAPGWMEGSHPTVAEGIVTRKVCYHWSDVNECSKNPCQNGGVCKNEHGGYSCACKAGFTGKICEQDVNECNKNPCQNGGVCK--NEHGGYSCTCKAG---FTGKNCEQDVNECNKN--------------------PCQNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECNKNPCQNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKICEQEICEICGTHAPGWMEGSHPTVAEGIVTRKVCYHWSGKTCHWNNAIRVRNCGGFYVYELNRPPVCHLRYCGNAEFETCSSKPCKNGGTC--REVNG---AYSCTCKSGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECNKN--------------PCQNGGVCKN--EHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNKHGGYSCACKAGFTGKNCEQDVNECSKN--------------PCKNGGV--CKNEHGGYSCTCKAGFTGKICEQDVNECSKN------PCKNGGVCKNEHG-------GYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCK----NEHGGYSCTCKAGFTGKNCEQD-VNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCE------------------QDVNECSKNPCKNGG---VCKNEHGGYSCTCKAGFTGKTANKMLTNVPASTRVIMAESALTAMEDT-----VVNARPDKNECKVNPCLNNG-KCINTPGS--YKCNCIDEYTGKHCETAKYKELGCYKDNGNDKNKPRRTIP------------EMIANFRPQIDWHDMSKTVNECAKHAKEKGYE--IFGVQFYGE 1538          

HSP 3 Score: 528.094 bits (1359), Expect = 3.644e-156
Identity = 414/1199 (34.53%), Postives = 573/1199 (47.79%), Query Frame = 3
Query:  885 DIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIE-INECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQI-----------------------------------------GPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKM---------DWCRG-NPCGDFGVCETDL----DSFKCKCNSEYIGERC------EIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICDLECNKYAC----GFDGGECLHRV 4271
            D++EC+  + P C+NGG C N  G Y C CK GF G+ CE D+ +C+ + CKNGG C ++ G Y C C   + G NCE     C + PCKNGG+C++    Y C C   +TGKNC+   N C +NPCKN G C++  +  Y C C+ GF GK CE  ++ C K  C NGG C N   G  C C  GF G NCE +VNEC   PC+N   C + +  Y+C C  G TGKNCE +++EC+ NPC NG  C++  GG++C C  GF+G  CE   + C +  PCK   +C    N   GY C C  G   +NC++++++C    C NG  C + +    C C  GF G+ CE + +    +        C++    Y C C  GF GK CE ++NEC+ NPC   G C +E  G+ C C   ++G  C  +  P  P  C +        K D+       A GR  G+  + D  E  L +      G A  +M  S +                                          PC N   C N +G + C C + + G+ CE+ +N C  NPC+NG  C N   G+ C C AGFTG+ CE ++NEC  NPC N   C +    Y C C++GF+GKNCE + N+C ++ C   G C ++  G+ C C   + G NCE     C  NPC N G C N        GY C C+ GFTG  CE ++          W  G +P    G+    +        C  N+      C      E+ +   C        + E+  +K CK+ G C      G + C+C+SG+ G  CE ++++C+  PC NGG C +  G Y C C+ GF G NC+ + NEC  N C N G C ++   +SC C  G +G+ CE  ++ C K  CQNGG+CKN  G + C C  GF GK CE D+NEC  N              PC   G   C +  G + C+CK  FTGK CE  ++ C K       PC N G+C NK+         +SC C  G+ G+ C+ +  +C  N CKN G+C+    ++   + C C  G  G  CE D VNEC    C N G C N  G   C C  G  G+ CE                   ++++C  N C +     +C  E   Y+C    GF G  C   V
Sbjct:  216 DVNECS--KNP-CKNGGVCKNEHGGYSCACKVGFTGKNCEQDVNECSVNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSVNPCKNGGVCKNEHGGYSCACKVGFTGKNCEQDVNECSVNPCKNGGVCKN-EHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCQNGGVCKNEHGGYSCACKAGFMGKNCEQDVNECSK-NPCKNGGVC---KNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDGLKTIIHLQSIKCGVCKNEHGGYSCACKAGFTGKNCEQDVNECSVNPCKNGGVCKNEHGGYSCACKAGFTGKNC--EQAPSKPRECRSYK------KLDTA----DRAAGRPRGNVLKCDQKEI-LTKAWYRFEGAAGSAMPTSLVPINRCGTHAPGWMEGSHPTVAEGIVTRKVCYHWSDVNECSKNPCQNGGVCKNEHGGYSCACKAGFTGKICEQDVNECNKNPCQNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECNKNPCQNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECNKNPCQNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEH-----GGYSCACKAGFTGKICEQEICEICGTHAPGWMEGSHPTVAEGIVTRKVCYHWSGKTCHWNNAIRVRNCGGFYVYELNRPPVCHLRYCGNAEFETCSSKPCKNGGTC--REVNGAYSCTCKSGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECNKNPCQNGGVCKNEHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKN--------------PCKNGGV--CKNEHGGYSCACKAGFTGKNCEQDMNECSKN------PCQNGGVCKNKHGG-------YSCACKAGFTGKNCEQDVNECSKNPCKNGGVCK----NEHGGYSCTCKAGFTGKICEQD-VNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCE------------------QDVNECSKNPCKNGG---VCKNEHGGYSCTCKAGFTGKNCEQDV 1331          

HSP 4 Score: 327.791 bits (839), Expect = 1.078e-90
Identity = 263/836 (31.46%), Postives = 392/836 (46.89%), Query Frame = 3
Query: 1920 EIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRG--VSGRFCETIVDYCKKMECQNGGICKNVI-----------GDFECNCPKGFAG----KLC--ETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKA--DNKICDLECNKYACGFDGGECLHRVPKRIDGNDISIASPWSNCEIIKSENIPCHNW 4364
            E ++NEC  NPC++G  C++    Y C C  GF GK CE ++NEC+ NPC   G C +E  G+ C C   ++G  C   ++ C+ N C N  +C   N++  Y C C      + G  CE+DV+EC+++                    PC N   C N +G + C C + + G+ CE+ +N C  NPC+NG  C N   G+ C C AGFTG+ CE ++NEC  NPC N   C +    Y C C++GF+GKNCE + N+C+++ C   G C ++  G+ C C   ++G NCE     C  NPC N G C N        GY C C+ GFTG  CE  ++ C  NPC + GVC+ +   + C C + + G+ CE    +T           +S+   +CK+        E GG+ C+C++G+ G  CE ++++C+  PC NGG C +  G Y C C+ GF G NC+   ++     C + K +D  +  +   PRG  +     E +     + E   G      +           G  E + P    G    K+C   +D+NEC  N              PC   G   C +  G + C+CK  FTGK CE  ++ C K       PC N G+C N++         +SC C  G+ G+ C+ +  +C  N C+N G+C+    ++   + C C  G  G  CE D VNEC    C N G C N  G   C C  G  G+ CE   + C+     N    ++E        CA KA    KIC+ E  +         C    P  ++G+  ++A      E I +  + C++W
Sbjct:  214 EFDVNECSKNPCKNGGVCKNEHGGYSCACKVGFTGKNCEQDVNECSVNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSVNPCKNGGVCK--NEHGGYSCACKVG---FTGKNCEQDVNECSVN--------------------PCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCQNGGVCKNEHGGYSCACKAGFMGKNCEQDVNECSKNPCKNGGVCKNEH-----GGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDGLKTI-------IHLQSIKCGVCKN--------EHGGYSCACKAGFTGKNCEQDVNECSVNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQAPSK--PRECRSYKKLDTADRAAGR-PRGNVLKCDQKEILTKAWYRFEGAAGSAMPTSLVPINRCGTHAPGWMEGSHPTVAEGIVTRKVCYHWSDVNECSKN--------------PCQNGGV--CKNEHGGYSCACKAGFTGKICEQDVNECNKN------PCQNGGVCKNEHG-------GYSCTCKAGFTGKNCEQDVNECNKNPCQNGGVCK----NEHGGYSCTCKAGFTGKNCEQD-VNECNKNPCQNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGG---YSCACKAGFTGKICEQEICEI--------CGTHAPGWMEGSHPTVA------EGIVTRKV-CYHW 949          

HSP 5 Score: 266.159 bits (679), Expect = 2.069e-71
Identity = 207/527 (39.28%), Postives = 268/527 (50.85%), Query Frame = 3
Query:  393 ILILLFCPIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSN-CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFSSN-CASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVG----------------LRCETK----SDICKQLTPCKTE---EICLNVN---NTRSGYKCICPDGVQNCKKELSKCKNIVCINGQCVDVNNEEKCI 1889
            +  L +C  A     C +  CKNG TC+ ++NG Y C C  G+ G  CEQ  N C   PC+NGG CK   G   C C   + G+ CE   N C  +PC+NGG+CK+ E   Y C C   + G NCE   +  S+NPC   G C   + G   C C  G+TG  C  D++EC+  + P C+NGG C N  G Y C CKAGF G+ CE D+ +C+ + C+NGG C +K G Y C C   + G NCE     C   PCKNGG+C++    Y C C   +TGK C+   N C  NPCKN G C++  +  Y C C+ GF GK CE  ++ C K  C NGG C N   G  C C  GF G NCE +VNEC   PC+N   C + +  Y+C C  G TGKNCE +++EC+ NPC NG  C++  GG++C C  GF G                +  E+      D      P K E     CLN     NT   YKC C D       E +K K + C      D N   + I
Sbjct:  978 VCHLRYCGNA-EFETCSSKPCKNGGTCR-EVNGAYSCTCKSGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECNKNPCQNGGVCKN-EHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNEHGG-YSCACKAGFTGKNCEQDVNECS--KNP-CKNGGVCKNEHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNKHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKICEQDVNECSKNPCKNGGVCKN-EHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKTANKMLTNVPASTRVIMAESALTAMEDTVVNARPDKNECKVNPCLNNGKCINTPGSYKCNCIDEYTGKHCETAKYKELGCYKDNGNDKNKPRRTI 1496          
BLAST of Neurogenic locus notch protein vs. Ensembl Nematostella
Match: EDO46243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQW9])

HSP 1 Score: 447.588 bits (1150), Expect = 1.401e-137
Identity = 283/740 (38.24%), Postives = 379/740 (51.22%), Query Frame = 3
Query: 1344 CETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDG----TGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCE 3539
            C T ID C    C NG +C + I G  C C  GF G +C   ++EC +KPC+N A C D  N +TC C  G TGK+C   IDEC  NPC NGA C DR+ GFTC C  GF G  C T+ D C    PCK    C +  N   G+ C C  G   ++C  E+ +C +  C NG  C D  N   C C PGF G+ C  EI+EC +NPC++G+ C D  N + C C PGF GK C   I+ECA NPC     C D + GF C C   ++G  C  ++D C  N C N A C   ++ + + C C      + G  C  ++DEC  +                    PC N   C +    F C C   + G+ C   ++ C +NPC+NGATC +  +GF C C  GFTG+ C  EI+EC  NPC N A C D IN + C C+ GF+GK+C    ++C  + C     C D++NGF C C   + G +C      C SNPC N  +C +R +N    G+ C C+ GFTG  C  ++D C  NPC +   C   ++ F C C   + G+ C  +  E                +  CK+   C +     GF C+C+ G+ G  C   ID+CAS PC NG  C D        Y+C C PGF G++C+ N +EC S+ C N G C D IN F+C CP G +G  C+  +D C    CQNGG C ++I  F C+CP G+ G  C+
Sbjct:    1 CGTEIDECASNPCKNGATCTDRINGFTCTCKHGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECAS-NPCKNGATCTDRIN---GFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCT--DRINGFACTCKPG---FTGKDCGTEIDECASN--------------------PCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDR-IN----GFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDE--------------CASNPCKNGATCTD--RINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINDLINGYYCFCTPGFSGIHCEANIDECASSPCQNGGLCTDMINAFTCTCPPGYTGITCDIDIDECASSPCQNGGFCTDMINAFTCSCPPGYTGITCD 690          

HSP 2 Score: 433.335 bits (1113), Expect = 1.363e-132
Identity = 274/715 (38.32%), Postives = 365/715 (51.05%), Query Frame = 3
Query: 1305 YKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTE----TCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCE 3425
            + C C+ GF GK C T ID C    C NG +C + I G  C C PGF G +C   ++EC + PC+N A C D  N +TC C  G TGK+C   IDEC  NPC NGA C DR+ GF C C  GF G  C T+ D C    PCK    C +  N   G+ C C  G   ++C  E+ +C +  C NG  C D  N   C C PGF G+ C  EI+EC +NPC++G+ C D  N + C C PGF GK C   I+ECA NPC     C D + GF C C   ++G  C  ++D C  N C N A C   ++ + + C C      + G  C  ++DEC  +                    PC N   C +    F C C   + G+ C   ++ C +NPC+NGATC +  +GF C C  GFTG+ C  EI+EC  NPC N A C D IN + C C+ GF+GK+C    ++C  + C     C D++NGF C C   + G +C      C SNPC N  +C +R +N    G+ C C+ GFTG  C  ++D C  NPC +   C   ++ F C C   + G+ C  +  E     CK+ A    +   LIN                G+ C C  G+ G  CE NID+CAS PC NGG C D    + C C PG+ G+ C ++ +EC S+ C N G C D IN F+C CP G +G  C+
Sbjct:   26 FTCTCKHGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECAS-NPCKNGATCTDRIN---GFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCT--DRINGFACTCKPG---FTGKDCGTEIDECASN--------------------PCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDR-IN----GFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINDLIN----------------GYYCFCTPGFSGIHCEANIDECASSPCQNGGLCTDMINAFTCTCPPGYTGITCDIDIDECASSPCQNGGFCTDMINAFTCSCPPGYTGITCD 690          

HSP 3 Score: 419.853 bits (1078), Expect = 6.400e-128
Identity = 277/729 (38.00%), Postives = 373/729 (51.17%), Query Frame = 3
Query:  876 CSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDK----VNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEI 3041
            C  +IDECAS     C+NG TC + +  + C CK GF G+ C  +I +C +  CKNG TC D+I  + C C   + G +C  +   C   PCKNG  C D    + C C   +TGK+C    + C  NPCKN   C +     + C C+ GF GK C T ID C    C NG +C + I G  C C PGF G +C   ++EC + PC+N A C D  N + C C  G TGK+C   IDEC  NPC NGA C DR+ GF C C  GF G  C T+ D C    PCK    C +  N   G+ C C  G   ++C  E+ +C +  C NG  C D  N   C C PGF G+ C  EI+EC +NPC++G+ C D  N + C C PGF GK C   I+ECA NPC     C D + GF C C   ++G  C  ++D C  N C N A C   ++ + + C C      + G  C  ++DEC  +                    PC N   C +    F C C   + G+ C   ++ C +NPC+NGATC +  +GF C C  GFTG+ C  EI+EC  NPC N A C D IN + C C+ GF+GK+C    ++C  + C     C D+    +NG+ C C   + G +CE     C S+PC N G C +  +N     + C C  G+TG  C+I +D C  +PC + G C   +++F C C   Y G  C+I
Sbjct:    1 CGTEIDECASNP---CKNGATCTDRINGFTCTCKHGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATC-TDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECAS-NPCKNGATCTDRIN---GFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCT--DRINGFACTCKPG---FTGKDCGTEIDECASN--------------------PCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINDLINGYYCFCTPGFSGIHCEANIDECASSPCQNGGLCTDM-INA----FTCTCPPGYTGITCDIDIDECASSPCQNGGFCTDMINAFTCSCPPGYTGITCDI 691          

HSP 4 Score: 416.001 bits (1068), Expect = 1.194e-126
Identity = 271/767 (35.33%), Postives = 370/767 (48.24%), Query Frame = 3
Query: 1806 CKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEI 4100
            C  E+ +C +  C NG  C D  N   C C  GF G+ C  EI+EC + PC++G+ C D  N + C C PGF GK C   I+ECA NPC     C D + GF C C   ++G  C  ++D C  N C N A C   ++ + + C C      + G  C  ++DEC  +                    PC N   C +    F C C   + G+ C   ++ C +NPC+NGATC +  +GF C C  GFTG+ C  EI+EC  NPC N A C D IN + C C+ GF+GK+C    ++C  + C     C D++NGF C C   + G +C      C SNPC N  +C +R +N    G+ C C+ GFTG  C  ++D C  NPC +   C   ++ F C C   + G+ C  +  E                +  CK+   C +     GF C+C+ G+ G  C   ID+CAS PC NG  C D    + C C+PGF G +C    +EC SN C  G  C D+IN F+C C  G +G+ C T +D C    C+NG  C + I  F C C  GF GK C T+I+EC  N   N                   C DR   F C+CK  FTGK C T ID C       + PC N   C ++  + +   Y   C C  G+ G  C+ N  +C  + C+N G+C     D   +F C CPPG  G+ C+ID ++EC S+ C N G C +      C C  G  G  C+I
Sbjct:    1 CGTEIDECASNPCKNGATCTDRINGFTCTCKHGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCT--DRINGFACTCKPG---FTGKDCGTEIDECASN--------------------PCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDR-IN----GFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDE--------------CASNPCKNGATCTD--RINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNG----------------ATCTDRINGFACTCKPGFTGKDCGTEIDECA------SNPCKNGATCTDRINDLINGYY---CFCTPGFSGIHCEANIDECASSPCQNGGLC----TDMINAFTCTCPPGYTGITCDID-IDECASSPCQNGGFCTDMINAFTCSCPPGYTGITCDI 691          

HSP 5 Score: 416.001 bits (1068), Expect = 1.378e-126
Identity = 280/722 (38.78%), Postives = 367/722 (50.83%), Query Frame = 3
Query:  783 SQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHIND----YQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEI 2927
            + NPC     C    +G   C C  G+TG  C  +IDECAS     C+NG TC + +  + C CK GF G+ C  +I +C ++ CKNG TC D+I  + C C   + G +C  +   C   PCKNG  C D    + C C   +TGK+C    + C  NPCKN   C +     + C C+ GF GK C T ID C    C NG +C + I G  C C PGF G +C   ++EC + PC+N A C D  N + C C  G TGK+C   IDEC  NPC NGA C DR+ GF C C  GF G  C T+ D C    PCK    C +  N   G+ C C  G   ++C  E+ +C +  C NG  C D  N   C C PGF G+ C  EI+EC +NPC++G+ C D  N + C C PGF GK C   I+ECA NPC     C D + GF C C   ++G  C  ++D C  N C N A C   ++ + + C C      + G  C  ++DEC  +                    PC N   C +    F C C   + G+ C   ++ C +NPC+NGATC +  +GF C C  GFTG+ C  EI+EC  NPC N A C D IND    Y C C  GFSG +CE N ++C  S C   G C D +N F C C   Y G  C+     C S+PC N G C +  +N     + C+C  G+TG  C+I
Sbjct:    9 ASNPCKNGATCTDRING-FTCTCKHGFTGKDCGTEIDECASKP---CKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATC-TDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECAS-NPCKNGATCTDRIN---GFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCT--DRINGFACTCKPG---FTGKDCGTEIDECASN--------------------PCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINDLINGYYCFCTPGFSGIHCEANIDECASSPCQNGGLCTDMINAFTCTCPPGYTGITCDIDIDECASSPCQNGGFCTDM-INA----FTCSCPPGYTGITCDI 691          

HSP 6 Score: 414.075 bits (1063), Expect = 6.865e-126
Identity = 275/738 (37.26%), Postives = 368/738 (49.86%), Query Frame = 3
Query:  999 CENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEV 3203
            C  +I +C ++ CKNG TC D+I  + C C + + G +C  +   C  KPCKNG  C D    + C C   +TGK+C    + C  NPCKN   C +     + C C+ GF GK C T ID C    C NG +C + I G  C C PGF G +C   ++EC + PC+N A C D  N + C C  G TGK+C   IDEC  NPC NGA C DR+ GF C C  GF G  C T+ D C    PCK    C +  N   G+ C C  G   ++C  E+ +C +  C NG  C D  N   C C PGF G+ C  EI+EC +NPC++G+ C D  N + C C PGF GK C   I+ECA NPC     C D + GF C C   ++G  C  ++D C  N C N A C   ++ + + C C      + G  C  ++DEC  +                    PC N   C +    F C C   + G+ C   ++ C +NPC+NGATC +  +GF C C  GFTG+ C  EI+EC  NPC N A C D IN + C C+ GF+GK+C    ++C  + C     C D++NGF C C   + G +C      C SNPC N  +C +R +N    GY C C  GF+G  CE  +D C  +PC + G+C   +++F C C   Y G  C+I   E   S          +IN                 F CSC  GY G  C++
Sbjct:    1 CGTEIDECASNPCKNGATCTDRINGFTCTCKHGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATC-TDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECAS-NPCKNGATCTDRIN---GFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCT--DRINGFACTCKPG---FTGKDCGTEIDECASN--------------------PCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDR-INDLINGYYCFCTPGFSGIHCEANIDECASSPCQNGGLCTDMINAFTCTCPPGYTGITCDIDIDECASSPCQNGGFCTDMINA----------------FTCSCPPGYTGITCDI 691          

HSP 7 Score: 387.497 bits (994), Expect = 7.742e-117
Identity = 265/719 (36.86%), Postives = 359/719 (49.93%), Query Frame = 3
Query:  552 CPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFI----CKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEI 2684
            C   PC+NG TC        C C + + G+ C      CAS PC+NG  C +  I+ + C C   + G +C       + NPC     C    +G   C C  G+TG  C  +IDECAS     C+NG TC + +  + C CK GF G+ C  +I +C ++ CKNG TC D+I  + C C   + G +C  +   C   PCKNG  C D    + C C   +TGK+C    + C  NPCKN   C +     + C C+ GF GK C T ID C    C NG +C + I G  C C PGF G +C   ++EC + PC+N A C D  N + C C  G TGK+C   IDEC  NPC NGA C DR+ GF C C  GF G  C T+ D C    PCK    C +  N   G+ C C  G   ++C  E+ +C +  C NG  C D  N   C C PGF G+ C  EI+EC +NPC++G+ C D  N + C C PGF GK C   I+ECA NPC     C D + GF C C   ++G  C  ++D C  N C N A C   ++ + + C C      + G  C  ++DEC  +                    PC N   C +     I    C C+  + G  CE  ++ C ++PC+NG  C ++ + F C C  G+TG  C+I+I+EC  +PC N   C D IN + C C  G++G  C+I
Sbjct:    8 CASNPCKNGATCTDRINGFTCTCKHGFTGKDCGTEIDECASKPCKNGATC-TDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRING-FTCTCKPGFTGKDCGTEIDECASNP---CKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATC-TDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECAS-NPCKNGATCTDRIN---GFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCT--DRINGFACTCKPG---FTGKDCGTEIDECASN--------------------PCKNGATCTDRINDLINGYYCFCTPGFSGIHCEANIDECASSPCQNGGLCTDMINAFTCTCPPGYTGITCDIDIDECASSPCQNGGFCTDMINAFTCSCPPGYTGITCDI 691          

HSP 8 Score: 382.489 bits (981), Expect = 4.130e-115
Identity = 267/724 (36.88%), Postives = 361/724 (49.86%), Query Frame = 3
Query:  420 AISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYC-EQKSNCPITPCQNGGTCKLIAGNNVCQCLNEWVGEFCEFS-SNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGNTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIP--GNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEI 2570
               ++ C ++ CKNGATC   ING + C C +G+ G  C  +   C   PC+NG TC        C C   + G+ C      CAS+PC+NG  C +  I+ + C C   + G +C       + NPC     C    +G   C C  G+TG  C  +IDECAS     C+NG TC + +  + C CK GF G+ C  +I +C ++ CKNG TC D+I  + C C   + G +C  +   C   PCKNG  C D    + C C   +TGK+C    + C  NPCKN   C +     + C C+ GF GK C T ID C    C NG +C + I G  C C PGF G +C   ++EC + PC+N A C D  N + C C  G TGK+C   IDEC  NPC NGA C DR+ GF C C  GF G  C T+ D C    PCK    C +  N   G+ C C  G   ++C  E+ +C +  C NG  C D  N   C C PGF G+ C  EI+EC +NPC++G+ C D  N + C C PGF GK C   I+ECA NPC     C D + GF C C   ++G  C  ++D C  N C N A C     +  + Y+C C+     + G  CE ++DEC                       PC N   C +   +F C C   Y G  C+  ++ C ++PC+NG  C ++ + F C C  G+TG  C+I
Sbjct:    2 GTEIDECASNPCKNGATCTDRING-FTCTCKHGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATC-TDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRING-FACTCKPGFTGKDCGTEIDECASNP---CKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATC-TDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECAS-NPCKNGATCTDRIN---GFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINDLINGYYCFCTPG---FSGIHCEANIDEC--------------------ASSPCQNGGLCTDMINAFTCTCPPGYTGITCDIDIDECASSPCQNGGFCTDMINAFTCSCPPGYTGITCDI 691          

HSP 9 Score: 307.375 bits (786), Expect = 2.302e-89
Identity = 209/600 (34.83%), Postives = 280/600 (46.67%), Query Frame = 3
Query: 2367 PCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMS-FKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEI 4160
            PC N   C +    F C C   + G+ C   ++ C + PC+NGATC +  +GF C C  GFTG+ C  EI+EC  NPC N A C D IN + C C+ GF+GK+C    ++C  + C     C D++NGF C C   + G +C      C SNPC N  +C +R +N    G+ C C+ GFTG  C  ++D C  NPC +   C   ++ F C C   + G+ C  +  E                +  CK+   C +     GF C+C+ G+ G  C   ID+CAS PC NG  C D    + C C+PGF G +C    +EC SN C  G  C D+IN F+C C  G +G+ C T +D C    C+NG  C + I  F C C  GF GK C T+I+EC  N   N                   C DR   F C+CK  FTGK C T ID C       + PC N   C ++          F+C C  G+ G+ C     +C  N CKN   C      DR++ F C C PG  G  C  + ++EC S  C N  +C +      C C  G  G+ C      C      N  T  D I
Sbjct:   12 PCKNGATCTDRINGFTCTCKHGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDR-IN----GFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDE--------------CASNPCKNGATCTD--RINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNG----------------ATCTDRINGFACTCKPGFTGKDCGTEIDECA------SNPCKNGATCTDRIN-------GFACTCKPGFTGKDCGTEIDECASNPCKNGATCT-----DRINGFACTCKPGFTGKDCGTE-IDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRI 555          

HSP 10 Score: 99.7525 bits (247), Expect = 5.922e-21
Identity = 93/306 (30.39%), Postives = 122/306 (39.87%), Query Frame = 3
Query: 3420 CETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMS-FKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEIS-------------DC--ELNKCASKA--DNKICDLECNKYAC----GFDGGECLHRV 4271
            C T +D C    C+NG  C + I  F C C  GF GK C T+I+EC      N                   C DR   F C+CK  FTGK C T ID C       + PC N   C ++          F+C C  G+ G+ C     +C  N CKN   C      DR++ F C C PG  G  C  + ++EC S  C N  +C +      C C  G  G+ C      C      N  T  D I+             DC  E+++CAS    +   C    N +AC    GF G +C   +
Sbjct:    1 CGTEIDECASNPCKNGATCTDRINGFTCTCKHGFTGKDCGTEIDECASKPCKNG----------------ATCTDRINGFTCTCKPGFTGKDCGTEIDECA------SNPCKNGATCTDRIN-------GFTCTCKPGFTGKDCGTEIDECASNPCKNGATCT-----DRINGFACTCKPGFTGKDCGTE-IDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEI 271          
BLAST of Neurogenic locus notch protein vs. Ensembl Nematostella
Match: EDO29720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2U3])

HSP 1 Score: 380.948 bits (977), Expect = 9.039e-116
Identity = 246/646 (38.08%), Postives = 329/646 (50.93%), Query Frame = 3
Query: 1356 IDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKC 3284
            ID C    C NGG+C + +    C C  G+ G  CEI  ++C + PC N   C      Y C C  G TGKNCE NIDEC  +PC NG  C DR+  FTC C  GF G  C T+ D C    PCK    C +  N   G+ C C  G   ++C  E+ +C +  C NG  C D  N   C C PGF G+ C  EI+EC + PC++G+ C D  N + C C PGF GK C   I+ECA NPC     C D + GF C C   ++G  C  ++D C  + C N A C   ++ + + C C   LG + G  C  ++DEC  +                    PC N   C +    F C C   + G  C   ++ C ++PC+NGATC +  +GF C C  GFTG  C  EI+EC   PC N A C D IN + C C+ GF+GK+C    ++C    C     C DK+NGF C C E Y G +C      C SNPCLN+G+C ++ VN    GYLC C++G+TGP CE++++ C+ +PC + G CE  + S++C C + Y G  CE    E   S          L++                  KC C +GY G  CEVNID+CA++PC+NG  C D   +Y C C
Sbjct:    2 IDECSSNPCQNGGTCTDQLNSYSCTCPSGYTGTKCEIVPDQCASAPCINGGTCKSDRYGYHCHCKVGFTGKNCETNIDECNSSPCKNGGSCTDRINRFTCTCKHGFTGKDCGTEIDECASK-PCKNGATCTDRIN---GFTCTCKPGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASKPCKNGATCTDRINGFRCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGSDCGTEIDECASSPCKNGATCT--DRINGFACTCK--LG-FTGKDCGTEIDECASN--------------------PCKNGATCTDRINGFTCTCKPGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTCKPGFTGSDCGTEIDECASKPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASEPCKNGANCTDKINGFMCTCKEGYTGKDCGTDIDECSSNPCLNEGTCTDQ-VN----GYLCVCKKGYTGPNCEVEVNECQSDPCQNGGTCEDLIASYRCFCKAGYTGRHCETDIDECASSPCANGGTCTDLVD----------------AHKCQCSTGYTGKNCEVNIDECATKPCLNGATCVDQIAVYKCLC 597          

HSP 2 Score: 375.555 bits (963), Expect = 7.824e-114
Identity = 246/630 (39.05%), Postives = 333/630 (52.86%), Query Frame = 3
Query:  885 DIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVXXXXXXXXXXXXGFCESVNYQDYKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKC 2765
            +IDEC+S     C+NGGTC + + SY C C +G+ G +CE     C +  C NGGTC      Y C C   + G NCE     C   PCKNGG C D    + C C + +TGK+C    + C   PCKN   C +     + C C+ GF GK C T ID C    C NG +C + I G  C C PGF G +C   ++EC +KPC+N A C D  N + C C  G TGK+C   IDEC  NPC NGA C DR+ GFTC C  GF G  C T+ D C   +PCK    C +  N   G+ C C  G   ++C  E+ +C +  C NG  C D  N   C C PGF G  C  EI+EC ++PC++G+ C D  N + C C PGF G  C   I+ECA  PC     C D + GF C C   ++G  C  ++D C    C N A C   +K + + C C      Y G  C  D+DEC+ +                    PCLN+  C +    ++C C   Y G  CE  +N C+++PC+NG TC++L   +RC C AG+TG  CE +I+EC  +PC+N   C D ++ ++C C +G++GKNCE+N ++C    CL    CVD++  ++C C
Sbjct:    1 EIDECSSNP---CQNGGTCTDQLNSYSCTCPSGYTGTKCEIVPDQCASAPCINGGTCKSDRYGYHCHCKVGFTGKNCETNIDECNSSPCKNGGSCTDRINRFTCTCKHGFTGKDCGTEIDECASKPCKNGATC-TDRINGFTCTCKPGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASKPCKNGATCTDRINGFRCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGSDCGTEIDECAS-SPCKNGATCTDRIN---GFACTCKLGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTCKPGFTGSDCGTEIDECASKPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASEPCKNGANCT--DKINGFMCTCKEG---YTGKDCGTDIDECSSN--------------------PCLNEGTCTDQVNGYLCVCKKGYTGPNCEVEVNECQSDPCQNGGTCEDLIASYRCFCKAGYTGRHCETDIDECASSPCANGGTCTDLVDAHKCQCSTGYTGKNCEVNIDECATKPCLNGATCVDQIAVYKCLC 597          

HSP 3 Score: 363.614 bits (932), Expect = 9.413e-110
Identity = 227/586 (38.74%), Postives = 307/586 (52.39%), Query Frame = 3
Query: 1305 YKCICQRGFEGKMCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFXXXXXXXXXXXXXXKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGV--QNCKKELSKCKNIVCINGQ-CVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLAVLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKXXXXXXXXXXXXGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTE 3053
            Y C C  G+ G  CE   D C    C NGG+C +   G  C+C  GF G NCE N++EC + PC+N   C D  N +TC C  G TGK+C   IDEC   PC NGA C DR+ GFTC C  GF G  C T+ D C    PCK    C +  N   G+ C C  G   ++C  E+ +C +  C NG  C D  N  +C C PGF G+ C  EI+EC +NPC++G+ C D  N + C C PGF G  C   I+ECA +PC     C D + GF C C L ++G  C  ++D C  N C N A C   ++ + + C C      + GS C  ++DEC                       PC N   C +    F C C   + G  C   ++ C + PC+NGATC +  +GF C C  GFTG+ C  EI+EC   PC N A C D IN + C C+ G++GK+C  + ++C+ + CL  G C D+VNG+ C C + Y G NCE     C S+PC N G+C +   +     Y C C+ G+TG  CE  +D C  +PC + G C   +D+ KC+C++ Y G+ CE+   E
Sbjct:   23 YSCTCPSGYTGTKCEIVPDQCASAPCINGGTCKSDRYGYHCHCKVGFTGKNCETNIDECNSSPCKNGGSCTDRINRFTCTCKHGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASK-PCKNGATCTDRIN---GFTCTCKPGFTGKDCGTEIDECASKPCKNGATCTDRINGFRCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTCKLGFTGKDCGTEIDECASNPCKNGATCT--DRINGFTCTCKPG---FTGSDCGTEIDEC--------------------ASSPCKNGATCTDRINGFACTCKPGFTGSDCGTEIDECASKPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASEPCKNGANCTDKINGFMCTCKEGYTGKDCGTDIDECSSNPCLNEGTCTDQVNGYLCVCKKGYTGPNCEVEVNECQSDPCQNGGTCEDLIAS-----YRCFCKAGYTGRHCETDIDECASSPCANGGTCTDLVDAHKCQC