Thioredoxin glutathione reductase

Overview
NameThioredoxin glutathione reductase
Smed IDSMED30025313
Length (bp)2160
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Thioredoxin glutathione reductase (SMED30025313) t-SNE clustered cells

Violin plots show distribution of expression levels for Thioredoxin glutathione reductase (SMED30025313) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Thioredoxin glutathione reductase (SMED30025313) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Thioredoxin glutathione reductase (SMED30025313) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025313

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025313SMESG000063612.1 Contig1040GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025313SMESG000020047.1 Contig1040GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30025313SMESG000020047.1 dd_Smed_v4_960_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025313SMESG000020047.1 dd_Smed_v4_960_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025313SMESG000020047.1 dd_Smed_v4_960_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025313SMESG000020047.1 dd_Smed_v4_960_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025313SMESG000020047.1 dd_Smed_v4_960_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30025313SMESG000020047.1 dd_Smed_v4_960_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30025313SMESG000020047.1 dd_Smed_v4_960_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30025313SMESG000020047.1 dd_Smed_v4_960_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025313SMESG000020047.1 dd_Smed_v4_960_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025313SMESG000063612.1 Contig1040GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025313SMESG000020047.1 Contig49753uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025313SMESG000020047.1 Contig49753newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025313SMESG000020047.1 Contig1040GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30025313SMESG000020047.1 dd_Smed_v6_960_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025313SMESG000020047.1 dd_Smed_v4_960_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Thioredoxin glutathione reductase vs. Ensembl Human
Match: TXNRD3 (thioredoxin reductase 3 [Source:HGNC Symbol;Acc:HGNC:20667])

HSP 1 Score: 685.256 bits (1767), Expect = 0.000e+0
Identity = 340/599 (56.76%), Postives = 434/599 (72.45%), Query Frame = 1
Query:   94 PPISTALEEWIRK----IINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDER-QYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*G 1872
            P  S+   E +R+    +I  S ++IFSK+ CP   ++K+      ++   +E++ +  G+ +Q++L  ITNQ+TVPN+FV   H+GGCD   +A   G +QKLL E   Y+YDL++IGGGSGGL+ +KEAA  G KV VLDFV P+PQGT+WGLGGTCVNVGCIPKKLMHQ+ALL  +  D+R +GW   + V H+W+ M + IQNHI SLNWGYR SLR K V Y+N+YG F++ H IK T+K   E   T+  F+IATGERPRY  I GDKEY ITSDDLFSL YCPGKTLV+GASYVALECAGFLA  GL VTVMVRSI LRGFDQ+MA K+G YME+HGV F+ + +P  +  +E+GSPGK +V     +     +  +NTVL AIGRD CT +IGLE + + + +K+G++ VN+ EQ+ V  +YA+GDI+    +LTPVAIQ+GK L++RLFG      DY+NVPTTVFTPLEYG  GL+EE AI  Y KE++E++H  F PLEWTVA R +N CY K+ICNK D+ RV+GFH+L PNAGE+TQG+A AM+ G TK+  DDTIGIHPTC E FTTL ITK+SG D  Q GC G
Sbjct:   45 PSRSSEAREELRRHLVGLIERSRVVIFSKSYCPHSTRVKELFSSLGVECNVLELDQVDDGARVQEVLSEITNQKTVPNIFVNKVHVGGCDQTFQAYQSGLLQKLLQEDLAYDYDLIIIGGGSGGLSCAKEAAILGKKVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGQALCDSRKFGWEYNQQVRHNWETMTKAIQNHISSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQFVIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGFGLDVTVMVRSILLRGFDQEMAEKVGSYMEQHGVKFLRKFIPVMVQQLEKGSPGKLKVLAKSTEGTETIEGVYNTVLLAIGRDSCTRKIGLEKIGVKINEKSGKIPVNDVEQTNVPYVYAVGDILEDKPELTPVAIQSGKLLAQRLFGASLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEVYKKENLEIYHTLFWPLEWTVAGRENNTCYAKIICNKFDHDRVIGFHILGPNAGEVTQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTLEITKSSGLDITQKGCUG 643          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Human
Match: TXNRD3 (thioredoxin reductase 3 [Source:HGNC Symbol;Acc:HGNC:20667])

HSP 1 Score: 684.871 bits (1766), Expect = 0.000e+0
Identity = 340/599 (56.76%), Postives = 434/599 (72.45%), Query Frame = 1
Query:   94 PPISTALEEWIRK----IINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDER-QYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*G 1872
            P  S+   E +R+    +I  S ++IFSK+ CP   ++K+      ++   +E++ +  G+ +Q++L  ITNQ+TVPN+FV   H+GGCD   +A   G +QKLL E   Y+YDL++IGGGSGGL+ +KEAA  G KV VLDFV P+PQGT+WGLGGTCVNVGCIPKKLMHQ+ALL  +  D+R +GW   + V H+W+ M + IQNHI SLNWGYR SLR K V Y+N+YG F++ H IK T+K   E   T+  F+IATGERPRY  I GDKEY ITSDDLFSL YCPGKTLV+GASYVALECAGFLA  GL VTVMVRSI LRGFDQ+MA K+G YME+HGV F+ + +P  +  +E+GSPGK +V     +     +  +NTVL AIGRD CT +IGLE + + + +K+G++ VN+ EQ+ V  +YA+GDI+    +LTPVAIQ+GK L++RLFG      DY+NVPTTVFTPLEYG  GL+EE AI  Y KE++E++H  F PLEWTVA R +N CY K+ICNK D+ RV+GFH+L PNAGE+TQG+A AM+ G TK+  DDTIGIHPTC E FTTL ITK+SG D  Q GC G
Sbjct:   45 PSRSSEAREELRRHLVGLIERSRVVIFSKSYCPHSTRVKELFSSLGVECNVLELDQVDDGARVQEVLSEITNQKTVPNIFVNKVHVGGCDQTFQAYQSGLLQKLLQEDLAYDYDLIIIGGGSGGLSCAKEAAILGKKVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGQALCDSRKFGWEYNQQVRHNWETMTKAIQNHISSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQFVIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGFGLDVTVMVRSILLRGFDQEMAEKVGSYMEQHGVKFLRKFIPVMVQQLEKGSPGKLKVLAKSTEGTETIEGVYNTVLLAIGRDSCTRKIGLEKIGVKINEKSGKIPVNDVEQTNVPYVYAVGDILEDKPELTPVAIQSGKLLAQRLFGASLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEVYKKENLEIYHTLFWPLEWTVAGRENNTCYAKIICNKFDHDRVIGFHILGPNAGEVTQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTLEITKSSGLDITQKGCUG 643          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Human
Match: TXNRD1 (thioredoxin reductase 1 [Source:HGNC Symbol;Acc:HGNC:12437])

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 338/591 (57.19%), Postives = 428/591 (72.42%), Query Frame = 1
Query:  124 IRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLD-------ERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*G 1872
            ++  I+   ++IFS++TC  C ++KK  K   + Y  +E++    G  ++  L  +  +  +P VFV+   IGG     KA  EGR+QKLL         + Y+YDL++IGGGSGGLAA+KEAA +G KV VLDFV PTP GT WGLGGTCVNVGCIPKKLMHQ+ALL  + +D+R+YGW V ETV+H WD M+E +QNHI SLNWGYR +LR K V Y NAYG FI  H IK T+    E+I ++  F+IATGERPRY  IPGDKEY I+SDDLFSL YCPGKTLV+GASYVALECAGFLA +GL VTVMVRSI LRGFDQ MANKIG++MEEHG+ FI + VP K+  +E G+PG+  V       +   +  +NTV+ AIGRD CT +IGLE V + + +K G++ V +EEQ+ V  IYAIGDI+   ++LTPVAIQAG+ L++RL+ G  +  DY NVPTTVFTPLEYG+ GL+EE A+ K+G+E+IEV+H  F PLEWT+  R +N CY K+ICN  DN RVVGFHVL PNAGE+TQG+A A++ G TK+  D TIGIHP C+E FTTL++TK SGA   Q+GC G
Sbjct:   59 LQAYIDGHSVVIFSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG 649          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Human
Match: TXNRD1 (thioredoxin reductase 1 [Source:HGNC Symbol;Acc:HGNC:12437])

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 337/589 (57.22%), Postives = 427/589 (72.50%), Query Frame = 1
Query:  124 IRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLD-------ERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            ++  I+   ++IFS++TC  C ++KK  K   + Y  +E++    G  ++  L  +  +  +P VFV+   IGG     KA  EGR+QKLL         + Y+YDL++IGGGSGGLAA+KEAA +G KV VLDFV PTP GT WGLGGTCVNVGCIPKKLMHQ+ALL  + +D+R+YGW V ETV+H WD M+E +QNHI SLNWGYR +LR K V Y NAYG FI  H IK T+    E+I ++  F+IATGERPRY  IPGDKEY I+SDDLFSL YCPGKTLV+GASYVALECAGFLA +GL VTVMVRSI LRGFDQ MANKIG++MEEHG+ FI + VP K+  +E G+PG+  V       +   +  +NTV+ AIGRD CT +IGLE V + + +K G++ V +EEQ+ V  IYAIGDI+   ++LTPVAIQAG+ L++RL+ G  +  DY NVPTTVFTPLEYG+ GL+EE A+ K+G+E+IEV+H  F PLEWT+  R +N CY K+ICN  DN RVVGFHVL PNAGE+TQG+A A++ G TK+  D TIGIHP C+E FTTL++TK SGA   Q+GC
Sbjct:   59 LQAYIDGHSVVIFSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGC 647          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Human
Match: TXNRD1 (thioredoxin reductase 1 [Source:HGNC Symbol;Acc:HGNC:12437])

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 325/547 (59.41%), Postives = 403/547 (73.67%), Query Frame = 1
Query:  250 LATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLD-------ERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            +  G  ++  L  +  +  +P VFV+   IGG     KA  EGR+QKLL         + Y+YDL++IGGGSGGLAA+KEAA +G KV VLDFV PTP GT WGLGGTCVNVGCIPKKLMHQ+ALL  + +D+R+YGW V ETV+H WD M+E +QNHI SLNWGYR +LR K V Y NAYG FI  H IK T+    E+I ++  F+IATGERPRY  IPGDKEY I+SDDLFSL YCPGKTLV+GASYVALECAGFLA +GL VTVMVRSI LRGFDQ MANKIG++MEEHG+ FI + VP K+  +E G+PG+  V       +   +  +NTV+ AIGRD CT +IGLE V + + +K G++ V +EEQ+ V  IYAIGDI+   ++LTPVAIQAG+ L++RL+ G  +  DY NVPTTVFTPLEYG+ GL+EE A+ K+G+E+IEV+H  F PLEWT+  R +N CY K+ICN  DN RVVGFHVL PNAGE+TQG+A A++ G TK+  D TIGIHP C+E FTTL++TK SGA   Q+GC
Sbjct:    1 MEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGC 547          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Celegans
Match: trxr-1 (Thioredoxin reductase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q17745])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 299/604 (49.50%), Postives = 405/604 (67.05%), Query Frame = 1
Query:  112 LEEWIRKIINSSVLIIFS-----KTTCPFCYKIK--KSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPE-TVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGS---PGKKEVFGCYIKDKT----EYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDND-CYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQ-SGC*G 1872
            L+E +++  NS ++I ++     K    F   +   K   DA       EI  L      Q ++  +T   + P ++++G  +GG  +  KAL +  +++ L  R + YDL+VIGGGSGGLAA+KEA+  G KVA LDFVKP+PQGT+WGLGGTCVNVGCIPKKLMHQ++LL HS  DA+ YGW +PE  VEH W+++ + +Q+HI SLNWGYR  LR K V YIN+YG F     I  T+K      +T++ F+I+TG RP+YP IPG KEY ITSDDLF L Y PGKTL +GASYV+LECAGFL   G  VTVMVRSI LRGFDQ MA +I K+M  +G+ F    VPT+I  ++E +    GK  VF     ++T    E  + +NT+L AIGR+  TD +GL  + ++  K+ +V+   E+ +T+  +YAIGD++    +LTPVAIQAG+ L RR+F G + LT+Y  +PTTVFTPLEYG  GL+EEDA+ KYGK++I ++H  F PLE+T++ R D D CY K+IC +++  +VVGFH+L+PNAGE+TQG+ IA+++ A K DFD  IGIHPT +E FTTL + K  G +  Q SGC G
Sbjct:   35 LKEALKEAANSKIVIFYNSSDEEKQLVEFETYLNSLKEPADAEKPLEIPEIKKLQVSRASQKVIQYLTLHTSWPLMYIKGNAVGGLKEL-KALKQDYLKEWL--RDHTYDLIVIGGGSGGLAAAKEASRLGKKVACLDFVKPSPQGTSWGLGGTCVNVGCIPKKLMHQASLLGHSIHDAKKYGWKLPEGKVEHQWNHLRDSVQDHIASLNWGYRVQLREKTVTYINSYGEFTGPFEISATNKKKKVEKLTADRFLISTGLRPKYPEIPGVKEYTITSDDLFQLPYSPGKTLCVGASYVSLECAGFLHGFGFDVTVMVRSILLRGFDQDMAERIRKHMIAYGMKF-EAGVPTRIEQIDEKTDEKAGKYRVFWPKKNEETGEMQEVSEEYNTILMAIGREAVTDDVGLTTIGVERAKSKKVLGRREQSTTIPWVYAIGDVLEGTPELTPVAIQAGRVLMRRIFDGANELTEYDQIPTTVFTPLEYGCCGLSEEDAMMKYGKDNIIIYHNVFNPLEYTISERMDKDHCYLKMICLRNEEEKVVGFHILTPNAGEVTQGFGIALKLAAKKADFDRLIGIHPTVAENFTTLTLEKKEGDEELQASGCUG 634          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Celegans
Match: trxr-1 (Thioredoxin reductase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q17745])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 299/604 (49.50%), Postives = 405/604 (67.05%), Query Frame = 1
Query:  112 LEEWIRKIINSSVLIIFS-----KTTCPFCYKIK--KSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPE-TVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGS---PGKKEVFGCYIKDKT----EYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDND-CYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQ-SGC*G 1872
            L+E +++  NS ++I ++     K    F   +   K   DA       EI  L      Q ++  +T   + P ++++G  +GG  +  KAL +  +++ L  R + YDL+VIGGGSGGLAA+KEA+  G KVA LDFVKP+PQGT+WGLGGTCVNVGCIPKKLMHQ++LL HS  DA+ YGW +PE  VEH W+++ + +Q+HI SLNWGYR  LR K V YIN+YG F     I  T+K      +T++ F+I+TG RP+YP IPG KEY ITSDDLF L Y PGKTL +GASYV+LECAGFL   G  VTVMVRSI LRGFDQ MA +I K+M  +G+ F    VPT+I  ++E +    GK  VF     ++T    E  + +NT+L AIGR+  TD +GL  + ++  K+ +V+   E+ +T+  +YAIGD++    +LTPVAIQAG+ L RR+F G + LT+Y  +PTTVFTPLEYG  GL+EEDA+ KYGK++I ++H  F PLE+T++ R D D CY K+IC +++  +VVGFH+L+PNAGE+TQG+ IA+++ A K DFD  IGIHPT +E FTTL + K  G +  Q SGC G
Sbjct:   68 LKEALKEAANSKIVIFYNSSDEEKQLVEFETYLNSLKEPADAEKPLEIPEIKKLQVSRASQKVIQYLTLHTSWPLMYIKGNAVGGLKEL-KALKQDYLKEWL--RDHTYDLIVIGGGSGGLAAAKEASRLGKKVACLDFVKPSPQGTSWGLGGTCVNVGCIPKKLMHQASLLGHSIHDAKKYGWKLPEGKVEHQWNHLRDSVQDHIASLNWGYRVQLREKTVTYINSYGEFTGPFEISATNKKKKVEKLTADRFLISTGLRPKYPEIPGVKEYTITSDDLFQLPYSPGKTLCVGASYVSLECAGFLHGFGFDVTVMVRSILLRGFDQDMAERIRKHMIAYGMKF-EAGVPTRIEQIDEKTDEKAGKYRVFWPKKNEETGEMQEVSEEYNTILMAIGREAVTDDVGLTTIGVERAKSKKVLGRREQSTTIPWVYAIGDVLEGTPELTPVAIQAGRVLMRRIFDGANELTEYDQIPTTVFTPLEYGCCGLSEEDAMMKYGKDNIIIYHNVFNPLEYTISERMDKDHCYLKMICLRNEEEKVVGFHILTPNAGEVTQGFGIALKLAAKKADFDRLIGIHPTVAENFTTLTLEKKEGDEELQASGCUG 667          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Celegans
Match: trxr-2 (Probable glutathione reductase 2 [Source:UniProtKB/Swiss-Prot;Acc:P30635])

HSP 1 Score: 435.261 bits (1118), Expect = 1.292e-145
Identity = 219/493 (44.42%), Postives = 321/493 (65.11%), Query Frame = 1
Query:  412 EYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWN--VPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEH--TIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDK-NGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDND-CYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*G 1872
            ++DL+VIG GSGGL+ SK AA+ GA VA++D V+PTP G +WG+GGTC NVGCIPKKLMHQ+A++    + A  YGWN    E ++H W+ + + + + +++ NW YR  L  K ++Y NAY  F+D+    I  TDK   +  +++ N +I+TG RP+YPNIPG  E GITSDDLF+L+  PGKTL++G  YVALECAGFL++    V V+VRSI L+GFD+   + + ++++  GV  + E V  + +   E    KK+V         EY    +TV++A GR P    + L+N  +  DK +G+++ +E ++++ + +YA+GDI+    +LTP+AIQ+GK L+ RLF     +  +  V TTVFTPLE  ++GL EE+AI K+G++SIEVFH +F P E+ V    D+  CY K +C + ++ +++G H + PNA E+ QGYA+A R+G +  D  +TI IHP  SE F  L+ITK SG DP   GC G
Sbjct:   20 KFDLIVIGAGSGGLSCSKRAADLGANVALIDAVEPTPHGHSWGIGGTCANVGCIPKKLMHQAAIVGKELKHADKYGWNGIDQEKIKHDWNVLSKNVNDRVKANNWIYRVQLNQKKINYFNAYAEFVDKDKIVITGTDKNKTKNFLSAPNVVISTGLRPKYPNIPG-AELGITSDDLFTLASVPGKTLIVGGGYVALECAGFLSAFNQNVEVLVRSIPLKGFDRDCVHFVMEHLKTTGVK-VKEHVEVERV---EAVGSKKKVTFTGNGGVEEY----DTVIWAAGRVPNLKSLNLDNAGVRTDKRSGKILADEFDRASCNGVYAVGDIVQDRQELTPLAIQSGKLLADRLFSNSKQIVRFDGVATTVFTPLELSTVGLTEEEAIQKHGEDSIEVFHSHFTPFEYVVPQNKDSGFCYVKAVCTRDESQKILGLHFVGPNAAEVIQGYAVAFRVGISMSDLQNTIAIHPCSSEEFVKLHITKRSGQDPRTQGCCG 503          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Celegans
Match: gsr-1 (Glutathione reductase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q93379])

HSP 1 Score: 251.136 bits (640), Expect = 1.895e-75
Identity = 173/476 (36.34%), Postives = 268/476 (56.30%), Query Frame = 1
Query:  412 EYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTD-KYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVR-SIFLRGFDQQMANKIGKYMEE--HGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGE--HILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTL 1821
            E+D +VIGGGSGG+A+++ A  FG  V +++         +  LGGTCVNVGC+PKK+M+  +L      D   YG++V    +  W  + +    +I+ LN  Y + L+   V+YI     F ++ T++    KY  +      N +IA G +P  PNI G  E+GI SD  F L   P +T+V+GA Y+A+E AG LA+LG    +++R    LR FD+ +++++   M+E  + +        T++I  ++G           IK  T   +   T+++AIGRDP T  + LE V +  DK+G +IV+E + ++   I ++GD   + L LTPVAI AG+ LS RLF GE  + LT Y N+ T VF+    G++GL E +A+ KYGK+ + ++   F P+ + V    +     KL+C   D  +VVG HV    + E+ QG+A+A+ MGATK+ FD T+ IHPT +E   T+
Sbjct:    6 EFDYLVIGGGSGGIASARRAREFGVSVGLIE---------SGRLGGTCVNVGCVPKKVMYNCSLHAEFIRDHADYGFDVTLN-KFDWKVIKKSRDEYIKRLNGLYESGLKGSSVEYIRGRATFAEDGTVEVNGAKYRGK------NTLIAVGGKPTIPNIKG-AEHGIDSDGFFDLEDLPSRTVVVGAGYIAVEIAGVLANLGSDTHLLIRYDKVLRTFDKMLSDELTADMDEETNPLHLHKNTQVTEVIKGDDGL--------LTIKTTTGVIEKVQTLIWAIGRDPLTKELNLERVGVKTDKSGHIIVDEYQNTSAPGILSVGDDTGKFL-LTPVAIAAGRRLSHRLFNGETDNKLT-YENIATVVFSHPLIGTVGLTEAEAVEKYGKDEVTLYKSRFNPMLFAVTKHKEKAAM-KLVCVGKDE-KVVGVHVFGVGSDEMLQGFAVAVTMGATKKQFDQTVAIHPTSAEELVTM 452          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Celegans
Match: gsr-1 (Glutathione reductase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q93379])

HSP 1 Score: 251.136 bits (640), Expect = 1.895e-75
Identity = 173/476 (36.34%), Postives = 268/476 (56.30%), Query Frame = 1
Query:  412 EYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTD-KYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVR-SIFLRGFDQQMANKIGKYMEE--HGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGE--HILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTL 1821
            E+D +VIGGGSGG+A+++ A  FG  V +++         +  LGGTCVNVGC+PKK+M+  +L      D   YG++V    +  W  + +    +I+ LN  Y + L+   V+YI     F ++ T++    KY  +      N +IA G +P  PNI G  E+GI SD  F L   P +T+V+GA Y+A+E AG LA+LG    +++R    LR FD+ +++++   M+E  + +        T++I  ++G           IK  T   +   T+++AIGRDP T  + LE V +  DK+G +IV+E + ++   I ++GD   + L LTPVAI AG+ LS RLF GE  + LT Y N+ T VF+    G++GL E +A+ KYGK+ + ++   F P+ + V    +     KL+C   D  +VVG HV    + E+ QG+A+A+ MGATK+ FD T+ IHPT +E   T+
Sbjct:    6 EFDYLVIGGGSGGIASARRAREFGVSVGLIE---------SGRLGGTCVNVGCVPKKVMYNCSLHAEFIRDHADYGFDVTLN-KFDWKVIKKSRDEYIKRLNGLYESGLKGSSVEYIRGRATFAEDGTVEVNGAKYRGK------NTLIAVGGKPTIPNIKG-AEHGIDSDGFFDLEDLPSRTVVVGAGYIAVEIAGVLANLGSDTHLLIRYDKVLRTFDKMLSDELTADMDEETNPLHLHKNTQVTEVIKGDDGL--------LTIKTTTGVIEKVQTLIWAIGRDPLTKELNLERVGVKTDKSGHIIVDEYQNTSAPGILSVGDDTGKFL-LTPVAIAAGRRLSHRLFNGETDNKLT-YENIATVVFSHPLIGTVGLTEAEAVEKYGKDEVTLYKSRFNPMLFAVTKHKEKAAM-KLVCVGKDE-KVVGVHVFGVGSDEMLQGFAVAVTMGATKKQFDQTVAIHPTSAEELVTM 452          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Fly
Match: Trxr-1 (gene:FBgn0020653 transcript:FBtr0071167)

HSP 1 Score: 509.605 bits (1311), Expect = 8.487e-175
Identity = 253/487 (51.95%), Postives = 334/487 (68.58%), Query Frame = 1
Query:  409 YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQ-GTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            Y+YDL+VIGGGS GLA +KEA   GA+VA LDFVKPTP  GT WG+GGTCVNVGCIPKKLMHQ++LL  +  +A +YGWNV E ++  W  +V+ +QNHI+S+NW  R  LR+K V+YIN  G+F+D HT+    K + ER IT+  F+IA G RPRYP+IPG  EYGITSDDLFSL   PGKTLV+GA Y+ LECAGFL  LG + TVMVRSI LRGFDQQMA  +   MEE G+ F+ + VP   + +E+   GK  V    ++   E +D ++TVL+AIGR    D + L N  + + K+ ++ V+ +E + V+NIYA+GDII    +LTPVA+ AG+ L+RRL+GG     DY +V TTVFTPLEY  +GL+EEDA+ ++G + IEVFH  +KP E+ +  +    CY K +  +  + RV G H + P AGE+ QG+A A++ G T     +T+GIHPT +E FT L ITK SG DP  + C
Sbjct:    8 YDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDEKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLK-SGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVP---LSVEKQDDGKLLVKYKNVETGEEAEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKD-KIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLDPTPASC 489          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Fly
Match: Trxr-1 (gene:FBgn0020653 transcript:FBtr0071169)

HSP 1 Score: 509.605 bits (1311), Expect = 1.536e-174
Identity = 253/487 (51.95%), Postives = 334/487 (68.58%), Query Frame = 1
Query:  409 YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQ-GTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            Y+YDL+VIGGGS GLA +KEA   GA+VA LDFVKPTP  GT WG+GGTCVNVGCIPKKLMHQ++LL  +  +A +YGWNV E ++  W  +V+ +QNHI+S+NW  R  LR+K V+YIN  G+F+D HT+    K + ER IT+  F+IA G RPRYP+IPG  EYGITSDDLFSL   PGKTLV+GA Y+ LECAGFL  LG + TVMVRSI LRGFDQQMA  +   MEE G+ F+ + VP   + +E+   GK  V    ++   E +D ++TVL+AIGR    D + L N  + + K+ ++ V+ +E + V+NIYA+GDII    +LTPVA+ AG+ L+RRL+GG     DY +V TTVFTPLEY  +GL+EEDA+ ++G + IEVFH  +KP E+ +  +    CY K +  +  + RV G H + P AGE+ QG+A A++ G T     +T+GIHPT +E FT L ITK SG DP  + C
Sbjct:   25 YDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDEKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLK-SGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVP---LSVEKQDDGKLLVKYKNVETGEEAEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKD-KIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLDPTPASC 506          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Fly
Match: Trxr-1 (gene:FBgn0020653 transcript:FBtr0071168)

HSP 1 Score: 509.22 bits (1310), Expect = 5.549e-173
Identity = 253/487 (51.95%), Postives = 334/487 (68.58%), Query Frame = 1
Query:  409 YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQ-GTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            Y+YDL+VIGGGS GLA +KEA   GA+VA LDFVKPTP  GT WG+GGTCVNVGCIPKKLMHQ++LL  +  +A +YGWNV E ++  W  +V+ +QNHI+S+NW  R  LR+K V+YIN  G+F+D HT+    K + ER IT+  F+IA G RPRYP+IPG  EYGITSDDLFSL   PGKTLV+GA Y+ LECAGFL  LG + TVMVRSI LRGFDQQMA  +   MEE G+ F+ + VP   + +E+   GK  V    ++   E +D ++TVL+AIGR    D + L N  + + K+ ++ V+ +E + V+NIYA+GDII    +LTPVA+ AG+ L+RRL+GG     DY +V TTVFTPLEY  +GL+EEDA+ ++G + IEVFH  +KP E+ +  +    CY K +  +  + RV G H + P AGE+ QG+A A++ G T     +T+GIHPT +E FT L ITK SG DP  + C
Sbjct:  113 YDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDEKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLK-SGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVP---LSVEKQDDGKLLVKYKNVETGEEAEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKD-KIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLDPTPASC 594          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Fly
Match: Trxr-2 (gene:FBgn0037170 transcript:FBtr0078514)

HSP 1 Score: 465.307 bits (1196), Expect = 4.243e-157
Identity = 232/489 (47.44%), Postives = 320/489 (65.44%), Query Frame = 1
Query:  406 QYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPET-VEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNE-RIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            +Y+YDLVV+GGGS GLA +KEAA  GA+V   D+VKPTP GT WG+GGTCVNVGCIPKKLMHQ++LL  +  +A +YGWNV +T +   W  +V  +QNHI+S+NW  R  LR+K V+Y+N+   F D HTI+       E R +TS   ++A G RPRYP+IPG  E GITSDD+FS    PG+TLV+GA YV LECA FL  LG + TVMVRSI LRGFD+QM+  +   M E G+ F+   +P  +   E  + G+  V       + +  D F+TVL+AIGR    + + L+   +    + +++V+  E ++V +I+A+GDII    +LTPVAI +G+ L+RRLF G   L DY +V TTVFTPLEY  +G++EE AI   G ++IEVFH  +KP E+ +  +    CY K +   S + +++G H + P AGE+ QG+A A++ G T +   +T+GIHPT +E FT L+ITK SG DP  + C
Sbjct:   30 RYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPKKLMHQASLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGAVELGITSDDIFSYEREPGRTLVVGAGYVGLECACFLKGLGYEPTVMVRSIVLRGFDRQMSELLAAMMTERGIPFLGTTIPKAV---ERQADGRLLVRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLNLDAAGVKTHDD-KIVVDAAEATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMSEETAIELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGEVIQGFAAALKTGLTVKTLLNTVGIHPTTAEEFTRLSITKRSGRDPTPASC 514          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Fly
Match: CG7430 (gene:FBgn0036762 transcript:FBtr0075140)

HSP 1 Score: 175.637 bits (444), Expect = 2.705e-47
Identity = 140/495 (28.28%), Postives = 227/495 (45.86%), Query Frame = 1
Query:  409 YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCE--DARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATG-ERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVM--VRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKI-----------IPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAH-RGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASG 1842
            +E D+VVIG G GG  A+ +AA  G K   ++            LGGTC+NVGCIP K +  ++   H     D    G +   +V    + ++ +  N +++L  G     +   V  +  +G  ++ + ++      +   + + N +IATG E   +P I  D+E  ++S     L+  P   +VIGA  + LE     + LG +VT +  + +I   G D +++    K + + G+ F    + TK+           + +E    G+KE   C            + +L ++GR P T+ +GLE V I  D  GR+ VN   Q+ V NIYAIGD I  G  L   A   G      + GG H+  DY  VP+ V+T  E   +G +EE    +  +E +      F  L  + A    D D + K++ +++ + +++G H++ P AGE+     +AM  GA   D       HPTCSE     N+  A G
Sbjct:   36 HEADIVVIGSGPGGYVAAIKAAQMGMKTVSVE--------KEATLGGTCLNVGCIPSKALLNNSHYYHMAHSGDLEKRGISCG-SVSLDLEKLMGQKSNAVKALTGGIAMLFKKNKVTQLTGFGTIVNPNEVEVKKSDGSTETVKTKNILIATGSEVTPFPGIEIDEEVIVSSTGALKLAKVPKHLVVIGAGVIGLELGSVWSRLGAEVTAIEFMDTIGGVGIDNEVSKTFQKVLTKQGLKF---KLGTKVTAASRSGDNVTVSVENAKSGEKEEIQC------------DALLVSVGRRPYTEGLGLEAVGIVKDDRGRIPVNATFQTVVPNIYAIGDCI-HGPMLAHKAEDEGLITIEGINGG-HVHIDYNCVPSVVYTHPEVAWVGKSEE----QLKQEGVAYKVGKFPFLANSRAKTNNDTDGFVKVLADQATD-KILGTHIIGPGAGELINEAVLAMEYGAAAEDVARVCHAHPTCSEALREANVAAAFG 499          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Zebrafish
Match: txnrd3 (thioredoxin reductase 3 [Source:ZFIN;Acc:ZDB-GENE-030327-3])

HSP 1 Score: 739.184 bits (1907), Expect = 0.000e+0
Identity = 352/600 (58.67%), Postives = 446/600 (74.33%), Query Frame = 1
Query:   91 MPPIST-----ALEEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDE--RQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            MPPI        +   I+++I+SS +++FSK+ CPFC K+K   K+ N+KY  +E++L+  G+  QD+L+ +T Q+TVPNVF+   HIGGCD+  KA  +G +QKLL E    Y+YDL+VIGGGSGGLA SKEAA  G KV VLD+V PTPQGT WGLGGTCVNVGCIPKKLMHQ+ALL  + EDAR +GW   E V H+W+ M   + N+I SLNWGYR SLR+K V+Y+NAY  F++ H IK T+K   E   T+  F++ATGERPRY  IPGDKE+ ITSDDLFSL YCPGKTLV+GASYVALEC GFLA LGL VT+MVRSI LRGFDQ MA++ G+YME HGV F+ + VPTKI  +E G+PG+ +V     + +  ++  +NTVL A+GRD CT +IGL+   + + +KNG+V VN+EEQ+ V +IYAIGDI+    +LTPVAIQAGK L+RRL+ G  +  DYVNVPTTVFTP+EYGS G  EE AI  YG+E++EV+H  F PLE+TV  R +N CY K+ICNK DN+RV+GFH L PNAGE+TQG+  AM+ G TK   D+TIGIHPTC+E FTT+ +TK+SG D  QSGC
Sbjct:    1 MPPIENDAGREQIRSKIKELIDSSAVVVFSKSFCPFCVKVKDLFKELNVKYNTIELDLMEDGTNYQDLLHEMTGQKTVPNVFINKKHIGGCDNTMKAHKDGVLQKLLGEGSEVYDYDLIVIGGGSGGLACSKEAATLGKKVMVLDYVVPTPQGTAWGLGGTCVNVGCIPKKLMHQTALLGTAMEDARKFGWEFAEQVTHNWETMKTAVNNYIGSLNWGYRVSLRDKNVNYVNAYAEFVEPHKIKATNKRGKETFYTAAQFVLATGERPRYLGIPGDKEFCITSDDLFSLPYCPGKTLVVGASYVALECGGFLAGLGLDVTIMVRSILLRGFDQDMADRAGEYMETHGVKFLRKFVPTKIEQLEAGTPGRIKVTAKSTESEEVFEGEYNTVLIAVGRDACTGKIGLDKAGVKINEKNGKVPVNDEEQTNVPHIYAIGDILEGKWELTPVAIQAGKLLARRLYAGATMKCDYVNVPTTVFTPMEYGSCGHPEEKAIQMYGQENLEVYHSLFWPLEFTVPGRDNNKCYAKIICNKLDNLRVIGFHYLGPNAGEVTQGFGAAMKCGITKDQLDNTIGIHPTCAEIFTTMEVTKSSGGDITQSGC 600          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Zebrafish
Match: txnrd3 (thioredoxin reductase 3 [Source:ZFIN;Acc:ZDB-GENE-030327-3])

HSP 1 Score: 739.184 bits (1907), Expect = 0.000e+0
Identity = 353/602 (58.64%), Postives = 447/602 (74.25%), Query Frame = 1
Query:   91 MPPIST-----ALEEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDE--RQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*G 1872
            MPPI        +   I+++I+SS +++FSK+ CPFC K+K   K+ N+KY  +E++L+  G+  QD+L+ +T Q+TVPNVF+   HIGGCD+  KA  +G +QKLL E    Y+YDL+VIGGGSGGLA SKEAA  G KV VLD+V PTPQGT WGLGGTCVNVGCIPKKLMHQ+ALL  + EDAR +GW   E V H+W+ M   + N+I SLNWGYR SLR+K V+Y+NAY  F++ H IK T+K   E   T+  F++ATGERPRY  IPGDKE+ ITSDDLFSL YCPGKTLV+GASYVALEC GFLA LGL VT+MVRSI LRGFDQ MA++ G+YME HGV F+ + VPTKI  +E G+PG+ +V     + +  ++  +NTVL A+GRD CT +IGL+   + + +KNG+V VN+EEQ+ V +IYAIGDI+    +LTPVAIQAGK L+RRL+ G  +  DYVNVPTTVFTP+EYGS G  EE AI  YG+E++EV+H  F PLE+TV  R +N CY K+ICNK DN+RV+GFH L PNAGE+TQG+  AM+ G TK   D+TIGIHPTC+E FTT+ +TK+SG D  QSGC G
Sbjct:    1 MPPIENDAGREQIRSKIKELIDSSAVVVFSKSFCPFCVKVKDLFKELNVKYNTIELDLMEDGTNYQDLLHEMTGQKTVPNVFINKKHIGGCDNTMKAHKDGVLQKLLGEGSEVYDYDLIVIGGGSGGLACSKEAATLGKKVMVLDYVVPTPQGTAWGLGGTCVNVGCIPKKLMHQTALLGTAMEDARKFGWEFAEQVTHNWETMKTAVNNYIGSLNWGYRVSLRDKNVNYVNAYAEFVEPHKIKATNKRGKETFYTAAQFVLATGERPRYLGIPGDKEFCITSDDLFSLPYCPGKTLVVGASYVALECGGFLAGLGLDVTIMVRSILLRGFDQDMADRAGEYMETHGVKFLRKFVPTKIEQLEAGTPGRIKVTAKSTESEEVFEGEYNTVLIAVGRDACTGKIGLDKAGVKINEKNGKVPVNDEEQTNVPHIYAIGDILEGKWELTPVAIQAGKLLARRLYAGATMKCDYVNVPTTVFTPMEYGSCGHPEEKAIQMYGQENLEVYHSLFWPLEFTVPGRDNNKCYAKIICNKLDNLRVIGFHYLGPNAGEVTQGFGAAMKCGITKDQLDNTIGIHPTCAEIFTTMEVTKSSGGDITQSGCUG 602          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Zebrafish
Match: txnrd2.2 (thioredoxin reductase 2, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-040914-66])

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 259/489 (52.97%), Postives = 345/489 (70.55%), Query Frame = 1
Query:  406 QYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYP-NIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDK-NGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            +++YDLVVIGGGSGGLA SKEAA  G KVAVLD+V+P+ +GT WGLGGTCVNVGCIPKKLMHQ+ALL  + +DAR YGW +PET+ H W  M E +QNH++SLNWG+R  L++K V Y+N  G  +D+HT++  +    E  +T+ N ++ATG RP+YP ++PG  E+GITSDD+F L   P KTL+IGASYV+LECAGFL  +GL  +VMVRSI LRGFDQQM+  +  YME +G  F  +C P  +   E+   G  +V    +  K E++D FN+VL+A+GR P T  + LE V + ++K  G++IV  +E ++V NI+AIGDI     +LTP AI+AGK L+ RL G    L +Y NV TTVFTPLEYG +GL+EE+A  ++GK+ IEV+H  +KPLE+TVA R    CY K++C +  + RV+G H   PNAGE+TQG+A+  + G T     +T+GIHPTC+E  T LNITK SG D   +GC
Sbjct:   30 KFDYDLVVIGGGSGGLACSKEAAQLGQKVAVLDYVEPSLKGTKWGLGGTCVNVGCIPKKLMHQAALLGTAVKDARKYGWQIPETLSHDWPTMAEAVQNHVRSLNWGHRVQLQDKKVKYLNMKGTLLDKHTVRAVNAQGKEMTVTARNILLATGGRPKYPTHVPGAMEFGITSDDIFWLKESPKKTLIIGASYVSLECAGFLTGIGLDTSVMVRSIALRGFDQQMSGLVTDYMETYGTKFHWKCTPKSV---EKLPSGHLQVTWMDLNTKEEHQDTFNSVLWAVGRAPETKTLNLEKVGVKINKETGKIIVAADEATSVPNIFAIGDIGEGRPELTPTAIKAGKLLAHRLAGRSTELMNYENVATTVFTPLEYGCVGLSEEEAERRHGKDQIEVYHAFYKPLEFTVAERDATQCYIKVVCLREGDQRVLGLHFTGPNAGEVTQGFALGFQCGLTYEHLRNTVGIHPTCAEELTKLNITKRSGLDATVTGC 515          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Zebrafish
Match: txnrd2.2 (thioredoxin reductase 2, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-040914-66])

HSP 1 Score: 338.191 bits (866), Expect = 1.399e-110
Identity = 156/283 (55.12%), Postives = 206/283 (72.79%), Query Frame = 1
Query:  406 QYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYP-NIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAI 1251
            +++YDLVVIGGGSGGLA SKEAA  G KVAVLD+V+P+ +GT WGLGGTCVNVGCIPKKLMHQ+ALL  + +DAR YGW +PET+ H W  M E +QNH++SLNWG+R  L++K V Y+N  G  +D+HT++  +    E  +T+ N ++ATG RP+YP ++PG  E+GITSDD+F L   P KTL+IGASYV+LECAGFL  +GL  +VMVRSI LRGFDQQM+  +  YME +G  F  +C P  +   E+   G  +V    +  K E++D FN+VL+A+
Sbjct:   30 KFDYDLVVIGGGSGGLACSKEAAQLGQKVAVLDYVEPSLKGTKWGLGGTCVNVGCIPKKLMHQAALLGTAVKDARKYGWQIPETLSHDWPTMAEAVQNHVRSLNWGHRVQLQDKKVKYLNMKGTLLDKHTVRAVNAQGKEMTVTARNILLATGGRPKYPTHVPGAMEFGITSDDIFWLKESPKKTLIIGASYVSLECAGFLTGIGLDTSVMVRSIALRGFDQQMSGLVTDYMETYGTKFHWKCTPKSV---EKLPSGHLQVTWMDLNTKEEHQDTFNSVLWAV 309          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Zebrafish
Match: gsr (glutathione reductase [Source:ZFIN;Acc:ZDB-GENE-050522-116])

HSP 1 Score: 272.322 bits (695), Expect = 8.771e-83
Identity = 160/466 (34.33%), Postives = 261/466 (56.01%), Query Frame = 1
Query:  463 KEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFID--EHTIKTTDKYNNERIITSNNFIIATGERPRY---PNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSI-FLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTV------LFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGE-HILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTL 1821
            + AA  GA  AV++         +  LGGTCVNVGC+PKK+M  ++       D   YG+   +    SW  +  +   ++  LN  YR++L    +++I+ Y  F D  E T++      N +  T+ + +I+TG  P      ++PG    GITSD  F L  CP +++++GA Y+A+E AG L++LG K ++++R    LR FD  +++   K ++ +G+D       T++  +++   G          D  + ++ F+T+      L+AIGR+P T  + L  + + LD+ G ++V+E + ++   +YA+GD+  R L LTPVAI AG+ L+ RLF G+     DY N+PT VF+    G++GL E++A+  YGK+ ++V+  +F P+ + +  R  + C  KL+C   +N +VVG H+      E+ QG+A+A+ MGATK DFD TI IHPT SE   TL
Sbjct:   56 RRAAELGATTAVIE---------SHRLGGTCVNVGCVPKKVMWNTSTHAEYLHDHEDYGFEGAK-AHFSWQIIKHKRDAYVSRLNQIYRSNLEKGKIEFIHGYARFTDDPEPTVEV-----NGKKYTATHILISTGGHPSTVSEDDVPGS-SLGITSDGFFELESCPKRSVIVGAGYIAVEMAGILSTLGSKTSIIIRQGGVLRNFDALISSNCTKELQNNGIDLRKN---TQVKSVKKNGKGLSITLVTKDPDDKDSQEKFDTINDVDCLLWAIGREPNTAGLNLSQIGVKLDERGHIVVDEFQNTSRPGVYAVGDVCGRAL-LTPVAIAAGRKLAHRLFEGKADSKVDYNNIPTVVFSHPPIGTVGLTEDEAVKTYGKDKVKVYTTSFTPMYYAITTR-KSQCIMKLVC-AGENEKVVGLHMQGFGCDEMLQGFAVAVNMGATKADFDRTIAIHPTSSEELVTL 499          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Xenopus
Match: txnrd3 (Xenopus tropicalis thioredoxin reductase 3 (txnrd3), mRNA. [Source:RefSeq mRNA;Acc:NM_001353367])

HSP 1 Score: 733.791 bits (1893), Expect = 0.000e+0
Identity = 349/596 (58.56%), Postives = 446/596 (74.83%), Query Frame = 1
Query:   91 MPPISTAL-EEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDERQ--YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            MPP    L +  ++++I+S+ +++FSK+ CP+C ++K+       +Y A+E++    G+ IQ+ L+ +T QRTVPNVFV  TH+GGCD   KA  +G + KLL +    Y+YDL+VIGGGSGGLA SKEAA+FG KV VLD+V PTP+GT+WGLGGTCVNVGCIPKKLMHQ+A+L  S +D+R +GW   E V+H+WD M E IQN+I SLNWGYR SLR+K V Y NAYG F++ H IK T+K   E   T+  F++ATGERPRY NIPGDKEY ITSDDLFSL YCPGKTLV+GASYVALECAGFLA LGL  TVMVRSI LRGFDQ+MAN+ G YME HGV FI + VP  +  +EEG+PG+ +V     +     +D +NTVL A+GRD CT  IGLE + + + ++NG++ V++EEQ++V  +YAIGDI+   L+LTPVAIQAG+ L+RRL+ G  +  DYVNVPTTVFTPLEYG  G AEE AI  YG+E++EV+H  F PLEWTV  R +N C+ K+ICNK D+ RVVGFHVL PNAGEITQG+  A++ G TK   D+TIGIHPTC+E FTT++++K+SG D  Q GC
Sbjct:   34 MPPTGRELLQARVKELIDSNRVMVFSKSFCPYCDQVKELFSSLGAEYQALELDECDDGTAIQETLHELTGQRTVPNVFVNKTHVGGCDKTLKAHKDGSLAKLLGDNSVTYDYDLIVIGGGSGGLACSKEAASFGKKVMVLDYVVPTPKGTSWGLGGTCVNVGCIPKKLMHQAAILGQSLKDSRKFGWEYEEQVKHNWDTMREAIQNYIGSLNWGYRVSLRDKQVRYENAYGEFVEPHKIKATNKRGKESFFTAEKFVVATGERPRYLNIPGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGLGLDATVMVRSILLRGFDQEMANRAGAYMETHGVKFIKQFVPISVELLEEGTPGRLKVTAKATEGDQIIEDEYNTVLIAVGRDACTRNIGLEKIGVKVNERNGKIPVSDEEQTSVPYVYAIGDILDGKLELTPVAIQAGRLLARRLYKGSKLKCDYVNVPTTVFTPLEYGCCGYAEEKAIEIYGEENLEVYHTLFWPLEWTVPSRDNNTCFAKIICNKQDDDRVVGFHVLGPNAGEITQGFGAAIKCGLTKEKLDETIGIHPTCAEVFTTMDVSKSSGGDITQKGC 629          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Xenopus
Match: txnrd3 (Xenopus tropicalis thioredoxin reductase 3 (txnrd3), mRNA. [Source:RefSeq mRNA;Acc:NM_001353367])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 347/596 (58.22%), Postives = 440/596 (73.83%), Query Frame = 1
Query:   91 MPPISTAL-EEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDERQ--YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            MPP    L +  ++++I+S+ +++FSK+ CP+C ++ +S           E      G+ IQ+ L+ +T QRTVPNVFV  TH+GGCD   KA  +G + KLL +    Y+YDL+VIGGGSGGLA SKEAA+FG KV VLD+V PTP+GT+WGLGGTCVNVGCIPKKLMHQ+A+L  S +D+R +GW   E V+H+WD M E IQN+I SLNWGYR SLR+K V Y NAYG F++ H IK T+K   E   T+  F++ATGERPRY NIPGDKEY ITSDDLFSL YCPGKTLV+GASYVALECAGFLA LGL  TVMVRSI LRGFDQ+MAN+ G YME HGV FI + VP  +  +EEG+PG+ +V     +     +D +NTVL A+GRD CT  IGLE + + + ++NG++ V++EEQ++V  +YAIGDI+   L+LTPVAIQAG+ L+RRL+ G  +  DYVNVPTTVFTPLEYG  G AEE AI  YG+E++EV+H  F PLEWTV  R +N C+ K+ICNK D+ RVVGFHVL PNAGEITQG+  A++ G TK   D+TIGIHPTC+E FTT++++K+SG D  Q GC
Sbjct:    1 MPPTGRELLQARVKELIDSNRVMVFSKSFCPYCDQVSESA-------PCWEAGACYDGTAIQETLHELTGQRTVPNVFVNKTHVGGCDKTLKAHKDGSLAKLLGDNSVTYDYDLIVIGGGSGGLACSKEAASFGKKVMVLDYVVPTPKGTSWGLGGTCVNVGCIPKKLMHQAAILGQSLKDSRKFGWEYEEQVKHNWDTMREAIQNYIGSLNWGYRVSLRDKQVRYENAYGEFVEPHKIKATNKRGKESFFTAEKFVVATGERPRYLNIPGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGLGLDATVMVRSILLRGFDQEMANRAGAYMETHGVKFIKQFVPISVELLEEGTPGRLKVTAKATEGDQIIEDEYNTVLIAVGRDACTRNIGLEKIGVKVNERNGKIPVSDEEQTSVPYVYAIGDILDGKLELTPVAIQAGRLLARRLYKGSKLKCDYVNVPTTVFTPLEYGCCGYAEEKAIEIYGEENLEVYHTLFWPLEWTVPSRDNNTCFAKIICNKQDDDRVVGFHVLGPNAGEITQGFGAAIKCGLTKEKLDETIGIHPTCAEVFTTMDVSKSSGGDITQKGC 589          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Xenopus
Match: txnrd3 (Xenopus tropicalis thioredoxin reductase 3 (txnrd3), mRNA. [Source:RefSeq mRNA;Acc:NM_001353367])

HSP 1 Score: 707.597 bits (1825), Expect = 0.000e+0
Identity = 339/576 (58.85%), Postives = 431/576 (74.83%), Query Frame = 1
Query:   91 MPPISTAL-EEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDERQ--YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSE 1806
            MPP    L +  ++++I+S+ +++FSK+ CP+C ++K+       +Y A+E++    G+ IQ+ L+ +T QRTVPNVFV  TH+GGCD   KA  +G + KLL +    Y+YDL+VIGGGSGGLA SKEAA+FG KV VLD+V PTP+GT+WGLGGTCVNVGCIPKKLMHQ+A+L  S +D+R +GW   E V+H+WD M E IQN+I SLNWGYR SLR+K V Y NAYG F++ H IK T+K   E   T+  F++ATGERPRY NIPGDKEY ITSDDLFSL YCPGKTLV+GASYVALECAGFLA LGL  TVMVRSI LRGFDQ+MAN+ G YME HGV FI + VP  +  +EEG+PG+ +V     +     +D +NTVL A+GRD CT  IGLE + + + ++NG++ V++EEQ++V  +YAIGDI+   L+LTPVAIQAG+ L+RRL+ G  +  DYVNVPTTVFTPLEYG  G AEE AI  YG+E++EV+H  F PLEWTV  R +N C+ K+ICNK D+ RVVGFHVL PNAGEITQG+  A++ G TK   D+TIGIHPTC+E
Sbjct:    1 MPPTGRELLQARVKELIDSNRVMVFSKSFCPYCDQVKELFSSLGAEYQALELDECDDGTAIQETLHELTGQRTVPNVFVNKTHVGGCDKTLKAHKDGSLAKLLGDNSVTYDYDLIVIGGGSGGLACSKEAASFGKKVMVLDYVVPTPKGTSWGLGGTCVNVGCIPKKLMHQAAILGQSLKDSRKFGWEYEEQVKHNWDTMREAIQNYIGSLNWGYRVSLRDKQVRYENAYGEFVEPHKIKATNKRGKESFFTAEKFVVATGERPRYLNIPGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGLGLDATVMVRSILLRGFDQEMANRAGAYMETHGVKFIKQFVPISVELLEEGTPGRLKVTAKATEGDQIIEDEYNTVLIAVGRDACTRNIGLEKIGVKVNERNGKIPVSDEEQTSVPYVYAIGDILDGKLELTPVAIQAGRLLARRLYKGSKLKCDYVNVPTTVFTPLEYGCCGYAEEKAIEIYGEENLEVYHTLFWPLEWTVPSRDNNTCFAKIICNKQDDDRVVGFHVLGPNAGEITQGFGAAIKCGLTKEKLDETIGIHPTCAE 576          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Xenopus
Match: txnrd3 (Xenopus tropicalis thioredoxin reductase 3 (txnrd3), mRNA. [Source:RefSeq mRNA;Acc:NM_001353367])

HSP 1 Score: 683.715 bits (1763), Expect = 0.000e+0
Identity = 332/574 (57.84%), Postives = 415/574 (72.30%), Query Frame = 1
Query:  154 IIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDERQ--YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            ++FSK+ CP+C ++K+       +Y A+E++    G+ IQ+ L+ +T QRTVPNVFV  TH+GGCD   KA  +G + KLL +    Y+YDL+VIGGGSGGLA SKEAA+FG KV VLD+V PTP+GT+WGLGGTCVNVGCIPKKLMHQ+A+L  S +D+R +GW   E V+H+WD M E IQN+I SLNWGYR SLR+K V Y NAYG F++ H IK + +   E   T+  F++ATGERPRY NIPGDKEY ITSDDLFSL YCPGKTLV+GASYVALECAGFLA LGL  TVMVRSI LRGFDQ+MAN+ G YME HGV FI + VP                                +VL A+GRD CT  IGLE + + + ++NG++ V++EEQ++V  +YAIGDI+   L+LTPVAIQAG+ L+RRL+ G  +  DYVNVPTTVFTPLEYG  G AEE AI  YG+E++EV+H  F PLEWTV  R +N C+ K+ICNK D+ RVVGFHVL PNAGEITQG+  A++ G TK   D+TIGIHPTC+E FTT++++K+SG D  Q GC
Sbjct:    1 MVFSKSFCPYCDQVKELFSSLGAEYQALELDECDDGTAIQETLHELTGQRTVPNVFVNKTHVGGCDKTLKAHKDGSLAKLLGDNSVTYDYDLIVIGGGSGGLACSKEAASFGKKVMVLDYVVPTPKGTSWGLGGTCVNVGCIPKKLMHQAAILGQSLKDSRKFGWEYEEQVKHNWDTMREAIQNYIGSLNWGYRVSLRDKQVRYENAYGEFVEPHKIKVSGR-GKESFFTAEKFVVATGERPRYLNIPGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGLGLDATVMVRSILLRGFDQEMANRAGAYMETHGVKFIKQFVPI-------------------------------SVLIAVGRDACTRNIGLEKIGVKVNERNGKIPVSDEEQTSVPYVYAIGDILDGKLELTPVAIQAGRLLARRLYKGSKLKCDYVNVPTTVFTPLEYGCCGYAEEKAIEIYGEENLEVYHTLFWPLEWTVPSRDNNTCFAKIICNKQDDDRVVGFHVLGPNAGEITQGFGAAIKCGLTKEKLDETIGIHPTCAEVFTTMDVSKSSGGDITQKGC 542          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Xenopus
Match: nmt1 (N-myristoyltransferase 1 [Source:Xenbase;Acc:XB-GENE-953051])

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 349/596 (58.56%), Postives = 433/596 (72.65%), Query Frame = 1
Query:  106 TALEEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDERQ-------YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLE--NVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            + L+  I + I SS ++IFSKT+C  C   K+SL D               G +++++LY  T + ++P+VFV+  HIG  DD  K   E   QKLL+ ++       Y+YDL+VIGGGSGGLAASKEAAN+G KV VLDFV PTP GT WGLGGTCVNVGCIPKKLMHQ+ALL+ + +D++ YGW + + ++H+W+ M + + N+I SLN+ YR SL    V Y N YG F++ HTIK+T+    E+  T+  F+IATGERPRY  IPGDKEY ITSDDLFSL YCPGKTLV+GASYVALECAGFLA LGL VTVMVRSI LRGFDQQMAN IG+YMEEHGV FI +CVPTKI  +E G+PG+ +V      D  E  + +NTVL AIGRD CT  IGLE   VKI+ +K G++ VN+EEQ+ V  IYAIGD++   L+LTPVAIQAG+ L+RRL+G   +  DYVNVPTTVFTPLEYG+ GL+EE AI +Y +E+IEV+H  F PLEWTV  R +N CY K+ICN  D  RVVGFHVLSPNAGEITQG+A+A++ G TK   D+TIGIHP C+E FTTL +TK SG +  QSGC
Sbjct:    7 SGLKIEIEEYICSSDVVIFSKTSCNSC--AKRSLFD-----------FTENGHKLEELLYEQTMETSLPSVFVKEKHIGNYDDILKLSKENLFQKLLETKEDNPDRSGYDYDLIVIGGGSGGLAASKEAANYGKKVLVLDFVTPTPLGTKWGLGGTCVNVGCIPKKLMHQAALLRQALKDSQKYGWQIEDNIQHNWEIMTDSVLNYIGSLNFNYRVSLMQNNVKYENGYGEFVEPHTIKSTNSRGKEKYFTAEKFLIATGERPRYLGIPGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGLGLDVTVMVRSILLRGFDQQMANMIGEYMEEHGVKFIKQCVPTKIEQIEAGTPGRLKVTS-QASDGAETTEEYNTVLLAIGRDACTRNIGLEIPGVKIN-EKTGKIPVNDEEQTNVPYIYAIGDVLQDKLELTPVAIQAGRLLARRLYGDSTVKCDYVNVPTTVFTPLEYGACGLSEEHAIRQYEEENIEVYHSYFWPLEWTVPARDNNKCYAKIICNLKDKGRVVGFHVLSPNAGEITQGFAVAIKCGLTKDQLDNTIGIHPVCAEIFTTLTVTKRSGGNILQSGC 587          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Mouse
Match: Txnrd3 (thioredoxin reductase 3 [Source:MGI Symbol;Acc:MGI:2386711])

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 340/582 (58.42%), Postives = 430/582 (73.88%), Query Frame = 1
Query:  133 IINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLL-DERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*G 1872
            +I  + ++IFSK+ CP   ++K+      + Y  +E++ +  G+ +Q++L  I+NQ+TVPN+FV   H+GGCD   +A   G +QKLL D+  ++YDL++IGGGSGGL+ +KEAAN G KV VLDFV P+PQGTTWGLGGTCVNVGCIPKKLMHQ+ALL H+ +DA+ YGW   + V+H+W+ M E IQ+HI SLNWGYR +LR KGV Y+N++G F+D H IK T+K   E   T++ F+IATGERPRY  I GDKEY ITSDDLFSL YCPG TLV+GASYV LECAGFLA LGL VTVMVRS+ LRGFDQ+MA K+G Y+E+ GV F  +  P  +  +E+G PGK +V     +     +  +NTVL AIGRD CT +IGLE + + + +KNG++ VN+ EQ+ V ++YAIGDI+    +LTPVAIQAGK L+RRLFG      DY+N+PTTVFTPLEYG  GL+EE AI  Y KE++EV+H  F PLEWTVA R +N CY K+ICNK DN RVVGFH+L PNAGEITQG+A AM+ G TK+  DDTIGIHPTC E FTTL ITK+SG D  Q GC G
Sbjct:   34 LIEGNRVMIFSKSYCPHSTRVKELFSSLGVVYNILELDQVDDGASVQEVLTEISNQKTVPNIFVNKVHVGGCDRTFQAHQNGLLQKLLQDDSAHDYDLIIIGGGSGGLSCAKEAANLGKKVMVLDFVVPSPQGTTWGLGGTCVNVGCIPKKLMHQAALLGHALQDAKKYGWEYNQQVKHNWEAMTEAIQSHIGSLNWGYRVTLREKGVTYVNSFGEFVDLHKIKATNKKGQETFYTASKFVIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGCTLVVGASYVGLECAGFLAGLGLDVTVMVRSVLLRGFDQEMAEKVGSYLEQQGVKFQRKFTPILVQQLEKGLPGKLKVVAKSTEGPETVEGIYNTVLLAIGRDSCTRKIGLEKIGVKINEKNGKIPVNDVEQTNVPHVYAIGDILDGKPELTPVAIQAGKLLARRLFGVSLEKCDYINIPTTVFTPLEYGCCGLSEEKAIEMYKKENLEVYHTLFWPLEWTVAGRDNNTCYAKIICNKFDNERVVGFHLLGPNAGEITQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTLEITKSSGLDITQKGCUG 615          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Mouse
Match: Txnrd1 (thioredoxin reductase 1 [Source:MGI Symbol;Acc:MGI:1354175])

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 309/489 (63.19%), Postives = 375/489 (76.69%), Query Frame = 1
Query:  409 YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*G 1872
            Y++DL++IGGGSGGLAA+KEAA F  KV VLDFV PTP GT WGLGGTCVNVGCIPKKLMHQ+ALL  + +D+R+YGW V +TV+H W+ M E +Q+HI SLNWGYR +LR K V Y NAYG FI  H I  T+    E+I ++  F+IATGERPRY  IPGDKEY I+SDDLFSL YCPGKTLV+GASYVALECAGFLA +GL VTVMVRSI LRGFDQ MANKIG++MEEHG+ FI + VPTKI  +E G+PG+  V       +   +  FNTVL A+GRD CT  IGLE V + + +K G++ V +EEQ+ V  IYAIGDI+   L+LTPVAIQAG+ L++RL+GG ++  DY NVPTTVFTPLEYG  GL+EE A+ K+G+E+IEV+H  F PLEWTV  R +N CY K+ICN  D+ RVVGFHVL PNAGE+TQG+A A++ G TK+  D TIGIHP C+E FTTL++TK SG D  QSGC G
Sbjct:   11 YDFDLIIIGGGSGGLAAAKEAAKFDKKVLVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKVEDTVKHDWEKMTESVQSHIGSLNWGYRVALREKKVVYENAYGRFIGPHRIVATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLRVTAQSTNSEETIEGEFNTVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGGSNVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNNKCYAKIICNLKDDERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFTTLSVTKRSGGDILQSGCUG 499          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Mouse
Match: Txnrd1 (thioredoxin reductase 1 [Source:MGI Symbol;Acc:MGI:1354175])

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 309/489 (63.19%), Postives = 375/489 (76.69%), Query Frame = 1
Query:  409 YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*G 1872
            Y++DL++IGGGSGGLAA+KEAA F  KV VLDFV PTP GT WGLGGTCVNVGCIPKKLMHQ+ALL  + +D+R+YGW V +TV+H W+ M E +Q+HI SLNWGYR +LR K V Y NAYG FI  H I  T+    E+I ++  F+IATGERPRY  IPGDKEY I+SDDLFSL YCPGKTLV+GASYVALECAGFLA +GL VTVMVRSI LRGFDQ MANKIG++MEEHG+ FI + VPTKI  +E G+PG+  V       +   +  FNTVL A+GRD CT  IGLE V + + +K G++ V +EEQ+ V  IYAIGDI+   L+LTPVAIQAG+ L++RL+GG ++  DY NVPTTVFTPLEYG  GL+EE A+ K+G+E+IEV+H  F PLEWTV  R +N CY K+ICN  D+ RVVGFHVL PNAGE+TQG+A A++ G TK+  D TIGIHP C+E FTTL++TK SG D  QSGC G
Sbjct:   11 YDFDLIIIGGGSGGLAAAKEAAKFDKKVLVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKVEDTVKHDWEKMTESVQSHIGSLNWGYRVALREKKVVYENAYGRFIGPHRIVATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLRVTAQSTNSEETIEGEFNTVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGGSNVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNNKCYAKIICNLKDDERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFTTLSVTKRSGGDILQSGCUG 499          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Mouse
Match: Txnrd1 (thioredoxin reductase 1 [Source:MGI Symbol;Acc:MGI:1354175])

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 309/489 (63.19%), Postives = 375/489 (76.69%), Query Frame = 1
Query:  409 YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*G 1872
            Y++DL++IGGGSGGLAA+KEAA F  KV VLDFV PTP GT WGLGGTCVNVGCIPKKLMHQ+ALL  + +D+R+YGW V +TV+H W+ M E +Q+HI SLNWGYR +LR K V Y NAYG FI  H I  T+    E+I ++  F+IATGERPRY  IPGDKEY I+SDDLFSL YCPGKTLV+GASYVALECAGFLA +GL VTVMVRSI LRGFDQ MANKIG++MEEHG+ FI + VPTKI  +E G+PG+  V       +   +  FNTVL A+GRD CT  IGLE V + + +K G++ V +EEQ+ V  IYAIGDI+   L+LTPVAIQAG+ L++RL+GG ++  DY NVPTTVFTPLEYG  GL+EE A+ K+G+E+IEV+H  F PLEWTV  R +N CY K+ICN  D+ RVVGFHVL PNAGE+TQG+A A++ G TK+  D TIGIHP C+E FTTL++TK SG D  QSGC G
Sbjct:   11 YDFDLIIIGGGSGGLAAAKEAAKFDKKVLVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKVEDTVKHDWEKMTESVQSHIGSLNWGYRVALREKKVVYENAYGRFIGPHRIVATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLRVTAQSTNSEETIEGEFNTVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGGSNVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNNKCYAKIICNLKDDERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFTTLSVTKRSGGDILQSGCUG 499          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Mouse
Match: Txnrd1 (thioredoxin reductase 1 [Source:MGI Symbol;Acc:MGI:1354175])

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 313/508 (61.61%), Postives = 382/508 (75.20%), Query Frame = 1
Query:  373 EGRIQKLLDER-------QYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*G 1872
            +G++QKL            Y++DL++IGGGSGGLAA+KEAA F  KV VLDFV PTP GT WGLGGTCVNVGCIPKKLMHQ+ALL  + +D+R+YGW V +TV+H W+ M E +Q+HI SLNWGYR +LR K V Y NAYG FI  H I  T+    E+I ++  F+IATGERPRY  IPGDKEY I+SDDLFSL YCPGKTLV+GASYVALECAGFLA +GL VTVMVRSI LRGFDQ MANKIG++MEEHG+ FI + VPTKI  +E G+PG+  V       +   +  FNTVL A+GRD CT  IGLE V + + +K G++ V +EEQ+ V  IYAIGDI+   L+LTPVAIQAG+ L++RL+GG ++  DY NVPTTVFTPLEYG  GL+EE A+ K+G+E+IEV+H  F PLEWTV  R +N CY K+ICN  D+ RVVGFHVL PNAGE+TQG+A A++ G TK+  D TIGIHP C+E FTTL++TK SG D  QSGC G
Sbjct:  106 KGQLQKLPTMNGSKDPPGSYDFDLIIIGGGSGGLAAAKEAAKFDKKVLVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKVEDTVKHDWEKMTESVQSHIGSLNWGYRVALREKKVVYENAYGRFIGPHRIVATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLRVTAQSTNSEETIEGEFNTVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGGSNVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNNKCYAKIICNLKDDERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFTTLSVTKRSGGDILQSGCUG 613          
BLAST of Thioredoxin glutathione reductase vs. UniProt/SwissProt
Match: sp|Q86VQ6|TRXR3_HUMAN (Thioredoxin reductase 3 OS=Homo sapiens OX=9606 GN=TXNRD3 PE=1 SV=4)

HSP 1 Score: 685.256 bits (1767), Expect = 0.000e+0
Identity = 340/599 (56.76%), Postives = 434/599 (72.45%), Query Frame = 1
Query:   94 PPISTALEEWIRK----IINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDER-QYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*G 1872
            P  S+   E +R+    +I  S ++IFSK+ CP   ++K+      ++   +E++ +  G+ +Q++L  ITNQ+TVPN+FV   H+GGCD   +A   G +QKLL E   Y+YDL++IGGGSGGL+ +KEAA  G KV VLDFV P+PQGT+WGLGGTCVNVGCIPKKLMHQ+ALL  +  D+R +GW   + V H+W+ M + IQNHI SLNWGYR SLR K V Y+N+YG F++ H IK T+K   E   T+  F+IATGERPRY  I GDKEY ITSDDLFSL YCPGKTLV+GASYVALECAGFLA  GL VTVMVRSI LRGFDQ+MA K+G YME+HGV F+ + +P  +  +E+GSPGK +V     +     +  +NTVL AIGRD CT +IGLE + + + +K+G++ VN+ EQ+ V  +YA+GDI+    +LTPVAIQ+GK L++RLFG      DY+NVPTTVFTPLEYG  GL+EE AI  Y KE++E++H  F PLEWTVA R +N CY K+ICNK D+ RV+GFH+L PNAGE+TQG+A AM+ G TK+  DDTIGIHPTC E FTTL ITK+SG D  Q GC G
Sbjct:   45 PSRSSEAREELRRHLVGLIERSRVVIFSKSYCPHSTRVKELFSSLGVECNVLELDQVDDGARVQEVLSEITNQKTVPNIFVNKVHVGGCDQTFQAYQSGLLQKLLQEDLAYDYDLIIIGGGSGGLSCAKEAAILGKKVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGQALCDSRKFGWEYNQQVRHNWETMTKAIQNHISSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQFVIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGFGLDVTVMVRSILLRGFDQEMAEKVGSYMEQHGVKFLRKFIPVMVQQLEKGSPGKLKVLAKSTEGTETIEGVYNTVLLAIGRDSCTRKIGLEKIGVKINEKSGKIPVNDVEQTNVPYVYAVGDILEDKPELTPVAIQSGKLLAQRLFGASLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEVYKKENLEIYHTLFWPLEWTVAGRENNTCYAKIICNKFDHDRVIGFHILGPNAGEVTQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTLEITKSSGLDITQKGCUG 643          
BLAST of Thioredoxin glutathione reductase vs. UniProt/SwissProt
Match: sp|Q99MD6|TRXR3_MOUSE (Thioredoxin reductase 3 OS=Mus musculus OX=10090 GN=Txnrd3 PE=1 SV=3)

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 340/582 (58.42%), Postives = 430/582 (73.88%), Query Frame = 1
Query:  133 IINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLL-DERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*G 1872
            +I  + ++IFSK+ CP   ++K+      + Y  +E++ +  G+ +Q++L  I+NQ+TVPN+FV   H+GGCD   +A   G +QKLL D+  ++YDL++IGGGSGGL+ +KEAAN G KV VLDFV P+PQGTTWGLGGTCVNVGCIPKKLMHQ+ALL H+ +DA+ YGW   + V+H+W+ M E IQ+HI SLNWGYR +LR KGV Y+N++G F+D H IK T+K   E   T++ F+IATGERPRY  I GDKEY ITSDDLFSL YCPG TLV+GASYV LECAGFLA LGL VTVMVRS+ LRGFDQ+MA K+G Y+E+ GV F  +  P  +  +E+G PGK +V     +     +  +NTVL AIGRD CT +IGLE + + + +KNG++ VN+ EQ+ V ++YAIGDI+    +LTPVAIQAGK L+RRLFG      DY+N+PTTVFTPLEYG  GL+EE AI  Y KE++EV+H  F PLEWTVA R +N CY K+ICNK DN RVVGFH+L PNAGEITQG+A AM+ G TK+  DDTIGIHPTC E FTTL ITK+SG D  Q GC G
Sbjct:   71 LIEGNRVMIFSKSYCPHSTRVKELFSSLGVVYNILELDQVDDGASVQEVLTEISNQKTVPNIFVNKVHVGGCDRTFQAHQNGLLQKLLQDDSAHDYDLIIIGGGSGGLSCAKEAANLGKKVMVLDFVVPSPQGTTWGLGGTCVNVGCIPKKLMHQAALLGHALQDAKKYGWEYNQQVKHNWEAMTEAIQSHIGSLNWGYRVTLREKGVTYVNSFGEFVDLHKIKATNKKGQETFYTASKFVIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGCTLVVGASYVGLECAGFLAGLGLDVTVMVRSVLLRGFDQEMAEKVGSYLEQQGVKFQRKFTPILVQQLEKGLPGKLKVVAKSTEGPETVEGIYNTVLLAIGRDSCTRKIGLEKIGVKINEKNGKIPVNDVEQTNVPHVYAIGDILDGKPELTPVAIQAGKLLARRLFGVSLEKCDYINIPTTVFTPLEYGCCGLSEEKAIEMYKKENLEVYHTLFWPLEWTVAGRDNNTCYAKIICNKFDNERVVGFHLLGPNAGEITQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTLEITKSSGLDITQKGCUG 652          
BLAST of Thioredoxin glutathione reductase vs. UniProt/SwissProt
Match: sp|Q16881|TRXR1_HUMAN (Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1 PE=1 SV=3)

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 338/591 (57.19%), Postives = 428/591 (72.42%), Query Frame = 1
Query:  124 IRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLD-------ERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*G 1872
            ++  I+   ++IFS++TC  C ++KK  K   + Y  +E++    G  ++  L  +  +  +P VFV+   IGG     KA  EGR+QKLL         + Y+YDL++IGGGSGGLAA+KEAA +G KV VLDFV PTP GT WGLGGTCVNVGCIPKKLMHQ+ALL  + +D+R+YGW V ETV+H WD M+E +QNHI SLNWGYR +LR K V Y NAYG FI  H IK T+    E+I ++  F+IATGERPRY  IPGDKEY I+SDDLFSL YCPGKTLV+GASYVALECAGFLA +GL VTVMVRSI LRGFDQ MANKIG++MEEHG+ FI + VP K+  +E G+PG+  V       +   +  +NTV+ AIGRD CT +IGLE V + + +K G++ V +EEQ+ V  IYAIGDI+   ++LTPVAIQAG+ L++RL+ G  +  DY NVPTTVFTPLEYG+ GL+EE A+ K+G+E+IEV+H  F PLEWT+  R +N CY K+ICN  DN RVVGFHVL PNAGE+TQG+A A++ G TK+  D TIGIHP C+E FTTL++TK SGA   Q+GC G
Sbjct:   59 LQAYIDGHSVVIFSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG 649          
BLAST of Thioredoxin glutathione reductase vs. UniProt/SwissProt
Match: sp|Q5NVA2|TRXR1_PONAB (Thioredoxin reductase 1, cytoplasmic OS=Pongo abelii OX=9601 GN=TXNRD1 PE=2 SV=3)

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 308/489 (62.99%), Postives = 377/489 (77.10%), Query Frame = 1
Query:  409 YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*G 1872
            Y+YDL++IGGGSGGLAA+KEAA +G KV VLDFV PTP GT WGLGGTCVNVGCIPKKLMHQ+ALL  + +D+R+YGW V ETV+H WD M+E +QNHI SLNWGYR +LR K V Y NAYG FI  H IK T+    E+I ++  F+IATGERPRY  IPGDKEY I+SDDLFSL YCPGKTL++GASYVALECAGFLA +GL VTVMVRSI LRGFDQ MANKIG++MEEHG+ FI + VP K+  +E G+PG+  V       +   +  +NTVL AIGRD CT +IGLE V + + +K G++ V +EEQ+ V  IYAIGDI+   ++LTPVAIQAG+ L++RL+ G  +  DY NVPTTVFTPLEYG+ GL+EE A+ K+G+E+IEV+H  F PLEWT+  R +N CY K+ICN  DN RVVGFHVL PNAGE+TQG+A A++ G TK+  D TIGIHP C+E FTTL++TK SGA   Q+GC G
Sbjct:   11 YDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLIVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVLLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG 499          
BLAST of Thioredoxin glutathione reductase vs. UniProt/SwissProt
Match: sp|O62768|TRXR1_BOVIN (Thioredoxin reductase 1, cytoplasmic OS=Bos taurus OX=9913 GN=TXNRD1 PE=2 SV=3)

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 308/489 (62.99%), Postives = 375/489 (76.69%), Query Frame = 1
Query:  409 YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDL-DKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*G 1872
            Y+YDL++IGGGSGGLAA+KEAA +  KV VLDFV PTP GT WGLGGTCVNVGCIPKKLMHQ+ALL  +  D+R+YGWNV ETV+H W+ M E +QNHI SLNWGYR +LR K V Y NAYG F+  H IK T+    E+I ++  F+IATGERPRY  IPGDKEY I+SDDLFSL YCPGKTLV+GASYVALECAGFLA +GL VTVMVRSI LRGFDQ MANKIG++M+EHG+ FI + VP K+  +E G+PG+  V           +  +NTVL AIGRD CT +IGLENV + + +K G++ V EEEQ+ V  IYAIGDI+   L+LTPVAIQAG+ L++RL+GG  +  DY NVPTTVFTPLEYGS GL+EE A+ K+G+E++EV+H  F PLEWT+  R +N CY K++CN  DN RVVGFHVL PNAGE+TQG+A A++ G TK   D TIGIHP C+E FTTL++TK SG +  Q+GC G
Sbjct:   11 YDYDLIIIGGGSGGLAAAKEAAKYDKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALRDSRNYGWNVEETVKHDWERMTEAVQNHIGSLNWGYRVALREKKVTYENAYGEFVGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMQEHGIKFIRQFVPIKVEQIEAGTPGRLRVIAKSTDSDQTIEGEYNTVLLAIGRDACTRKIGLENVGVKINEKTGKIPVTEEEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGGSTVKCDYENVPTTVFTPLEYGSCGLSEEKAVEKFGEENVEVYHSYFWPLEWTIPSRDNNKCYAKVVCNIKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKDQLDSTIGIHPVCAEVFTTLSVTKRSGGNILQTGCUG 499          
BLAST of Thioredoxin glutathione reductase vs. TrEMBL
Match: A0A068AVN2 (Thioredoxin glutathione reductase OS=Dugesia japonica OX=6161 GN=TGR PE=2 SV=1)

HSP 1 Score: 1023.85 bits (2646), Expect = 0.000e+0
Identity = 481/592 (81.25%), Postives = 539/592 (91.05%), Query Frame = 1
Query:   91 MPPISTALEEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            MPP+S+ L+ W+ + I SSV+IIFSKTTCPFC KIKK+LK+A IK+AAVE+NLL+   EIQDIL+ +TNQ+TVPNVFVRGTHIGGCD+AH AL+EG+IQ ++D+R+Y+YDLVVIGGGSGGLAASKEA+NFGAKVAVLDFV+PTP GTTWGLGGTCVNVGCIPKKLMHQSALLK +CEDA+SYGWN+PE +EH+W+NMV EIQNHIQSLNWGYR SLRNK VDYINAY  FIDEHTIK TDKYN+ R ITS+ F+IATGERP+YP+IPGDKEY ITSDDLFSL Y PGKTLV+GASYVALECAGF+A+LG KVTVMVRSIFLRGFDQQMANK+ +YM+ HG++FI ECVPTKIIPMEEGSPGKKEVFG Y+K+  EYKDWFNTVLFAIGRDPCT  IGL N+ +DLDKNGRV V  EEQ+ V N+YAIGDIIS GLQLTPVAIQAGKNL+RRL+GGE +LTDYVNVPTTVFTPLEYG IG  EEDAI K+G E+IEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRV+G HVL PNAGEITQGYA+AMRMGATKRDFDDTIGIHPTCSETFTTLNIT++SGADPAQSGC
Sbjct:    1 MPPVSSELKLWVEQTIKSSVMIIFSKTTCPFCRKIKKTLKEAKIKFAAVELNLLSNRQEIQDILFQLTNQKTVPNVFVRGTHIGGCDNAHAALSEGKIQNIIDQRKYDYDLVVIGGGSGGLAASKEASNFGAKVAVLDFVQPTPMGTTWGLGGTCVNVGCIPKKLMHQSALLKCACEDAKSYGWNIPEKLEHNWENMVTEIQNHIQSLNWGYRVSLRNKNVDYINAYAEFIDEHTIKATDKYNSTREITSDKFLIATGERPKYPDIPGDKEYCITSDDLFSLQYFPGKTLVVGASYVALECAGFIAALGGKVTVMVRSIFLRGFDQQMANKVAEYMKTHGIEFINECVPTKIIPMEEGSPGKKEVFGSYVKNNNEYKDWFNTVLFAIGRDPCTSNIGLGNINLDLDKNGRVKVTNEEQTNVENVYAIGDIISGGLQLTPVAIQAGKNLARRLYGGERVLTDYVNVPTTVFTPLEYGCIGWPEEDAISKFGAENIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVIGLHVLGPNAGEITQGYAVAMRMGATKRDFDDTIGIHPTCSETFTTLNITRSSGADPAQSGC 592          
BLAST of Thioredoxin glutathione reductase vs. TrEMBL
Match: A0A210PSR9 (Thioredoxin reductase 3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11132 PE=3 SV=1)

HSP 1 Score: 787.719 bits (2033), Expect = 0.000e+0
Identity = 379/594 (63.80%), Postives = 464/594 (78.11%), Query Frame = 1
Query:   91 MPPISTA-LEEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLL-DERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            MPP+    L+  +   +  + ++IFSKTTCPFC+K+K+  K  + +Y   E++ +A GS+IQ+ L  +T Q+TVPNVF+ G H+GGCDD  KA   G +Q +L D   Y+YDL+VIGGGSGGLAASKEAA+ G KVAV DFV+PTP GTTWGLGGTCVNVGCIPKKLMHQ+A+L HS EDA+ +GW VPE V+H+WD M   IQ+HI SLNWGYR  LR+K VDY NAY  FID+HT+K  +K   E   T+ +FI+A GERPRYP+IPG KEYGITSDDLFSL YCPGKTL+IGASYV+LEC GFL  +GL VTVMVRSI LRGFDQQMA+KIG+YME  G++FI +CVPTKI  +E+G PGK +V+G Y  D TEY D FNTV+FAIGRDP T  IGL+ V + L+K+G+V+ NE E + VSNIYAIGDI+   L+LTPVAIQAGK L+RRL+    +LTDYVNV TTVFTPLEYG+IG +EE AI K+G++++EV+H N+ PLEWTVA R +N CY K+IC+  D  RVVGFH+  PNAGEITQGYA+ M++GATK+DFDDTIGIHPTCSE FTTLN+TK SG    QSGC
Sbjct:    1 MPPVGAGGLKAEVMDQVAKNKVMIFSKTTCPFCFKVKEMFKSIDQEYGVTELDKIANGSDIQNTLLEVTGQKTVPNVFINGKHLGGCDDTLKAHKNGSLQAMLQDATNYDYDLIVIGGGSGGLAASKEAASLGKKVAVFDFVQPTPVGTTWGLGGTCVNVGCIPKKLMHQAAILGHSLEDAKHFGWKVPEDVQHNWDTMKNAIQDHIGSLNWGYRVQLRDKKVDYQNAYAEFIDDHTVKAVNKKGKEVTKTARDFIVAVGERPRYPDIPGAKEYGITSDDLFSLPYCPGKTLLIGASYVSLECGGFLHGIGLNVTVMVRSILLRGFDQQMADKIGEYMEAKGINFIRQCVPTKIEKLEDGQPGKYKVYGKY-SDGTEYSDTFNTVIFAIGRDPVTKTIGLDKVGVKLNKSGKVVANESEATNVSNIYAIGDILEGKLELTPVAIQAGKLLARRLYDNSKVLTDYVNVATTVFTPLEYGAIGYSEEAAIEKFGEDNVEVYHTNYWPLEWTVAKREENVCYAKIICHIPDKERVVGFHICGPNAGEITQGYALGMKLGATKKDFDDTIGIHPTCSEQFTTLNVTKRSGKMVNQSGC 593          
BLAST of Thioredoxin glutathione reductase vs. TrEMBL
Match: A0A0P4VXF7 (Glutaredoxin domain-containing protein OS=Scylla olivacea OX=85551 PE=3 SV=1)

HSP 1 Score: 749.969 bits (1935), Expect = 0.000e+0
Identity = 363/597 (60.80%), Postives = 461/597 (77.22%), Query Frame = 1
Query:   91 MPPISTA---LEEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDE--RQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            M PI+TA     + + K I  + ++IFSK+ CPFC+K+K   K  N+ Y  +E++++  GSEIQ  L   + QRTVPNV++ G H+GG DD     A G + KL+++    Y+YDLVVIGGGSGGLAASKEAAN GAKVAV DFV+PTP+GTTWGLGGTCVNVGCIPKKLMHQ+A+L+   +D+R YGW  PE + H W+ MVE IQNHI SLNWGYR +LR+K VDY+NAY  F+D+HT+KT D+   E+ ITS+  ++ATG RPRYP+IPG KE+ ITSDD+FSLSY PGKTL++GASY++LECAGFLA LG  VTVMVRSI LRGFDQQMA +IG YME+HGV FI   VPT I  +EEGSPG  +V     + + E    +NTV+ AIGRDPCT  IGL+ + I++ K+G+V+V+E EQ++V +IYA+GDII  G +LTPVAIQAG+ L+RRL+G   +LTDY  VPTTVFTPLEYG  GL+EE AI ++G+E+IEVFH N++PLE+TVAHR +NDCY KL+C K++N RV+GFHVL PNAGEITQG+AI +++ ATK DFD+ IGIHPT +E FTTL++TK+SG D A  GC
Sbjct:   78 MAPINTAGLQPAQVVEKCIAENKVMIFSKSFCPFCHKVKDLFKSLNVPYEVLELDIVENGSEIQGALLEKSGQRTVPNVYISGEHVGGADDTFATHARGDLMKLVNKGAHSYDYDLVVIGGGSGGLAASKEAANLGAKVAVCDFVQPTPRGTTWGLGGTCVNVGCIPKKLMHQAAILQEGLKDSREYGWETPEGITHDWNKMVEAIQNHIGSLNWGYRVALRDKKVDYLNAYATFVDDHTLKTVDRRGKEKTITSDKILLATGGRPRYPDIPGAKEHCITSDDIFSLSYAPGKTLLVGASYISLECAGFLAGLGYDVTVMVRSILLRGFDQQMAERIGTYMEKHGVKFIRGAVPTAIEQVEEGSPGLLKVTAQSTEGE-EVVGEYNTVVVAIGRDPCTASIGLDKLDINMAKSGKVVVDEREQTSVPHIYAVGDIIEGGHELTPVAIQAGRLLARRLYGNGTLLTDYDKVPTTVFTPLEYGCCGLSEEVAIERHGEENIEVFHSNYQPLEFTVAHRPENDCYAKLVCLKTENNRVLGFHVLGPNAGEITQGFAIGLKLNATKADFDNLIGIHPTTAEIFTTLSVTKSSGQDVAAQGC 673          
BLAST of Thioredoxin glutathione reductase vs. TrEMBL
Match: A0A2P2HXB3 (Thioredoxin reductase 1, cytoplasmic-like OS=Hirondellea gigas OX=1518452 PE=2 SV=1)

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 361/596 (60.57%), Postives = 448/596 (75.17%), Query Frame = 1
Query:   91 MPPISTAL--EEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDER--QYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            MPP+ T L   E + + I  + +++FSK+TCPFC+K+K   K+ NI +  +E++ ++ G+ +Q+ L   T Q TVPN ++ GTH+GG  D  +  ++G + KLL  R   YEYD+V+IGGGSGGLAASKEAA  GAKVAV+DFVKPTP GTTWGLGGTCVNVGCIPKKLMHQ+A+L H  ED+ ++GW  PE + H W  +VE +Q+HI SLNWGYR  LR+K VDYINAY  F D HT++T D+   ER IT++  ++A G RPRYP+IPG KEY ITSDD+FSL + PGKTL++GASY+ALECAGFLA+LG  VTVMVRSIFLRGFDQQMANKI +YME+ GV FI   VPTK+  +E GSPG   V              +NTV+ AIGRDPCT  IG+EN   +L KNG++IV++ E+S V +IY IGD+I  GL+LTPVAIQAGK LS+R+F       DY NVPTTVFTPLEYG  GL+EE AI KYG++ +E++H NF PLE+TVAHR +NDCY KLIC KS N  VVGFH+L PNAGEITQGYAIA++M ATK +FDD +GIHPTC+ET TT+NITK SGADPA SGC
Sbjct:   67 MPPLPTDLPAAELVEQYIKQNKIVVFSKSTCPFCHKVKGLFKELNIAFTVLELDQISNGAAVQEALQAKTGQTTVPNTWINGTHVGGATDTLELHSKGELMKLLRTRTHSYEYDMVIIGGGSGGLAASKEAAKLGAKVAVVDFVKPTPSGTTWGLGGTCVNVGCIPKKLMHQAAVLSHCLEDSVAFGWKTPEKISHDWAALVEGVQSHIGSLNWGYRVQLRDKKVDYINAYAKFTDPHTLQTVDRRGKERTITADQIVLAAGGRPRYPDIPGAKEYCITSDDIFSLPHAPGKTLLVGASYIALECAGFLANLGYDVTVMVRSIFLRGFDQQMANKIAEYMEKQGVKFIRGAVPTKVEQIEAGSPGTLRVTAAPTDGGEAITGEYNTVVVAIGRDPCTSDIGIENTGAELAKNGKLIVDDVERSNVPHIYGIGDMIEGGLELTPVAIQAGKLLSKRIFADATKKMDYRNVPTTVFTPLEYGCCGLSEEAAIAKYGEDDLEIYHTNFWPLEFTVAHRPENDCYAKLICVKSQNELVVGFHILGPNAGEITQGYAIALQMKATKENFDDLVGIHPTCAETLTTMNITKKSGADPAASGC 662          
BLAST of Thioredoxin glutathione reductase vs. TrEMBL
Match: A0A5C6N1Z1 (Thioredoxin reductase 3 OS=Takifugu flavidus OX=433684 GN=D4764_04G0001490 PE=3 SV=1)

HSP 1 Score: 748.429 bits (1931), Expect = 0.000e+0
Identity = 359/600 (59.83%), Postives = 455/600 (75.83%), Query Frame = 1
Query:   91 MPPISTA-----LEEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLD--ERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLD-KNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            MPPI        L+  I+++I+S+ +++FSK+ CP+C K+K   K+  ++   VE++L+  G+  Q++L  +T Q+TVPNVF+  TH+GGCD   +A  +G +Q+LL+     Y+YDL+VIGGGSGGLA SKEAA  G KV VLD+V PTP+GT+WGLGGTCVNVGCIPKKLMHQ+ALL+ + +DAR +GW   ETV+H+W+ M E I N+I SLNWGYR +LR+K VDY+NAY  FID H IKTT+K   E   T+  F++ATGERPRY NIPGDKE+ ITSDDLFSL YCPGKTLVIGASYVALEC GFLA LGL VTVMVRSI LRGFDQ MAN+ G+YMEEHGV F+ E VPTKI  +E G+PG+ +V       +   +  +NTVL A+GRD CTD+IGL+ V + ++ KNG++ VN+EEQ+ V +IYAIGDI+    +LTPVAIQAGK L+RRL+GG     DYVNVPTTVFTP+EYG+ GL+EE A+G YG+E+IEVFH  F PLE+TV  R +N CY K+ICNK DN RV+GFH L PNAGE+TQG++ AM+ GATK   D TIGIHPTC+E FTT+ +TK+SG +  QSGC
Sbjct:    1 MPPIENESGKNDLKSRIQQLIDSNQVMVFSKSYCPYCVKVKDLFKELQVECNVVELDLIEDGTNYQEMLLEMTGQKTVPNVFINKTHVGGCDKTLQAHKDGSLQQLLNGQNESYDYDLIVIGGGSGGLACSKEAALLGKKVMVLDYVVPTPKGTSWGLGGTCVNVGCIPKKLMHQTALLRTAIQDARKFGWEFDETVKHNWETMKEAINNYIGSLNWGYRVALRDKMVDYVNAYAEFIDPHKIKTTNKRGKETFYTAARFVLATGERPRYLNIPGDKEHCITSDDLFSLPYCPGKTLVIGASYVALECGGFLAGLGLDVTVMVRSILLRGFDQDMANRAGEYMEEHGVKFLREYVPTKIEELEAGTPGRLKVTAKSTGSEEVIEGEYNTVLIAVGRDACTDKIGLDKVGVKVNPKNGKIPVNDEEQTNVPHIYAIGDILQDKWELTPVAIQAGKLLARRLYGGSKAKCDYVNVPTTVFTPMEYGACGLSEERAVGLYGQENIEVFHTLFWPLEFTVPSRDNNKCYAKIICNKLDNDRVIGFHYLGPNAGEVTQGFSTAMKCGATKEQLDGTIGIHPTCAEIFTTMEVTKSSGGNINQSGC 600          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Cavefish
Match: txnrd3 (thioredoxin reductase 1, cytoplasmic [Source:NCBI gene;Acc:103047502])

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 339/600 (56.50%), Postives = 446/600 (74.33%), Query Frame = 1
Query:   91 MPPIST-----ALEEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDERQ--YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLD-KNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            MPP+        ++  I+++I+++ +++FSK+ CP+C K+K+   D N++   +E++L+  GS  QD+L  +T Q+TVPNVFV  TH+GGCD+  KA  +G +Q+LL ++   Y+YDL+VIGGGSGGLA SKEAAN G KV VLD+V PTP+GTTWGLGGTCVNVGCIPKKLMHQ+AL+  + +DAR +GW   E V H+W+ M   + N+I SLNWGYR SLR+K V+Y+N+Y  F++ H IK T++   E   T+  F++ATGERPRY  IPGDKEY ITSDDLFSL YCPGKTLVIGASYVALEC GFLA LGL VT+MVRSI LRGFDQ MAN+ G +ME HGV F+ + VP K+  +E G+PG+ +V     +    ++  +NTVL A+GRD CT++IGL+   + ++ KNG++ VN+EEQ+ + +IYAIGDI+    +LTPVAIQAGK L+RRL+ G  +  DYVNVPTTVFTPLEYGS G  EE A+  YG+E++EV+H  F PLE+TV +R +N CY K+ICNK D+ RV+GFH L PNAGE+TQG+  AM+ G TK   D+TIGIHPTC+E FTT+ +TK SG D  Q+GC
Sbjct:    1 MPPVEIDAGRDQIKARIQELIDTNSVVVFSKSYCPYCTKVKELFNDLNVECNIIELDLMENGSNFQDLLMEMTGQKTVPNVFVNKTHVGGCDNTIKAHKDGLLQQLLGDKSEVYDYDLIVIGGGSGGLACSKEAANLGKKVMVLDYVVPTPKGTTWGLGGTCVNVGCIPKKLMHQTALMGTALQDARKFGWEFSEQVSHNWETMKTAVNNYIGSLNWGYRVSLRDKNVNYVNSYAEFVEPHKIKATNRRGKETFHTAAKFVLATGERPRYLGIPGDKEYCITSDDLFSLPYCPGKTLVIGASYVALECGGFLAGLGLDVTIMVRSILLRGFDQDMANRAGDHMETHGVKFLRKFVPVKVEELEAGTPGRLKVTAKSTETDEIFEGEYNTVLIAVGRDACTEKIGLDQAGVKVNPKNGKIPVNDEEQTNIPHIYAIGDILEGKWELTPVAIQAGKLLARRLYAGASLKCDYVNVPTTVFTPLEYGSCGHPEERAVELYGQENLEVYHSLFWPLEYTVPNRDNNRCYAKIICNKLDDNRVIGFHYLGPNAGEVTQGFGAAMKCGVTKEQLDNTIGIHPTCAEIFTTMEVTKRSGGDITQAGC 600          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Cavefish
Match: txnrd3 (thioredoxin reductase 1, cytoplasmic [Source:NCBI gene;Acc:103047502])

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 295/489 (60.33%), Postives = 372/489 (76.07%), Query Frame = 1
Query:  385 QKLLDERQ--YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLD-KNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASG 1842
            Q+LL ++   Y+YDL+VIGGGSGGLA SKEAAN G KV VLD+V PTP+GTTWGLGGTCVNVGCIPKKLMHQ+AL+  + +DAR +GW   E V H+W+ M   + N+I SLNWGYR SLR+K V+Y+N+Y  F++ H IK T++   E   T+  F++ATGERPRY  IPGDKEY ITSDDLFSL YCPGKTLVIGASYVALEC GFLA LGL VT+MVRSI LRGFDQ MAN+ G +ME HGV F+ + VP K+  +E G+PG+ +V     +    ++  +NTVL A+GRD CT++IGL+   + ++ KNG++ VN+EEQ+ + +IYAIGDI+    +LTPVAIQAGK L+RRL+ G  +  DYVNVPTTVFTPLEYGS G  EE A+  YG+E++EV+H  F PLE+TV +R +N CY K+ICNK D+ RV+GFH L PNAGE+TQG+  AM+ G TK   D+TIGIHPTC+E FTT+ +TK SG
Sbjct:    1 QQLLGDKSEVYDYDLIVIGGGSGGLACSKEAANLGKKVMVLDYVVPTPKGTTWGLGGTCVNVGCIPKKLMHQTALMGTALQDARKFGWEFSEQVSHNWETMKTAVNNYIGSLNWGYRVSLRDKNVNYVNSYAEFVEPHKIKATNRRGKETFHTAAKFVLATGERPRYLGIPGDKEYCITSDDLFSLPYCPGKTLVIGASYVALECGGFLAGLGLDVTIMVRSILLRGFDQDMANRAGDHMETHGVKFLRKFVPVKVEELEAGTPGRLKVTAKSTETDEIFEGEYNTVLIAVGRDACTEKIGLDQAGVKVNPKNGKIPVNDEEQTNIPHIYAIGDILEGKWELTPVAIQAGKLLARRLYAGASLKCDYVNVPTTVFTPLEYGSCGHPEERAVELYGQENLEVYHSLFWPLEYTVPNRDNNRCYAKIICNKLDDNRVIGFHYLGPNAGEVTQGFGAAMKCGVTKEQLDNTIGIHPTCAEIFTTMEVTKRSG 489          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Cavefish
Match: ENSAMXT00000055472.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002185.1:27093:32744:-1 gene:ENSAMXG00000036332.1 transcript:ENSAMXT00000055472.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 284/497 (57.14%), Postives = 360/497 (72.43%), Query Frame = 1
Query:  385 QKLLDERQ--YEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLD-KNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            Q+LL ++   Y+YDL+VIGGGSGGLA SK       KV VLD+V PTP+GTTWGLGGTCVNVGCIPKKLMHQ+AL+  + +DAR +GW   E V H+W+ M   + N+I SLNWGYR SLR+K V+Y+N+Y  F++ H IK T++   E   T+  F++ATGERPRY  IPGDKEY ITSDDLFSL YCPGKTLVIGASYVALEC GFLA LGL VT+MVRSI LRGFDQ MAN+ G +ME HGV F+ +   +       G+PG+ +V     +    ++  +NTVL A+GRD CT++IGL+   + ++ KNG++ VN+EEQ+ + +IYAIGDI+    +LTPVAIQAGK L+RRL+ G  +  DYVNVPTTVFTPLEY             YG+E++EV+H  F PLE+TV +R +N CY K+ICNK D+ RV+GFH L PNAGE+TQG+  AM+ G TK   D+TIGIHPTC+E FTT+ +TK SG D  Q+GC
Sbjct:    1 QQLLGDKSEVYDYDLIVIGGGSGGLACSK-------KVMVLDYVVPTPKGTTWGLGGTCVNVGCIPKKLMHQTALMGTALQDARKFGWEFSEQVSHNWETMKTAVNNYIGSLNWGYRVSLRDKNVNYVNSYAEFVEPHKIKATNRRGKETFHTAAKFVLATGERPRYLGIPGDKEYCITSDDLFSLPYCPGKTLVIGASYVALECGGFLAGLGLDVTIMVRSILLRGFDQDMANRAGDHMETHGVKFLRKFCSS-------GTPGRLKVTAKSTETDEIFEGEYNTVLIAVGRDACTEKIGLDQAGVKVNPKNGKIPVNDEEQTNIPHIYAIGDILEGKWELTPVAIQAGKLLARRLYAGASLKCDYVNVPTTVFTPLEYEL-----------YGQENLEVYHSLFWPLEYTVPNRDNNRCYAKIICNKLDDNRVIGFHYLGPNAGEVTQGFGAAMKCGVTKEQLDNTIGIHPTCAEIFTTMEVTKRSGGDITQAGC 472          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Cavefish
Match: txnrd2.2 (thioredoxin reductase 2 [Source:NCBI gene;Acc:103037574])

HSP 1 Score: 446.432 bits (1147), Expect = 5.375e-151
Identity = 211/429 (49.18%), Postives = 296/429 (69.00%), Query Frame = 1
Query:  586 MHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYP-NIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGR-VIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            MHQ+ALL  + +DA+ YGW +P+ V H W  + E +QN+++SLNWG+R  L+++ V Y+N  G+ +D+HT++       E  +T+ N +IATG RP+YP ++PG  E+GI+SDDLF L   PGKTLV+GASYV LECAGFL  +GL+ TVMVRSI LRGFDQQM+  +  YM+ +G  F  +CVP K+   E+   G  +V     +   +++D FN+VL+A+GR P T  + L+ V ++LD + R V+V ++E+++V NIYAIGDI     +LTP AI AGK L+RRL G    L DY NVPTTVFTPLEYG +GL+EE+A  +YGK+ +EV+H  +KPLE+TVA R    CY K++C +  + +VVG H   PNAGE+TQG+A+++R G +     D++GIHPTC+E  T + ITK SG D   +GC
Sbjct:    1 MHQAALLGSAVKDAQKYGWQIPQPVSHDWATLAESVQNYVKSLNWGHRVQLQDRKVKYMNMKGSLVDDHTVRCLSSRGKEMTVTARNILIATGGRPKYPTHVPGALEFGISSDDLFWLKETPGKTLVVGASYVGLECAGFLTGIGLEATVMVRSIALRGFDQQMSRLVTDYMQGYGTRFCWDCVPKKV---EKLPSGLLQVTWTDSRTGQDHQDTFNSVLWAVGRAPETGTLNLQQVGVELDGDTRKVMVADDERTSVPNIYAIGDIAQGRPELTPTAIHAGKLLARRLAGLSSQLMDYSNVPTTVFTPLEYGCVGLSEEEAERRYGKDKVEVYHAFYKPLEFTVAERELRQCYIKVVCERDGDQKVVGLHFTGPNAGEVTQGFALSLRCGLSYAQLRDSVGIHPTCAEELTKIYITKRSGLDATVTGC 426          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Cavefish
Match: txnrd2.2 (thioredoxin reductase 2 [Source:NCBI gene;Acc:103037574])

HSP 1 Score: 446.432 bits (1147), Expect = 5.375e-151
Identity = 211/429 (49.18%), Postives = 296/429 (69.00%), Query Frame = 1
Query:  586 MHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYP-NIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGR-VIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            MHQ+ALL  + +DA+ YGW +P+ V H W  + E +QN+++SLNWG+R  L+++ V Y+N  G+ +D+HT++       E  +T+ N +IATG RP+YP ++PG  E+GI+SDDLF L   PGKTLV+GASYV LECAGFL  +GL+ TVMVRSI LRGFDQQM+  +  YM+ +G  F  +CVP K+   E+   G  +V     +   +++D FN+VL+A+GR P T  + L+ V ++LD + R V+V ++E+++V NIYAIGDI     +LTP AI AGK L+RRL G    L DY NVPTTVFTPLEYG +GL+EE+A  +YGK+ +EV+H  +KPLE+TVA R    CY K++C +  + +VVG H   PNAGE+TQG+A+++R G +     D++GIHPTC+E  T + ITK SG D   +GC
Sbjct:    1 MHQAALLGSAVKDAQKYGWQIPQPVSHDWATLAESVQNYVKSLNWGHRVQLQDRKVKYMNMKGSLVDDHTVRCLSSRGKEMTVTARNILIATGGRPKYPTHVPGALEFGISSDDLFWLKETPGKTLVVGASYVGLECAGFLTGIGLEATVMVRSIALRGFDQQMSRLVTDYMQGYGTRFCWDCVPKKV---EKLPSGLLQVTWTDSRTGQDHQDTFNSVLWAVGRAPETGTLNLQQVGVELDGDTRKVMVADDERTSVPNIYAIGDIAQGRPELTPTAIHAGKLLARRLAGLSSQLMDYSNVPTTVFTPLEYGCVGLSEEEAERRYGKDKVEVYHAFYKPLEFTVAERELRQCYIKVVCERDGDQKVVGLHFTGPNAGEVTQGFALSLRCGLSYAQLRDSVGIHPTCAEELTKIYITKRSGLDATVTGC 426          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Sea Lamprey
Match: txnrd3 (thioredoxin reductase 3 [Source:ZFIN;Acc:ZDB-GENE-030327-3])

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 345/606 (56.93%), Postives = 424/606 (69.97%), Query Frame = 1
Query:   91 MPPISTALEEW---IRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLD-----------------ERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLD-KNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGA 1845
            MPP   A E     ++ ++    +++FSK+ CPFC K+K    +  + Y A+E++L+  G  IQ++L  +T Q+TVPNVFV  TH+GGCD   +A   GR+Q+LL                     YEYDL+VIGGGSGGLAASKEAA  G KV VLDFV+PTP GT+WGLGGTCVNVGCIPKKLMHQ+ALL H+  D+R +GW   + V H+W  M E IQN+I SLNWGYR +LR+  V Y+NA+G F D H IK T+K   E   T+  FI+A GERPRY  IPGDKE+ ITSDDLFSL YCPGKTLV+GASYVALECAGFLA LGL VTVMVRSI LRGFDQQMA   G YME+HGV FI + VPTK+  +E G+PG+ +V     +    Y+  FNTVL A+GRD CT  IGL+ V + +D + G+V VN+ EQ+ V ++YAIGDI+   L+LTP+AIQAG+ L++RL+GG     DYVNV TTVFTPLEYG  GL+EE AI   G ++IEVFH NF PLEWTVA   +N CY K++CNK+D  RVVGFHVL PNAGEITQG+ +AM+ G TK   DDTIGIHPTC+E       T  S A
Sbjct:    1 MPPTGEAREAARTRVQGLVERVPVVLFSKSFCPFCEKVKGLFTELKVSYEALELDLIDDGPLIQEVLLEMTGQKTVPNVFVNKTHVGGCDKTIQAYQSGRLQQLLAASTAPSPAPPVEDTDAVRHSYEYDLIVIGGGSGGLAASKEAAKLGKKVMVLDFVQPTPLGTSWGLGGTCVNVGCIPKKLMHQAALLGHALSDSRKFGWEYDQQVTHNWSTMKEAIQNYIGSLNWGYRVALRDHAVSYVNAFGTFTDAHAIKATNKRGKETQHTAETFILAMGERPRYLGIPGDKEFCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGLGLDVTVMVRSILLRGFDQQMAELAGDYMEKHGVKFIRQFVPTKVEQLEAGTPGRLKVHAKATEGSELYEGEFNTVLIAVGRDACTSNIGLDVVGVKVDERTGKVPVNDVEQTNVPHVYAIGDILQGKLELTPIAIQAGRLLAQRLYGGGTTKCDYVNVCTTVFTPLEYGCCGLSEERAIELLGGDNIEVFHSNFWPLEWTVAGGDNNSCYAKILCNKADKDRVVGFHVLGPNAGEITQGFGVAMKCGLTKAQLDDTIGIHPTCAEVGRAHTATHRSTA 606          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Sea Lamprey
Match: dldh (dihydrolipoamide dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040120-4])

HSP 1 Score: 172.17 bits (435), Expect = 1.300e-46
Identity = 142/493 (28.80%), Postives = 229/493 (46.45%), Query Frame = 1
Query:  397 DERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSC--EDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATG-ERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVM--VRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGE-HILTDYVNVPTTVFTPLEYGSIG-----LAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASG 1842
            D+   + D+ VIG G GG  A+ +AA  G KV  ++            LGGTC+NVGCIP K +  ++   H    +D  S G  + + ++ + + M+E+    +++L  G     +   V ++  +G    ++ +       ++++I + N +IATG E   +  I  D+E  ++S    SL   P K +VIGA  + +E       LG +VT +  +  +   G D +++    + +++ G+ F    + TK++     + GK +V     K         + +L  +GR P T  +GLE + I LD  GRV +N   Q+++ NIYAIGD ++ G  L   A   G      + GG  HI  DY  VP+ ++T  E   IG     L EE    K GK     F  N +          D D   K++ +K  + R++G H+L   AGE+    A+AM  GA+  D       HPT SE F   N+    G
Sbjct:   35 DKAPLDADVTVIGSGPGGYVAAIKAAQLGFKVICVE--------KNETLGGTCLNVGCIPSKALLNNSYFYHLAHGKDFASRGIEI-QGLKLNLEKMMEQKSGAVKALTGGIAHLFKQNKVTHVKGHGMITGKNQVTAACADGSQQVINTKNILIATGSEVTPFQGIEVDEETVVSSTGALSLKQVPEKLVVIGAGVIGVELGSVWQRLGAEVTAVEFLGHVGGAGIDMEISKNFQRILQKQGMKFK---LSTKVMAASRRADGKIDVQTEPAKGGAADTLTCDVLLVCVGRRPFTAGLGLEELGIALDNRGRVPINNRFQTSIPNIYAIGDAVA-GPMLAHKAEDEGIICVEGMAGGAVHI--DYNCVPSVIYTHPEVAWIGKNEEQLKEEGVPYKIGKFP---FAANSR-----AKTNADTDGLVKILAHKETD-RMLGAHILGSGAGEMINEAALAMEYGASCEDVARVCHAHPTVSEAFREANLAATFG 503          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Yeast
Match: GLR1 (Cytosolic and mitochondrial glutathione oxidoreductase; converts oxidized glutathione to reduced glutathione; cytosolic Glr1p is the main determinant of the glutathione redox state of the mitochondrial intermembrane space; mitochondrial Glr1p has a role in resistance to hyperoxia; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000006012])

HSP 1 Score: 266.544 bits (680), Expect = 8.530e-82
Identity = 168/479 (35.07%), Postives = 274/479 (57.20%), Query Frame = 1
Query:  415 YDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGW--NVPETVEH---SWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYP-NIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVR-SIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILT---DYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTL 1821
            YD +VIGGGSGG+A+++ AA++GAK  +++            LGGTCVNVGC+PKK+M  ++ L      A  YG   N+P   EH   +W    ++   ++  LN  Y+ +L  + VD +  +  F  +  ++   + N   + ++N+ ++ATG +  +P NIPG  E G  SD  F L   P K +V+GA Y+ +E AG    LG +  +++R    LR FD+ + N I  +  + G++       +KI+ +E+     K     ++ D     D  + +++ IGR      +G ENV I L+ + ++I +E + + V NIY++GD++ + ++LTPVAI AG+ LS RLFG E       DY NVP+ +F+  E GSIG++E++AI KYGKE+I+V++  F  + + +        Y K++C    N +VVG H++  ++ EI QG+ +A++MGATK DFD+ + IHPT +E   T+
Sbjct:   24 YDYLVIGGGSGGVASARRAASYGAKTLLVE---------AKALGGTCVNVGCVPKKVMWYASDLATRVSHANEYGLYQNLPLDKEHLTFNWPEFKQKRDAYVHRLNGIYQKNLEKEKVDVVFGWARFNKDGNVEVQKRDNTTEVYSANHILVATGGKAIFPENIPG-FELGTDSDGFFRLEEQPKKVVVVGAGYIGIELAGVFHGLGSETHLVIRGETVLRKFDECIQNTITDHYVKEGINVHK---LSKIVKVEKNVETDK--LKIHMNDSKSIDD-VDELIWTIGRKSHLG-MGSENVGIKLNSHDQIIADEYQNTNVPNIYSLGDVVGK-VELTPVAIAAGRKLSNRLFGPEKFRNDKLDYENVPSVIFSHPEAGSIGISEKEAIEKYGKENIKVYNSKFTAMYYAMLSEKSPTRY-KIVC-AGPNEKVVGLHIVGDSSAEILQGFGVAIKMGATKADFDNCVAIHPTSAEELVTM 482          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Yeast
Match: LPD1 (Dihydrolipoamide dehydrogenase; the lipoamide dehydrogenase component (E3) of the pyruvate dehydrogenase and 2-oxoglutarate dehydrogenase multi-enzyme complexes; PDH complex is concentrated in spots within the mitochondrial matrix, often near the ERMES complex and near peroxisomes; LPD1 has a paralog, IRC15, that arose from the whole genome duplication [Source:SGD;Acc:S000001876])

HSP 1 Score: 159.458 bits (402), Expect = 2.004e-42
Identity = 136/493 (27.59%), Postives = 224/493 (45.44%), Query Frame = 1
Query:  415 YDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKK-LMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTD------KYNNERIITSNNFIIATG-ERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVM-VRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKD-KTEYKDWFNT--VLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEED--------AIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKL-ICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNIT 1830
            +D+V+IGGG  G  A+ +AA  G   A ++            LGGTC+NVGCIP K L++ S L      +A+  G +V   ++ +  N  +   + ++ L  G     +   V Y    G+F DE  I+ T           + I+   N I+ATG E   +P I  D+E  ++S    SL   P +  +IG   + LE     + LG KVTV+  +       D ++A    K++++ G+DF    + TK+I  +      K V    ++D KT  ++      +L A+GR P    +G E + +++DK GR++++++  S   +I  +GD+ + G  L   A + G      L  G H   +Y N+P+ +++  E   +G  EE          IGK+             P       + + D  G + I   S   R++G H++ PNAGE+     +A+  GA+  D       HPT SE F   N+ 
Sbjct:   27 HDVVIIGGGPAGYVAAIKAAQLGFNTACVE--------KRGKLGGTCLNVGCIPSKALLNNSHLFHQMHTEAQKRGIDVNGDIKINVANFQKAKDDAVKQLTGGIELLFKKNKVTYYKGNGSFEDETKIRVTPVDGLEGTVKEDHILDVKNIIVATGSEVTPFPGIEIDEEKIVSSTGALSLKEIPKRLTIIGGGIIGLEMGSVYSRLGSKVTVVEFQPQIGASMDGEVAKATQKFLKKQGLDF---KLSTKVISAKRND--DKNVVEIVVEDTKTNKQENLEAEVLLVAVGRRPYIAGLGAEKIGLEVDKRGRLVIDDQFNSKFPHIKVVGDV-TFGPMLAHKAEEEGIAAVEMLKTG-HGHVNYNNIPSVMYSHPEVAWVGKTEEQLKEAGIDYKIGKF-------------PFAANSRAKTNQDTEGFVKILIDSKTERILGAHIIGPNAGEMIAEAGLALEYGASAEDVARVCHAHPTLSEAFKEANMA 491          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Yeast
Match: IRC15 (Microtubule associated protein; regulates microtubule dynamics; required for accurate meiotic chromosome segregation; null mutant displays large budded cells due to delayed mitotic progression, increased levels of spontaneous Rad52 foci; IRC15 has a paralog, LPD1, that arose from the whole genome duplication [Source:SGD;Acc:S000005938])

HSP 1 Score: 108.997 bits (271), Expect = 1.912e-25
Identity = 116/506 (22.92%), Postives = 215/506 (42.49%), Query Frame = 1
Query:  373 EGRIQKLLDERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEE--IQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERP-RYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVM-VRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVI-VNEEEQSTVS--NIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEE---DAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLI--CNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETF-TTLNITKASGADP 1851
            E  I   +++    YD++VIG G GG  A+ +A+  G   A +D            LGG  +  G +P K +   + L    +                +D    +  ++++I+ L   Y+  L    V       AF D H ++   +     I+ +   ++ATG    + P +  D +  I+SD   SL Y P +  ++G   + LE A    +LG +VT++  +S   +  D ++A+     ++  G+ F+ +   T++   E  + G+  +       K  Y    + ++ +IGR P     GL+   I LD+   V  V+ + QS +   +I  IGD+    +       QA + +      G    ++    P  ++   + G +G  EE    A   Y K  + +F QN +    T+  R +N      I     S +M+++G H+++ +A E+    ++A+ +G T  D       HP+ SE+F   + +  A+G  P
Sbjct:    4 EDEILSTMEDFAAVYDVLVIGCGPGGFTAAMQASQAGLLTACVD--------QRASLGGAYLVDGAVPSKTLLYESYLYRLLQQQELIEQRGTRLFPAKFDMQAAQSALKHNIEELGNVYKRELSKNNVTVYKGTAAFKDPHHVEIAQRGMKPFIVEAKYIVVATGSAVIQCPGVAIDNDKIISSDKALSLDYIPSRFTIMGGGTIGLEIACIFNNLGSRVTIVESQSEICQNMDNELASATKTLLQCQGIAFLLD---TRVQLAEADAAGQLNITLLNKVSKKTYVHHCDVLMVSIGRRPLLK--GLDISSIGLDERDFVENVDVQTQSLLKYPHIKPIGDVTLGPMLALKAEEQAIRAIQSIGCTGSDGTSNCGFPPNVLYCQPQIGWVGYTEEGLAKARIPYQKGRV-LFSQNVR--YNTLLPREENTTVSPFIKVLIDSRDMKILGVHMINDDANELLSQASMAVSLGLTAHDVCKVPFPHPSLSESFKQAVQLAMANGTSP 493          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Yeast
Match: GRX1 (Glutathione-dependent disulfide oxidoreductase; hydroperoxide and superoxide-radical responsive, heat-stable, with active site cysteine pair; protects cells from oxidative damage; GRX1 has a paralog, GRX2, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000540])

HSP 1 Score: 63.5438 bits (153), Expect = 8.186e-13
Identity = 31/89 (34.83%), Postives = 52/89 (58.43%), Query Frame = 1
Query:  100 ISTALEEWIRKIINSSVLIIFSKTTCPFCYK----IKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDD 354
            +S    + ++ +I  + + + SKT CP+C+     + + LK    K   +++N +  G++IQ  LY I  QRTVPN+++ G HIGG DD
Sbjct:    2 VSQETIKHVKDLIAENEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNIYINGKHIGGNDD 90          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Yeast
Match: GRX2 (Cytoplasmic glutaredoxin; thioltransferase, glutathione-dependent disulfide oxidoreductase involved in maintaining redox state of target proteins, also exhibits glutathione peroxidase activity, expression induced in response to stress; GRX2 has two in-frame start codons resulting in a shorter isoform that is retained in the cytosol and a longer form translocated to the mitochondrial matrix; GRX2 has a paralog, GRX1, that arose from the whole genome duplication [Source:SGD;Acc:S000002921])

HSP 1 Score: 63.1586 bits (152), Expect = 2.248e-12
Identity = 32/95 (33.68%), Postives = 56/95 (58.95%), Query Frame = 1
Query:  124 IRKIINSSVLIIFSKTTCPFCYKIKKSL-KDANI---KYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLL 396
            ++ +I    + + +KT CP+C     +L ++ N+   K   +E++ ++ GSEIQD L  I+ Q+TVPNV++ G HIGG  D       G++ ++L
Sbjct:   44 VKDLIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQKTVPNVYINGKHIGGNSDLETLKKNGKLAEIL 138          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Nematostella
Match: EDO38228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDH7])

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 367/595 (61.68%), Postives = 447/595 (75.13%), Query Frame = 1
Query:   91 MPPISTALEEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLL--DERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLD-KNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            M P+   ++  I   IN++ ++IFSK+ CPFC K+K   +  N++Y A+E++L+  G  IQ+ L   + Q+TVPNV++RG H+GG D   K   E +I  L+      YEYDL+VIGGGSGGLA +KEAA  G KVAVLDFVKPTP+GTTWGLGGTCVNVGCIPKKLMHQ+ALL  + +DAR YGW   E V+H+W+++ E +QNHI SLNWGYR  LR K V Y NA+G FID HTIK TDK   E I+T+  F++A G RPRYPNIPG KEYGITSDDLFSL YCPG T++IGASYV+LECAGFLA++GL VTV+VRSI LRGFDQQMA K G +ME HGV F    VPTK+  +EEGSPGK  V       +  + D  NTV+FAIGRD CT  IGLE V + L+ KN +VI  + EQS+V NIYAIGDI+   L+LTPVAIQAG+ LSRRL+  +  L DY+NV TTVFTPLEYG+IG +EEDAI K+G+E++EV+H  F+PLE+TVA R  +DCY KLICNK+D+ RVVGFHVL PNAGEITQGYA+A + GATK  FDDTIGIHPTCSETFT L++TK SGA    SGC
Sbjct:    1 MAPVPQ-IQRLIEDSINNNAVMIFSKSFCPFCKKVKAIFESINVQYTAMELDLVDNGPAIQEALLEKSGQKTVPNVYIRGNHVGGSDIITKLQEENKILGLIIPPSASYEYDLIVIGGGSGGLACAKEAAQLGRKVAVLDFVKPTPKGTTWGLGGTCVNVGCIPKKLMHQAALLGEALKDARLYGWEFDEKVKHNWESLREGVQNHIGSLNWGYRVQLREKSVTYKNAFGEFIDNHTIKATDKRGTETIMTAETFVLAMGLRPRYPNIPGAKEYGITSDDLFSLPYCPGTTVLIGASYVSLECAGFLAAMGLDVTVVVRSILLRGFDQQMAEKAGSFMETHGVKFKRPAVPTKVEQLEEGSPGKLRVHYKLEGGEEGHLDC-NTVVFAIGRDACTTGIGLEKVGVKLNPKNQKVIAGDNEQSSVPNIYAIGDILDGKLELTPVAIQAGRLLSRRLYRNDTKLCDYINVATTVFTPLEYGAIGYSEEDAIQKFGQENVEVYHTLFQPLEYTVAQRSKDDCYAKLICNKADSERVVGFHVLGPNAGEITQGYAVAFKCGATKEHFDDTIGIHPTCSETFTLLDVTKRSGASIVSSGC 593          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Nematostella
Match: EDO46553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPR5])

HSP 1 Score: 429.098 bits (1102), Expect = 3.604e-144
Identity = 231/485 (47.63%), Postives = 294/485 (60.62%), Query Frame = 1
Query:  415 YDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYP-NIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            YDLVVIGGGSGGLA SKEAA+ G KVAVLDFV P+PQG+TWG+GGTCVNVGCIPKKLMH ++LL    +DA+ YGW + + +   W N+V  +QN+I+SLNWGYR  L +K V YI    +F+D HTIK   K   E ++TS   +IA G RPR+P ++PG KEY ITSDDLFSL   PGKTLVIGASYVALECAGFLA  G   ++M+RSI LRGFDQQMA+ + +YM  HG  FI +CVP  +   ++   GK  V           ++ F+TVL AIGRDP T  + L+   + +DK+G +I  E EQ++  NIYA+GD++    +LTPVAI AGK L+RRLF G  I  DY NV       L +         +I K  K       + +  +     + G         C   D   +     L+P  G       +  R G T R    T+GIHPTC+E    L+ITK SG DP  +GC
Sbjct:    1 YDLVVIGGGSGGLACSKEAASLGKKVAVLDFVAPSPQGSTWGIGGTCVNVGCIPKKLMHHASLLGDGIKDAKKYGWQLSDQMTFDWGNLVTGVQNYIKSLNWGYRVQLHDKSVRYIPGMASFVDRHTIKAVLKSGKEELLTSEKVVIAVGGRPRFPSDVPGAKEYCITSDDLFSLQKPPGKTLVIGASYVALECAGFLAGFGYNTSLMMRSIPLRGFDQQMASLVTEYMSRHGTRFINQCVPVSV---DKRPDGKLHVQWTNPSSGERGEEEFDTVLMAIGRDPSTAALELDKAGVQVDKSGFIIGMENEQTSAKNIYALGDVLQDRPELTPVAIMAGKLLARRLFAGSTIQMDYDNVRILSLRRLLH---------SINKAAKAEEHAPVRLYSMMSLLTPYWG---------CTTGD---LYTRPSLNPLLG-------MYYRCGLTMRMLSSTVGIHPTCAEEVVKLHITKRSGEDPTVTGC 454          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Nematostella
Match: EDO43495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYC0])

HSP 1 Score: 296.59 bits (758), Expect = 5.914e-93
Identity = 165/457 (36.11%), Postives = 273/457 (59.74%), Query Frame = 1
Query:  463 KEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVR-SIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDW--FNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGE-HILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTL 1821
            + AA FG K  V++  +         LGGTCVNVGC+PKK+M  +A+   +    + YG++V    + +W N+ E+   H+  LN  Y  +L    VD++  +  F  +  +K  D     ++ +  + +IATG  P  P+IPG  E+GITSD  F L   P K  V+GA Y+A+E AG L +LG +V++++R +  +R FD  ++  + + +++ G+D  T     ++   ++ + G   +    +K+KTE  D   ++ +L+A+GR+P T+ +GLE++ I++DK G +IV+E + +T  N+YA+GD+  + L LTPVAI AG+ L+ RLF G+ ++  DYVN+PT VF+    G+IGL EE A  +YGK+ ++++   F  + + V  +  +  + KLI    +  +V+G H+L   A E+ QG+A+A++MGATK DFD+ + IHPT SE   T+
Sbjct:   23 RRAAEFGVKAVVIEHAR---------LGGTCVNVGCVPKKIMFNAAMCAETLPYYKDYGFDVILN-KFTWKNIKEKRDAHVSKLNTIYENNLGKAHVDFVAGHAQFTPDGNVKVGD-----QLFSGKHILIATGGVPSLPSIPG-FEHGITSDGFFELEDLPKKVAVVGAGYIAVELAGILNALGSRVSLLIRYNNVIRNFDSMLSGMLTEEIKDSGIDLCTNTTTEQV--SKDSNTGLLTLH--TLKNKTEKVDLSGYDCLLWAMGRNPNTNNLGLEHMGIEMDKGGHIIVDEFQNTTRKNVYALGDVCGKAL-LTPVAISAGRKLAHRLFDGQTNLKLDYVNIPTVVFSHPTIGTIGLTEEQAAQQYGKDKLKIYKSTFVNMYYAVTDK-KHKTHMKLITLLPEE-KVIGLHILGLGADEMLQGFAVAIKMGATKADFDNAVAIHPTSSEELVTM 456          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Nematostella
Match: EDO46554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPR6])

HSP 1 Score: 184.496 bits (467), Expect = 1.692e-54
Identity = 85/157 (54.14%), Postives = 111/157 (70.70%), Query Frame = 1
Query: 1396 QLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            +LTPVAI AGK L+RRLF G  I  DY N+ TTVFTPLEY ++GL+EEDAI +YG+E++EV+H  +KPLE+ V  R ++  Y K +C +     V+G H L PNAGE+ QG+A+A+R G T R    T+GIHPTC+E    L+ITK SG DP  +GC
Sbjct:   21 ELTPVAIMAGKLLARRLFAGSTIQMDYDNIATTVFTPLEYSTVGLSEEDAIRQYGEENLEVYHAFYKPLEFRVTEREEDVGYIKAVCLREGEQSVIGLHYLGPNAGEVMQGFAVAIRCGLTMRMLSSTVGIHPTCAEEVVKLHITKRSGEDPTVTGC 177          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Nematostella
Match: EDO49659 (Dihydrolipoyl dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A7RFT6])

HSP 1 Score: 187.963 bits (476), Expect = 5.881e-52
Identity = 157/498 (31.53%), Postives = 240/498 (48.19%), Query Frame = 1
Query:  388 KLLDERQY----EYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKH--SCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATG-ERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVM--VRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDW-FNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGE-HILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYG--KLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASG 1842
            +++  R Y    E DLVVIG G GG  A+ +AA  G K   ++            LGGTC+NVGCIP K +  ++ L H  S  D ++ G  +   V  + D M+ + +N +++L  G     +   V  ++  G   D + +       +  +I + N +IATG E   +P I  D+++ I+S    SLS  P   ++IGA  + +E     + LG  VT +  +  I   G D +++    + +++ G+ F    + TK+   E  S G   V     KD ++ ++   + +L  IGR P T R+GLE V I LD  GRV+VNE+ Q+ V NIYAIGD I  G  L   A   G      + GG  HI  DY  VP  V+T  E   +G  EE       +E +E     F P+      R + +  G  K++ +K  + R++G H++ P AGE+    A+AM  GA+  D       HPT SE F   N+   +G
Sbjct:   31 RVVSSRNYSTEGEVDLVVIGSGPGGYVAAIKAAQLGMKTVSVE--------KNMSLGGTCLNVGCIPSKALLNNSHLYHQASGADFKNRGIEM-SGVTLNLDQMMSQKENAVKALTNGIAHLFKQNKVTQVHGRGTITDTNEVTVYKDDLSTEVIKTKNILIATGSEVTPFPGIEIDEKHIISSTGALSLSTVPKNLVLIGAGVIGVELGSVWSRLGANVTAVEFLGHIGGIGIDMEISKNFQRILQKQGMKFK---LNTKVTGAERTSDGVV-VSVESAKDGSKKEELEADVLLVCIGRRPYTTRLGLEKVGIPLDSRGRVVVNEKFQTNVPNIYAIGDCI-HGPMLAHKAEDEGIICVEGMNGGAVHI--DYNCVPNVVYTHPEVAWVGKTEE----MLKEEGVEYKVGKF-PMSANSRARTNAEIDGMVKVLGDKETD-RLLGVHMICPGAGELINEAALAMEYGASCEDIARVCHAHPTVSEAFREANLAAYAG 506          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Medaka
Match: txnrd3 (thioredoxin reductase 1, cytoplasmic [Source:NCBI gene;Acc:101169850])

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 346/606 (57.10%), Postives = 448/606 (73.93%), Query Frame = 1
Query:   91 MPPI-----STALEEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLL--------DERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLD-KNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            MPPI        L+  I+++I S+ +++FSK++CPFC ++K   K+  ++   VE++L+  G+  Q++L  +T Q+TVPNVF+   H+GGCD   +A  +G +Q+LL        +++ Y+YDL+VIGGGSGGLA SKEAAN G KV VLDFV+PTP+GTTWGLGGTCVNVGCIPKKLMHQ+ALL  + +DAR +GW   E+V+H+W+ M   + N+I SLNWGYR +L++K V+Y+NAY  F++ H IK T+K   E   T+  F++ATGERPRY +IPGD+EY ITSDDLFSL YCPGKTLVIGASYVALEC GFLA LGL VTVMVRSI LRGFDQ MAN+ G +MEEHGV FI + VP KI  +E GSPG+ +V     +     +  +NTVL A+GR+ CT+RIGL+   + ++ KNG++ VN+EEQ+ V +IYAIGDI+    +LTPVAIQAGK L+RRL+G   +  DY+NVPTTVFTP+EYGS GL EE A+  YG E+IEV+H  F PLE+TVA+R +N CY K+I NK DN RV+GFH L PNAGE+TQG+  AM+ G TK   D TIGIHPTC+E FTTL +TK+SG D  Q+GC
Sbjct:    1 MPPIGNDAGKNDLKMRIQQLIESNAVMVFSKSSCPFCVRVKDLFKELKVECNVVELDLIEEGTNYQEMLLELTGQKTVPNVFINKKHVGGCDKTMQAHRDGSLQRLLGGQTEENQEDQTYDYDLIVIGGGSGGLACSKEAANLGKKVMVLDFVEPTPKGTTWGLGGTCVNVGCIPKKLMHQTALLGTALQDARKFGWEFDESVKHNWETMKTAVNNYIGSLNWGYRVALKDKNVNYVNAYAEFVEPHKIKATNKRKKETFYTAAKFVLATGERPRYLDIPGDREYCITSDDLFSLPYCPGKTLVIGASYVALECGGFLAGLGLDVTVMVRSILLRGFDQDMANRAGDHMEEHGVKFIRKFVPVKIEELEAGSPGRLKVTAKSTETDEIIEGEYNTVLIAVGRNACTERIGLDKAGVRVNPKNGKIPVNDEEQTNVPHIYAIGDILEGKWELTPVAIQAGKLLARRLYGNSTLKCDYINVPTTVFTPMEYGSCGLPEERAVELYGLENIEVYHSLFWPLEFTVANRDNNKCYSKIIVNKLDNERVIGFHYLGPNAGEVTQGFGAAMKCGITKEQLDGTIGIHPTCAEIFTTLQVTKSSGGDIKQAGC 606          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Medaka
Match: txnrd3 (thioredoxin reductase 1, cytoplasmic [Source:NCBI gene;Acc:101169850])

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 333/580 (57.41%), Postives = 427/580 (73.62%), Query Frame = 1
Query:  160 FSKTTCPFC--YKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLL--------DERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLD-KNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            + K++ P      +K   K+  ++   VE++L+  G+  Q++L  +T Q+TVPNVF+   H+GGCD   +A  +G +Q+LL        +++ Y+YDL+VIGGGSGGLA SKEAAN G KV VLDFV+PTP+GTTWGLGGTCVNVGCIPKKLMHQ+ALL  + +DAR +GW   E+V+H+W+ M   + N+I SLNWGYR +L++K V+Y+NAY  F++ H IK T+K   E   T+  F++ATGERPRY +IPGD+EY ITSDDLFSL YCPGKTLVIGASYVALEC GFLA LGL VTVMVRSI LRGFDQ MAN+ G +MEEHGV FI + VP KI  +E GSPG+ +V     +     +  +NTVL A+GR+ CT+RIGL+   + ++ KNG++ VN+EEQ+ V +IYAIGDI+    +LTPVAIQAGK L+RRL+G   +  DY+NVPTTVFTP+EYGS GL EE A+  YG E+IEV+H  F PLE+TVA+R +N CY K+I NK DN RV+GFH L PNAGE+TQG+  AM+ G TK   D TIGIHPTC+E FTTL +TK+SG D  Q+GC
Sbjct:    3 YMKSSSPLSSFVMVKDLFKELKVECNVVELDLIEEGTNYQEMLLELTGQKTVPNVFINKKHVGGCDKTMQAHRDGSLQRLLGGQTEENQEDQTYDYDLIVIGGGSGGLACSKEAANLGKKVMVLDFVEPTPKGTTWGLGGTCVNVGCIPKKLMHQTALLGTALQDARKFGWEFDESVKHNWETMKTAVNNYIGSLNWGYRVALKDKNVNYVNAYAEFVEPHKIKATNKRKKETFYTAAKFVLATGERPRYLDIPGDREYCITSDDLFSLPYCPGKTLVIGASYVALECGGFLAGLGLDVTVMVRSILLRGFDQDMANRAGDHMEEHGVKFIRKFVPVKIEELEAGSPGRLKVTAKSTETDEIIEGEYNTVLIAVGRNACTERIGLDKAGVRVNPKNGKIPVNDEEQTNVPHIYAIGDILEGKWELTPVAIQAGKLLARRLYGNSTLKCDYINVPTTVFTPMEYGSCGLPEERAVELYGLENIEVYHSLFWPLEFTVANRDNNKCYSKIIVNKLDNERVIGFHYLGPNAGEVTQGFGAAMKCGITKEQLDGTIGIHPTCAEIFTTLQVTKSSGGDIKQAGC 582          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Medaka
Match: txnrd2.1 (thioredoxin reductase 2 [Source:NCBI gene;Acc:101163827])

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 257/489 (52.56%), Postives = 348/489 (71.17%), Query Frame = 1
Query:  406 QYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYP-NIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDK-NGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            +++YDLVVIGGGSGGLA SKEAA  G KVAVLD+V P+ +GT WGLGGTCVNVGCIPKKLMHQ+ALL  + +DA+ YGW +  TV H W  M E +QN+++SLNWG+R  L++K V Y+N  G  +D+HTI+   K   E I+T+ N ++ATG RP+YP N+PG  E+GITSDD+F L   PGKTLV+GASYVALECAGFL  +GL  TVMVR+I LRGFDQQMA  +  ++E +G  F  + VPT++   E+ S G  +V     +   E+ D F+++L+A+GR P T  +GL+ + + + K  G++IV  +E S++ NIYA GDI     +LTP AI+AG+ L+ RL G    L +Y NV TTVFTPLEYG +GL+EE+A  ++GK+ IEV+H  +KPLE+TVA R  + CY K+IC ++ + +++G H L PNAGE+ QG+++A++ GAT R    T+GIHPT +E    +NITK SG DP  +GC
Sbjct:   27 KHDYDLVVIGGGSGGLACSKEAAQLGQKVAVLDYVDPSAKGTKWGLGGTCVNVGCIPKKLMHQAALLGTAVKDAQRYGWQISGTVSHDWATMAEAVQNYVKSLNWGHRVQLQDKKVTYLNLKGTLVDKHTIRGLSKAGKETILTAKNIVLATGGRPKYPSNVPGAMEHGITSDDIFWLKKSPGKTLVVGASYVALECAGFLTGIGLDTTVMVRTIALRGFDQQMAGLVTDHLESYGTRFEWKSVPTRV---EKLSSGALKVTWTNTQTGCEHSDTFDSLLWAVGRAPETKALGLDKLGVQISKETGKIIVGPDESSSLPNIYAFGDIGEGRPELTPTAIKAGRLLAHRLAGRSSELMNYDNVATTVFTPLEYGCVGLSEEEAEKRHGKDGIEVYHAFYKPLEFTVAQRDSSQCYIKVICERAGHQKILGLHFLGPNAGEVLQGFSLALQCGATYRQLMQTVGIHPTSAEELVKINITKRSGLDPTVTGC 512          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Medaka
Match: txnrd2.1 (thioredoxin reductase 2 [Source:NCBI gene;Acc:101163827])

HSP 1 Score: 462.225 bits (1188), Expect = 1.260e-156
Identity = 232/489 (47.44%), Postives = 319/489 (65.24%), Query Frame = 1
Query:  406 QYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYP-NIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDK-NGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            +++YDLVVIGGGSGGLA SKE                   GT WGLGGTCVNVGCIPKKLMHQ+ALL  + +DA+ YGW +  TV H W  M E +QN+++SLNWG+R  L++K V Y+N  G  +D+HTI+   K   E I+T+ N ++ATG RP+YP N+PG  E+GIT+                  S VALECAGFL  +GL  TVMVR+I LRGFDQQMA  +  ++E +G  F  + VPT++   E+ S G  +V     +   E+ D F+++L+A+GR P T  +GL+ + + + K  G++IV  +E S++ NIYA GDI     +LTP AI+AG+ L+ RL G    L +Y NV TTVFTPLEYG +GL+EE+A  ++GK+ IEV+H  +KPLE+TVA R  + CY K+IC ++ + +++G H L PNAGE+ QG+++A++ GAT R    T+GIHPT +E    +NITK SG DP  +GC
Sbjct:    4 KHDYDLVVIGGGSGGLACSKE-------------------GTKWGLGGTCVNVGCIPKKLMHQAALLGTAVKDAQRYGWQISGTVSHDWATMAEAVQNYVKSLNWGHRVQLQDKKVTYLNLKGTLVDKHTIRGLSKAGKETILTAKNIVLATGGRPKYPSNVPGAMEHGITT---------------CSHSDVALECAGFLTGIGLDTTVMVRTIALRGFDQQMAGLVTDHLESYGTRFEWKSVPTRV---EKLSSGALKVTWTNTQTGCEHSDTFDSLLWAVGRAPETKALGLDKLGVQISKETGKIIVGPDESSSLPNIYAFGDIGEGRPELTPTAIKAGRLLAHRLAGRSSELMNYDNVATTVFTPLEYGCVGLSEEEAEKRHGKDGIEVYHAFYKPLEFTVAQRDSSQCYIKVICERAGHQKILGLHFLGPNAGEVLQGFSLALQCGATYRQLMQTVGIHPTSAEELVKINITKRSGLDPTVTGC 455          
BLAST of Thioredoxin glutathione reductase vs. Ensembl Medaka
Match: gsr (glutathione-disulfide reductase [Source:NCBI gene;Acc:101174600])

HSP 1 Score: 264.233 bits (674), Expect = 7.343e-80
Identity = 172/485 (35.46%), Postives = 266/485 (54.85%), Query Frame = 1
Query:  412 EYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFID--EHTIKTTDKYNNERIITSNNFIIATGERPRY---PNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSI-FLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEG--------SPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLF-GGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTL 1821
             +D +VIGGGSGGLA ++ AA  GA  AV++  K         LGGTCVNVGC+PKK+M  +A+      D   YG+    +V  SW+ +  +   +I  LN  YR +L    V +I  Y  F D  E T++      N +  T+ + +I+TG +P       +PG    GI SD  F L   P +++++GA Y+A+E AG L++LG K ++++R    LR FD  ++    K ++ +G+D         +   E+G         P K         +K    +  + +L+AIGR P T  + +  + +D D  G +IV++ + +T S IYA+GD+  + L LTPVAI AG+ L+ RLF G +    DY  +PT VF+    G++GL EE+A+   GKE+++++  +F P+   +  R  + C  KL+C   +  +VVG H+      E+ QG+A+A++MGATK DFD T+ IHPT SE F T+
Sbjct:   36 RFDFLVIGGGSGGLAGARRAAELGANAAVIESHK---------LGGTCVNVGCVPKKVMWNAAVHAEYLHDHCDYGFETG-SVRFSWEALKAKRDAYIAHLNRIYRNNLDKAKVTFIQGYARFTDDAEPTVEV-----NGKKYTAPHILISTGGQPSVLSDEEVPG-ASLGINSDGFFELETLPKRSVIVGAGYIAVEMAGILSTLGSKTSLIIRQTGVLRNFDALISANCTKEIQNNGIDLWKNSQVKSVCKTEKGLEVTIVTKDPDKTN------DEKISVIEEVDCLLWAIGRQPNTAGLNIGAMGVDTDDRGHIIVDDFQNTTRSGIYAVGDVCGKAL-LTPVAIAAGRKLAHRLFEGKKDSKLDYSCIPTVVFSHPPIGTVGLTEEEAVKTKGKENVKIYKTSFTPMYHAITRR-KSQCIMKLVCVGKEE-KVVGLHMQGLGCDEMLQGFAVAIKMGATKEDFDKTVAIHPTSSEEFVTM 495          
BLAST of Thioredoxin glutathione reductase vs. Planmine SMEST
Match: SMESG000020047.1 (SMESG000020047.1)

HSP 1 Score: 1228 bits (3176), Expect = 0.000e+0
Identity = 591/592 (99.83%), Postives = 591/592 (99.83%), Query Frame = 1
Query:   91 MPPISTALEEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            MPPISTALEEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGL EEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC
Sbjct:    1 MPPISTALEEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLLDERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLTEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 592          
BLAST of Thioredoxin glutathione reductase vs. Planmine SMEST
Match: SMESG000063651.1 (SMESG000063651.1)

HSP 1 Score: 477.633 bits (1228), Expect = 7.913e-162
Identity = 254/498 (51.00%), Postives = 331/498 (66.47%), Query Frame = 1
Query:  415 YDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWGLGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNV----PETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYME-EHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKT--EYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVN-------EEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC 1866
            YDLVV+GGGSGGLA +KEAA FG +VAVLD+V P+ +GT+WGLGGTCVNVGCIPKKLMH  A ++   E A   GWN     P+++   W  M   +QN+++SLNWG+R SLR   V+YINA   F D  TI  TD    E+ I + NF+IA G RPRYP+IPG K+YGITSDDLF L   PGKTLV+G SYVALECAGFL + G   TVMVRSI LRGFD+QMA  + ++ME E  + FI    P  +I  E+G    K     Y K+K   E  D ++T+LFAIGRDPCT  + L  V + +D+  + I +       + E++T  NIYAIGD++  G++LTPVAI+AGK L+RRLF  E    +Y  +PTTVFTPLEY  +G+ EE+AI + G ++ EV+H  FKPLE  ++      CY K+IC+   + RVVG H+L  NAGE+ QG+A A++ G T +   +T+GIHPT +E    ++ITK S  DP  +GC
Sbjct:   35 YDLVVVGGGSGGLACAKEAALFGKQVAVLDYVSPSERGTSWGLGGTCVNVGCIPKKLMHHIAQMRDVIESAHDAGWNQINAKPQSLIIDWPIMASRVQNYVKSLNWGHRVSLRENKVEYINAKAKFKDAQTITATDSKGVEKEIKAKNFVIAVGGRPRYPDIPGAKQYGITSDDLFWLKKSPGKTLVVGGSYVALECAGFLHAFGCDTTVMVRSIPLRGFDRQMAEMVAEHMEKERKIKFIYGAEPVSVIEAEQGKFRVK-----YKKEKNPGEMSDVYDTILFAIGRDPCTSDLNLSVVNVSVDEGTKKITSGSKSNECDLEKTTAPNIYAIGDVLKDGVELTPVAIKAGKLLARRLFNNETGQMNYNMIPTTVFTPLEYACVGMTEEEAINRLGDKNTEVYHCFFKPLE-IISMGLQRPCYMKMICDIGHSERVVGLHILGMNAGEVLQGFAAAIKEGITHKQLSNTVGIHPTSAEEVVKIHITKRSHVDPHLTGC 526          
BLAST of Thioredoxin glutathione reductase vs. Planmine SMEST
Match: SMESG000069912.1 (SMESG000069912.1)

HSP 1 Score: 267.7 bits (683), Expect = 1.027e-81
Identity = 149/435 (34.25%), Postives = 251/435 (57.70%), Query Frame = 1
Query:  541 LGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVMVR-SIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTV------LFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGE-HILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTL 1821
            +GGTCVNVGC+PKK+M+ +A+++    D ++YG+ +      +W+ + ++  N+I++LN  Y ++L+   V ++          T+       N +  T+++ +IATG RP  P+IPG  E GITSD  F L   P KT+++G  Y+ +E AG L+SLG +V ++ R  + LR FD+ +   + + +   GV    +    +++      PG  E+    IK+ T   +  NT+      ++A+GR P T  + L+ + I  DK+G + V++ + ++V   YA+GD+  + L LTPVAI AG+ LS RLF  + +   DY N+PT +F+    G IG+ E++A+ KYG   ++++   FKPL + V  R +  C  KL+C   D  +++G H+      E+ QG+++A+++GATK  FDDT+ IHPT +E   T+
Sbjct:   40 MGGTCVNVGCVPKKIMYNTAMIREILRDVKNYGFKISYD-SFNWEIIKQKRDNYIKNLNNIYESNLKQNSVKFVYGEAVTNSNKTVSV-----NNKSYTADHILIATGGRPIIPDIPG-AELGITSDGFFELKALPKKTVIVGVGYIGIELAGILSSLGSEVILIARGDVVLRNFDKIIQTSVEENLHLSGVKIFYK-TDVEMVEYSIMDPGVLEI---SIKNNTN--ESVNTISNVDCLIWAVGRTPNTQTLNLDKLGIKTDKSGHISVDDCQNTSVPGFYAVGDVCGKAL-LTPVAIAAGRRLSDRLFNDQVNSKLDYTNIPTVIFSHPPCGVIGMTEQEAVDKYGSVKVKIYRTFFKPLYFAVTERKEK-CQMKLVCLLPDE-KIIGLHMCGMGCDEMLQGFSVAIKLGATKAQFDDTVAIHPTSAEELVTM 458          
BLAST of Thioredoxin glutathione reductase vs. Planmine SMEST
Match: SMESG000047749.1 (SMESG000047749.1)

HSP 1 Score: 154.066 bits (388), Expect = 3.528e-40
Identity = 127/441 (28.80%), Postives = 211/441 (47.85%), Query Frame = 1
Query:  541 LGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVP-ETVEHSWDNMVEEIQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITSNNFIIATG-ERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALECAGFLASLGLKVTVM--VRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPTKIIPMEEGSPGKKEVFGCYIKD-KTEYKDWFNTVLFAIGRDPCTDRIGLENVKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSRRLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQNFKPLEWTVAHRGDNDCYG--KLICNKSDNMRVVGFHVLSPNAGEITQGYAIAMRMGATKRDFDDTIGIHPTCSETFTTLNITKASG 1842
            LGGTC+NVGCIP K +  ++   H  +        +    V  + + M+      +  L  G +   ++  V ++   G+    + +  T+   N+  +++ N +IATG E   +P+I  D+E  ++S    SL   P K +VIGA  + +E     + LG +VT++  +  +   G D +++  I K + + G++F    + TK+   ++   GK  V     KD K+E  D  +T+L  IGR P T  + L +V +  D  GR+ VN + Q+ V NIYAIGD+I+ G  L   A   G  +      G  +  DY+ VP+ ++T  E   +G +EE       KE    +     PL      + ++D  G  K+I +K D  R++G +++   AGE+    A+AM  GA+  D       HPT +E F   N+    G
Sbjct:   12 LGGTCLNVGCIPSKALLNNSHYYHMAKSNELAARGIDCSGVSLNLEKMMSVKNKAVSGLTGGIKMLFKSNKVTHMEGVGSITGTNEVTVTNNSGNKEKVSTKNILIATGSEVTPFPDIEIDEESIVSSTGALSLKKVPEKMIVIGAGVIGVELGSVWSRLGAQVTLVEFLGHVGGMGIDMEISKSIQKILTKQGLNFK---LNTKVTGAQK-QGGKILVNISGTKDNKSETIDC-DTLLVCIGRRPFTGNLNLSSVGLSTDDKGRIPVNNKFQTAVPNIYAIGDVIA-GPMLAHKAEDEGI-ICVEGMCGSSVHIDYLCVPSVIYTHPEVAWVGRSEEQC-----KEEKIPYKIGKFPLVANSRAKTNDDTDGMVKVIAHK-DTDRLLGAYIVGSVAGELINEAALAMEYGASCEDIARVCHAHPTVAEAFREANLAAYCG 439          
BLAST of Thioredoxin glutathione reductase vs. Planmine SMEST
Match: SMESG000007272.1 (SMESG000007272.1)

HSP 1 Score: 54.6842 bits (130), Expect = 4.594e-9
Identity = 33/99 (33.33%), Postives = 50/99 (50.51%), Query Frame = 1
Query:  118 EWIRKIINSSVLIIFSKTTCPFCYKIKKSLKD------ANIKYAAVEINLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQKLL 396
            E++ + I++  +++FSK+ CP+C   K  L           +Y  VE+      ++IQD L  IT  RTVP VFV    IGG  D  K     +++ LL
Sbjct:    4 EFVNEKISTKKVVVFSKSFCPYCTLAKNVLNKYIGTSIPTDQYEVVELENDPNCNKIQDYLSEITGARTVPRVFVNSKFIGGGTDVEKLDKMNQLEPLL 102          
The following BLAST results are available for this feature:
BLAST of Thioredoxin glutathione reductase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TXNRD30.000e+056.76thioredoxin reductase 3 [Source:HGNC Symbol;Acc:HG... [more]
TXNRD30.000e+056.76thioredoxin reductase 3 [Source:HGNC Symbol;Acc:HG... [more]
TXNRD10.000e+057.19thioredoxin reductase 1 [Source:HGNC Symbol;Acc:HG... [more]
TXNRD10.000e+057.22thioredoxin reductase 1 [Source:HGNC Symbol;Acc:HG... [more]
TXNRD10.000e+059.41thioredoxin reductase 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Thioredoxin glutathione reductase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trxr-10.000e+049.50Thioredoxin reductase 1 [Source:UniProtKB/Swiss-P... [more]
trxr-10.000e+049.50Thioredoxin reductase 1 [Source:UniProtKB/Swiss-P... [more]
trxr-21.292e-14544.42Probable glutathione reductase 2 [Source:UniProtK... [more]
gsr-11.895e-7536.34Glutathione reductase, mitochondrial [Source:UniP... [more]
gsr-11.895e-7536.34Glutathione reductase, mitochondrial [Source:UniP... [more]
back to top
BLAST of Thioredoxin glutathione reductase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trxr-18.487e-17551.95gene:FBgn0020653 transcript:FBtr0071167[more]
Trxr-11.536e-17451.95gene:FBgn0020653 transcript:FBtr0071169[more]
Trxr-15.549e-17351.95gene:FBgn0020653 transcript:FBtr0071168[more]
Trxr-24.243e-15747.44gene:FBgn0037170 transcript:FBtr0078514[more]
CG74302.705e-4728.28gene:FBgn0036762 transcript:FBtr0075140[more]
back to top
BLAST of Thioredoxin glutathione reductase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
txnrd30.000e+058.67thioredoxin reductase 3 [Source:ZFIN;Acc:ZDB-GENE-... [more]
txnrd30.000e+058.64thioredoxin reductase 3 [Source:ZFIN;Acc:ZDB-GENE-... [more]
txnrd2.20.000e+052.97thioredoxin reductase 2, tandem duplicate 2 [Sourc... [more]
txnrd2.21.399e-11055.12thioredoxin reductase 2, tandem duplicate 2 [Sourc... [more]
gsr8.771e-8334.33glutathione reductase [Source:ZFIN;Acc:ZDB-GENE-05... [more]
back to top
BLAST of Thioredoxin glutathione reductase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
txnrd30.000e+058.56Xenopus tropicalis thioredoxin reductase 3 (txnrd3... [more]
txnrd30.000e+058.22Xenopus tropicalis thioredoxin reductase 3 (txnrd3... [more]
txnrd30.000e+058.85Xenopus tropicalis thioredoxin reductase 3 (txnrd3... [more]
txnrd30.000e+057.84Xenopus tropicalis thioredoxin reductase 3 (txnrd3... [more]
nmt10.000e+058.56N-myristoyltransferase 1 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Thioredoxin glutathione reductase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Txnrd30.000e+058.42thioredoxin reductase 3 [Source:MGI Symbol;Acc:MGI... [more]
Txnrd10.000e+063.19thioredoxin reductase 1 [Source:MGI Symbol;Acc:MGI... [more]
Txnrd10.000e+063.19thioredoxin reductase 1 [Source:MGI Symbol;Acc:MGI... [more]
Txnrd10.000e+063.19thioredoxin reductase 1 [Source:MGI Symbol;Acc:MGI... [more]
Txnrd10.000e+061.61thioredoxin reductase 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Thioredoxin glutathione reductase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86VQ6|TRXR3_HUMAN0.000e+056.76Thioredoxin reductase 3 OS=Homo sapiens OX=9606 GN... [more]
sp|Q99MD6|TRXR3_MOUSE0.000e+058.42Thioredoxin reductase 3 OS=Mus musculus OX=10090 G... [more]
sp|Q16881|TRXR1_HUMAN0.000e+057.19Thioredoxin reductase 1, cytoplasmic OS=Homo sapie... [more]
sp|Q5NVA2|TRXR1_PONAB0.000e+062.99Thioredoxin reductase 1, cytoplasmic OS=Pongo abel... [more]
sp|O62768|TRXR1_BOVIN0.000e+062.99Thioredoxin reductase 1, cytoplasmic OS=Bos taurus... [more]
back to top
BLAST of Thioredoxin glutathione reductase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068AVN20.000e+081.25Thioredoxin glutathione reductase OS=Dugesia japon... [more]
A0A210PSR90.000e+063.80Thioredoxin reductase 3 OS=Mizuhopecten yessoensis... [more]
A0A0P4VXF70.000e+060.80Glutaredoxin domain-containing protein OS=Scylla o... [more]
A0A2P2HXB30.000e+060.57Thioredoxin reductase 1, cytoplasmic-like OS=Hiron... [more]
A0A5C6N1Z10.000e+059.83Thioredoxin reductase 3 OS=Takifugu flavidus OX=43... [more]
back to top
BLAST of Thioredoxin glutathione reductase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
txnrd30.000e+056.50thioredoxin reductase 1, cytoplasmic [Source:NCBI ... [more]
txnrd30.000e+060.33thioredoxin reductase 1, cytoplasmic [Source:NCBI ... [more]
ENSAMXT00000055472.10.000e+057.14pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
txnrd2.25.375e-15149.18thioredoxin reductase 2 [Source:NCBI gene;Acc:1030... [more]
txnrd2.25.375e-15149.18thioredoxin reductase 2 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Thioredoxin glutathione reductase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
txnrd30.000e+056.93thioredoxin reductase 3 [Source:ZFIN;Acc:ZDB-GENE-... [more]
dldh1.300e-4628.80dihydrolipoamide dehydrogenase [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Thioredoxin glutathione reductase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GLR18.530e-8235.07Cytosolic and mitochondrial glutathione oxidoreduc... [more]
LPD12.004e-4227.59Dihydrolipoamide dehydrogenase; the lipoamide dehy... [more]
IRC151.912e-2522.92Microtubule associated protein; regulates microtub... [more]
GRX18.186e-1334.83Glutathione-dependent disulfide oxidoreductase; hy... [more]
GRX22.248e-1233.68Cytoplasmic glutaredoxin; thioltransferase, glutat... [more]
back to top
BLAST of Thioredoxin glutathione reductase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO382280.000e+061.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465533.604e-14447.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434955.914e-9336.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465541.692e-5454.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496595.881e-5231.53Dihydrolipoyl dehydrogenase [Source:UniProtKB/TrE... [more]
back to top
BLAST of Thioredoxin glutathione reductase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
txnrd30.000e+057.10thioredoxin reductase 1, cytoplasmic [Source:NCBI ... [more]
txnrd30.000e+057.41thioredoxin reductase 1, cytoplasmic [Source:NCBI ... [more]
txnrd2.10.000e+052.56thioredoxin reductase 2 [Source:NCBI gene;Acc:1011... [more]
txnrd2.11.260e-15647.44thioredoxin reductase 2 [Source:NCBI gene;Acc:1011... [more]
gsr7.343e-8035.46glutathione-disulfide reductase [Source:NCBI gene;... [more]
back to top
BLAST of Thioredoxin glutathione reductase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020047.10.000e+099.83SMESG000020047.1[more]
SMESG000063651.17.913e-16251.00SMESG000063651.1[more]
SMESG000069912.11.027e-8134.25SMESG000069912.1[more]
SMESG000047749.13.528e-4028.80SMESG000047749.1[more]
SMESG000007272.14.594e-933.33SMESG000007272.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025313 ID=SMED30025313|Name=Thioredoxin glutathione reductase|organism=Schmidtea mediterranea sexual|type=transcript|length=2160bp
CAGATTGTTTAAATATATAAAATAATTAAAGATACATCTGTGGTATTCCT
TTATATATCCAAATTTAGTGCATTTGTATTATTATAACAAATGCCACCTA
TATCTACAGCGTTGGAAGAATGGATTAGAAAGATTATCAATTCATCAGTT
TTGATTATCTTTAGCAAAACTACATGTCCATTTTGCTATAAAATAAAAAA
ATCATTGAAAGACGCTAATATTAAATATGCTGCTGTTGAAATAAATCTTT
TGGCCACCGGATCAGAGATACAAGATATCCTATATCTCATTACTAACCAG
AGAACAGTTCCCAACGTATTTGTCCGTGGAACTCATATCGGAGGATGTGA
CGATGCTCATAAGGCGCTTGCCGAGGGAAGGATCCAGAAACTGTTGGATG
AACGGCAATATGAATATGATCTGGTAGTGATTGGTGGGGGCTCGGGTGGA
CTGGCCGCCTCCAAGGAAGCTGCAAATTTTGGAGCCAAAGTAGCAGTTTT
GGATTTTGTTAAACCAACACCGCAGGGTACAACCTGGGGTCTAGGAGGAA
CTTGTGTCAATGTAGGCTGCATTCCCAAAAAATTAATGCATCAATCAGCA
TTACTAAAACATTCGTGTGAGGATGCTCGATCATACGGCTGGAATGTGCC
AGAAACAGTGGAACATAGTTGGGACAATATGGTGGAAGAAATACAAAACC
ATATTCAATCACTCAATTGGGGATACAGAACATCATTGAGAAATAAAGGC
GTGGATTATATTAATGCGTATGGAGCATTTATCGATGAACATACAATTAA
AACAACGGATAAATATAATAATGAAAGGATAATCACTTCAAATAACTTTA
TAATTGCTACCGGAGAACGACCGAGATATCCAAATATACCCGGAGATAAA
GAATATGGAATTACGAGTGATGATTTGTTTTCCTTGTCTTATTGTCCTGG
TAAAACCCTTGTGATTGGTGCTAGTTACGTAGCATTGGAATGCGCTGGTT
TTCTAGCGAGTCTTGGCCTGAAAGTAACTGTTATGGTCCGTTCAATCTTT
CTTCGAGGTTTCGATCAACAAATGGCCAATAAAATCGGAAAGTATATGGA
GGAACATGGTGTTGATTTCATCACAGAGTGTGTGCCAACAAAGATAATAC
CAATGGAGGAAGGCAGTCCAGGAAAGAAAGAAGTATTCGGTTGTTATATA
AAAGACAAAACCGAATACAAAGATTGGTTTAACACAGTGCTATTTGCTAT
AGGCAGAGATCCGTGCACTGATAGAATTGGACTTGAGAATGTGAAAATCG
ATTTGGACAAAAATGGGAGGGTGATTGTTAACGAAGAAGAACAATCAACG
GTTTCGAATATCTACGCAATCGGAGATATAATTTCCCGGGGGTTACAATT
GACTCCAGTGGCTATTCAAGCGGGTAAAAATCTCTCGAGAAGATTATTTG
GTGGCGAACATATTCTGACGGATTATGTGAATGTTCCGACAACAGTTTTC
ACTCCATTGGAATACGGTAGTATCGGATTAGCTGAGGAGGACGCGATCGG
GAAATACGGAAAAGAAAGCATTGAAGTGTTCCATCAGAATTTCAAGCCAT
TGGAATGGACTGTAGCACACAGGGGGGATAATGATTGCTATGGGAAACTG
ATCTGCAACAAATCCGATAATATGCGTGTAGTTGGCTTCCACGTTCTCAG
TCCGAATGCTGGGGAAATCACCCAAGGTTACGCAATTGCTATGAGAATGG
GAGCGACGAAACGAGATTTCGATGACACGATTGGAATTCATCCGACATGT
TCTGAGACATTCACAACATTGAACATCACCAAGGCATCCGGTGCTGATCC
TGCACAATCTGGTTGCTGAGGTTAATTTCCGATTATATCGATTCCTCAAG
GCATTTCCGAGCTGATCGGGAAGCTTTGCTGTCGAGTCTATAATCGGAAT
ATCGGAAACAATATATATGATTTGTGTGTGTGTGTGCTTGCACTTCGTGT
GTGCTTTGATCGATTGTGCATTTGTAGCCTTCAGATACTCTCTCAATGAT
AGCTATTCAGATAAATTCCGCTGGAACTCTGTTTGGTTTGATGTGGTTTC
TTAGTTACTGTTACACATTCAACTTTATATAATATAGATTATTTTTAAAA
AAAAAGATCG
back to top

protein sequence of SMED30025313-orf-1

>SMED30025313-orf-1 ID=SMED30025313-orf-1|Name=SMED30025313-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=593bp
MPPISTALEEWIRKIINSSVLIIFSKTTCPFCYKIKKSLKDANIKYAAVE
INLLATGSEIQDILYLITNQRTVPNVFVRGTHIGGCDDAHKALAEGRIQK
LLDERQYEYDLVVIGGGSGGLAASKEAANFGAKVAVLDFVKPTPQGTTWG
LGGTCVNVGCIPKKLMHQSALLKHSCEDARSYGWNVPETVEHSWDNMVEE
IQNHIQSLNWGYRTSLRNKGVDYINAYGAFIDEHTIKTTDKYNNERIITS
NNFIIATGERPRYPNIPGDKEYGITSDDLFSLSYCPGKTLVIGASYVALE
CAGFLASLGLKVTVMVRSIFLRGFDQQMANKIGKYMEEHGVDFITECVPT
KIIPMEEGSPGKKEVFGCYIKDKTEYKDWFNTVLFAIGRDPCTDRIGLEN
VKIDLDKNGRVIVNEEEQSTVSNIYAIGDIISRGLQLTPVAIQAGKNLSR
RLFGGEHILTDYVNVPTTVFTPLEYGSIGLAEEDAIGKYGKESIEVFHQN
FKPLEWTVAHRGDNDCYGKLICNKSDNMRVVGFHVLSPNAGEITQGYAIA
MRMGATKRDFDDTIGIHPTCSETFTTLNITKASGADPAQSGC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0016491oxidoreductase activity
GO:0009055electron carrier activity
GO:0015035protein disulfide oxidoreductase activity
GO:0016668oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor
GO:0050660flavin adenine dinucleotide binding
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0004791thioredoxin-disulfide reductase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: biological process
TermDefinition
GO:0022900electron transport chain
GO:0055114oxidation-reduction process
GO:0045454cell redox homeostasis
GO:0098869cellular oxidant detoxification
Vocabulary: INTERPRO
TermDefinition
IPR006338Thioredoxin/glutathione_Rdtase
IPR036188FAD/NAD-bd_sf
IPR011899Glutaredoxin_euk/vir
IPR001100Pyr_nuc-diS_OxRdtase
IPR036249Thioredoxin-like_sf
IPR023753FAD/NAD-binding_dom
IPR002109Glutaredoxin
IPR004099Pyr_nucl-diS_OxRdtase_dimer
IPR012336Thioredoxin-like_fold
IPR012999Pyr_OxRdtase_I_AS
IPR016156FAD/NAD-linked_Rdtase_dimer_sf
IPR019774Aromatic-AA_hydroxylase_C
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00411PNDRDTASEIcoord: 424..431
score: 66.54
coord: 530..545
score: 38.66
coord: 552..572
score: 40.57
coord: 151..166
score: 72.49
coord: 110..132
score: 49.83
coord: 253..262
score: 51.18
coord: 381..395
score: 41.24
coord: 461..482
score: 39.44
coord: 288..313
score: 41.48
NoneNo IPR availablePRINTSPR00368FADPNRcoord: 250..268
score: 35.35
coord: 380..396
score: 34.09
coord: 288..306
score: 33.27
coord: 409..431
score: 33.05
coord: 111..130
score: 40.92
NoneNo IPR availablePANTHERPTHR43256FAMILY NOT NAMEDcoord: 37..592
NoneNo IPR availablePANTHERPTHR43256:SF7THIOREDOXIN REDUCTASE 3coord: 37..592
NoneNo IPR availableCDDcd03419GRX_GRXh_1_2_likecoord: 22..101
e-value: 1.12248E-32
score: 118.411
IPR006338Thioredoxin/glutathione reductase selenoproteinTIGRFAMTIGR01438TIGR01438coord: 107..592
e-value: 1.0E-218
score: 725.1
IPR023753FAD/NAD(P)-binding domainPFAMPF07992Pyr_redox_2coord: 109..445
e-value: 9.5E-60
score: 202.3
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 270..395
e-value: 1.3E-125
score: 421.2
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 112..447
e-value: 1.3E-125
score: 421.2
IPR036188FAD/NAD(P)-binding domain superfamilySUPERFAMILYSSF51905FAD/NAD(P)-binding domaincoord: 105..452
IPR016156FAD/NAD-linked reductase, dimerisation domain superfamilyGENE3DG3DSA:3.30.390.30coord: 464..592
e-value: 1.2E-57
score: 195.5
IPR016156FAD/NAD-linked reductase, dimerisation domain superfamilySUPERFAMILYSSF55424FAD/NAD-linked reductases, dimerisation (C-terminal) domaincoord: 462..587
IPR002109GlutaredoxinPFAMPF00462Glutaredoxincoord: 22..83
e-value: 8.3E-15
score: 54.8
IPR002109GlutaredoxinPROSITEPS51354GLUTAREDOXIN_2coord: 9..109
score: 20.927
IPR011899Glutaredoxin, eukaryotic/virialTIGRFAMTIGR02180TIGR02180coord: 22..101
e-value: 5.2E-27
score: 91.9
IPR001100Pyridine nucleotide-disulphide oxidoreductase, class IPIRSFPIRSF000350Hg-II_reductase_MerAcoord: 19..580
e-value: 6.1E-67
score: 224.1
IPR004099Pyridine nucleotide-disulphide oxidoreductase, dimerisation domainPFAMPF02852Pyr_redox_dimcoord: 465..576
e-value: 1.0E-29
score: 103.0
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 5..111
e-value: 7.2E-30
score: 105.0
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 9..104
IPR012999Pyridine nucleotide-disulphide oxidoreductase, class I, active sitePROSITEPS00076PYRIDINE_REDOX_1coord: 152..162