Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2

Overview
NameGlutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
Smed IDSMED30025303
Length (bp)2227
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 (SMED30025303) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 (SMED30025303) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 (SMED30025303) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 (SMED30025303) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025303

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025303SMESG000073848.1 Contig2859uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025303SMESG000073848.1 Contig2859newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025303SMESG000073848.1 Contig5140uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025303SMESG000073848.1 Contig5140newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025303SMESG000069640.1 Contig5140uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025303SMESG000069640.1 Contig5140newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30025303SMESG000073848.1 dd_Smed_v4_7522_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025303SMESG000073848.1 dd_Smed_v4_7522_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025303SMESG000073848.1 dd_Smed_v4_7522_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025303SMESG000073848.1 dd_Smed_v4_7522_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30025303SMESG000073848.1 dd_Smed_v4_7522_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025303SMESG000073848.1 dd_Smed_v4_7522_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025303SMESG000073848.1 Contig31397uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025303SMESG000073848.1 Contig31397newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30025303SMESG000073848.1 dd_Smed_v4_7522_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Human
Match: GFPT2 (glutamine-fructose-6-phosphate transaminase 2 [Source:HGNC Symbol;Acc:HGNC:4242])

HSP 1 Score: 506.908 bits (1304), Expect = 0.000e+0
Identity = 251/405 (61.98%), Postives = 308/405 (76.05%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-----IALFRNKGKVFSL-EELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNF----------ITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAY+NY  P TR +I E LI GL+RLEYRGYDSAGVA D N N E     I L + +GKV +L EEL K    D+   E ETH GIAHTRWATHG+PS  NSHP RSD+ NEF+VIHNGIITNY+ +++ L  KG++FE++TDTE I KL+K  +DNR  E+++F  LVE VI +LEG+FALVFKS H+PGE VATRRGSPLL+G+RS + L+T+ IPI+Y               + R DS   LH VG +K VE+FFASDASAI+EHTN+VI+LEDDD+AA+ DG L +HR+ R A+D   R + TL+MEL+QIMKGNF  FM+KEI++QPESV NTMRGRVNFET  ++LGGL +HL  IRRCRRL+ IGCGTSYH+A+ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGN-NHEVKERHIQLVKKRGKVKALDEELYKQDSMDL-KVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVVIHNGIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAFALVFKSVHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTCTLENVKNICKTRMKRLDSSACLHAVG-DKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSASDDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDHLKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELA 402          

HSP 2 Score: 362.844 bits (930), Expect = 0.000e+0
Identity = 165/261 (63.22%), Postives = 213/261 (81.61%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTL+AL+YC+ RGAL VG+TN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQF+SLVM  L++SEDR  ++ RR+EI+ GL  LP LIKEVL  E  + ++A EL  +RS+L+MGRGYNYATCLEGALK+KE+ Y+HSEGI++GELKHGPLAL+D  M +IM++ KD  F K  NA+ +V AR+G+PI + + +  +  K+    + +P TVDCLQG+LSVIPLQ+LS++LA L+G+D+D PRNLAKSVTVE
Sbjct:  422 SQSGETADTLLALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLEEKIHDLALELYTQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCFAKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHLAVLRGYDVDFPRNLAKSVTVE 682          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Human
Match: GFPT1 (glutamine--fructose-6-phosphate transaminase 1 [Source:HGNC Symbol;Acc:HGNC:4241])

HSP 1 Score: 504.982 bits (1299), Expect = 0.000e+0
Identity = 251/403 (62.28%), Postives = 305/403 (75.68%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-------IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY------SGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY  P TR +I+E LI GL+RLEYRGYDSAGV FD   + +       I L + KGKV +L+E V  Q +D+D D E + H GIAHTRWATHG PS  NSHP RSD+NNEFIVIHNGIITNY+ +K+ L  KG+ FE++TDTE I KL+K  YDNR  ++ SF  LVE VI +LEG+FALVFKS HFPG+ V TRRGSPLL+G+RS H L+TDHIPI+Y       G   ++R DS T L PV   K VEY+FASDASA++EHTN+VI+LEDDDVAA+ DG L +HR+ R A D   R V TL+MEL+QIMKGNF  FM+KEI++QPESV+NTMRGRVNF+   + LGGL +H+  I+RCRRL+ I CGTSYH+ +ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGFDGGNDKDWEANACKIQLIKKKGKVKALDEEVHKQ-QDMDLDIEFDVHLGIAHTRWATHGEPSPVNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNRESQDTSFTTLVERVIQQLEGAFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLSTDHIPILYRTGKDKKGSCNLSRVDSTTCLFPV-EEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELA 401          

HSP 2 Score: 354.369 bits (908), Expect = 0.000e+0
Identity = 165/261 (63.22%), Postives = 215/261 (82.38%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLM L+YC++RGAL VGITN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQFVSLVM AL++ +DR  M+ RR+EI+ GL  LP LIKEVL  +  ++ +A EL +++S+LIMGRGY+YATCLEGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IMI+ +D  + K  NA+ +V+AR+G+P+ I   E  + +K  +  + VP +VDCLQG+LSVIPLQ+L+++LA L+G+D+D PRNLAKSVTVE
Sbjct:  421 SQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE 681          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Human
Match: GFPT1 (glutamine--fructose-6-phosphate transaminase 1 [Source:HGNC Symbol;Acc:HGNC:4241])

HSP 1 Score: 497.664 bits (1280), Expect = 0.000e+0
Identity = 251/421 (59.62%), Postives = 305/421 (72.45%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-------IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY------------------------SGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY  P TR +I+E LI GL+RLEYRGYDSAGV FD   + +       I L + KGKV +L+E V  Q +D+D D E + H GIAHTRWATHG PS  NSHP RSD+NNEFIVIHNGIITNY+ +K+ L  KG+ FE++TDTE I KL+K  YDNR  ++ SF  LVE VI +LEG+FALVFKS HFPG+ V TRRGSPLL+G+RS H L+TDHIPI+Y                         G   ++R DS T L PV   K VEY+FASDASA++EHTN+VI+LEDDDVAA+ DG L +HR+ R A D   R V TL+MEL+QIMKGNF  FM+KEI++QPESV+NTMRGRVNF+   + LGGL +H+  I+RCRRL+ I CGTSYH+ +ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGFDGGNDKDWEANACKIQLIKKKGKVKALDEEVHKQ-QDMDLDIEFDVHLGIAHTRWATHGEPSPVNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNRESQDTSFTTLVERVIQQLEGAFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLSTDHIPILYRTARTQIGSKFTRWGSQGERGKDKKGSCNLSRVDSTTCLFPV-EEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELA 419          

HSP 2 Score: 354.369 bits (908), Expect = 0.000e+0
Identity = 165/261 (63.22%), Postives = 215/261 (82.38%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLM L+YC++RGAL VGITN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQFVSLVM AL++ +DR  M+ RR+EI+ GL  LP LIKEVL  +  ++ +A EL +++S+LIMGRGY+YATCLEGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IMI+ +D  + K  NA+ +V+AR+G+P+ I   E  + +K  +  + VP +VDCLQG+LSVIPLQ+L+++LA L+G+D+D PRNLAKSVTVE
Sbjct:  439 SQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE 699          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Human
Match: GFPT2 (glutamine-fructose-6-phosphate transaminase 2 [Source:HGNC Symbol;Acc:HGNC:4242])

HSP 1 Score: 234.187 bits (596), Expect = 1.022e-71
Identity = 114/203 (56.16%), Postives = 151/203 (74.38%), Query Frame = 3
Query:  384 NEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNF----------ITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMEL 962
            +EF+VIHNGIITNY+ +++ L  KG++FE++TDTE I KL+K  +DNR  E+++F  LVE VI +LEG+FALVFKS H+PGE VATRRGSPLL+G+RS + L+T+ IPI+Y               + R DS   LH VG +K VE+FFASDASAI+EHTN+VI+LEDDD+AA+ DG L +HR+ R A+D   R + TL+MEL
Sbjct:   15 SEFVVIHNGIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAFALVFKSVHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTCTLENVKNICKTRMKRLDSSACLHAVG-DKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSASDDPSRAIQTLQMEL 216          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Human
Match: PPAT (phosphoribosyl pyrophosphate amidotransferase [Source:HGNC Symbol;Acc:HGNC:9238])

HSP 1 Score: 62.3882 bits (150), Expect = 2.097e-9
Identity = 44/183 (24.04%), Postives = 86/183 (46.99%), Query Frame = 3
Query:   63 CGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRN-KGKVFSLEELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDE-NNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVF 605
            CG+F  +      T+  +  ++  GL  L++RG +SAG+         +  F++ KG         +D LK +      ++ GI HTR+AT G    +N  P   +  + +  V HNG + N   +++ L+R G    T +D+E+I +L+        D+   +   ++ ++ E   +++L+ 
Sbjct:   12 CGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDG--SSVPTFKSHKGMGLVNHVFTEDNLKKL----YVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPTAYSLLI 188          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Celegans
Match: gfat-2 (Glutamine-Fructose 6-phosphate AminoTransferase homolog [Source:UniProtKB/TrEMBL;Acc:Q19699])

HSP 1 Score: 447.973 bits (1151), Expect = 0.000e+0
Identity = 226/440 (51.36%), Postives = 312/440 (70.91%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFD-----KNINGEIALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGD---------------NFITRYDSMTEL-----HPVGSNK----------------QVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGA-TDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            MCGIFAYLN++ P  R +I++IL+ GL+R+EYRGYDSAG+A D     +N + +IAL R +GKV  L + +K+  + ++ D E   H GIAHTRWATHG P + NSHP RS++NNEF+V+HNGIITNY+ IKE L +KG KFE++TDTEVI KL +  +D   D   SFRQLVE VI +LEG+FAL FKS+ FPG++VA+RRGSPLLVGI+S+ +L T H P+ YS                 +F+   +++ +L     +P GS K                +VEYF ASDA+AI+EHT +V++LEDDDVA ++DG L +HR++R A +  Q R+V  L +E+++IMKG++  FM+KEI++QPESV+NTMRGRV   + +++LGGL E+L AI+RCRRL+ + CGTSYHSA+A R ++EEL+ELPV+VELA +   ++T
Sbjct:    1 MCGIFAYLNFLAPKKRSEIVDILVQGLQRMEYRGYDSAGIAIDGSNDIENPHSKIALLRKRGKVSVLNDYIKENNEKLNMDMEYNIHCGIAHTRWATHGSPRDVNSHPHRSNDNNEFLVVHNGIITNYREIKEYLEKKGHKFESETDTEVIAKLTQHVHDRYPD--FSFRQLVETVIQQLEGAFALAFKSSRFPGQLVASRRGSPLLVGIKSNSTLHTSHFPVSYSKGRCFMSNNATHLREETSFVETPNNILDLSIAVRNPSGSAKLPDNNSTTRPFDSTDFEVEYFIASDAAAIIEHTKQVLFLEDDDVAFVEDGSLTIHRISRHADSGEQKREVQLLELEIQEIMKGSYKTFMQKEIFEQPESVVNTMRGRV-LPSGQVVLGGLKEYLPAIKRCRRLIMVACGTSYHSAIACRQVLEELSELPVVVELASDFLDRET 437          

HSP 2 Score: 333.183 bits (853), Expect = 0.000e+0
Identity = 159/262 (60.69%), Postives = 211/262 (80.53%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVK-DLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC+ RGAL +G+TN VGS+I R+S CG+HINAGPEIGVASTKAYTSQ VSL++ AL +SEDR     RR EI++ L+ LP LI++VL  +  V  IAE++  ++S+LIMGRG N+ATCLEGALK+KEL+Y+H EGIMSGELKHGPLA+VD+ + I M+V  D ++ KS+NA+ +V+ARKG PI I  + + + DL  ++  + VP+TVDC+Q +L+VIPLQ+LSY++A+L G ++D PRNLAKSVTVE
Sbjct:  449 SQSGETADTLMALRYCKPRGALTIGVTNTVGSSIGRESHCGIHINAGPEIGVASTKAYTSQIVSLLLFALTISEDRISKMKRRAEIIDALNNLPILIRDVLDLDDQVLKIAEQIYKDKSLLIMGRGLNFATCLEGALKIKELSYMHCEGIMSGELKHGPLAMVDEFLSICMVVCNDHVYKKSLNALQQVVARKGAPIIIADSSVPESDLAGMKHVLRVPRTVDCVQNILTVIPLQLLSYHIAELNGANVDRPRNLAKSVTVE 710          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Celegans
Match: gfat-2 (Glutamine-Fructose 6-phosphate AminoTransferase homolog [Source:UniProtKB/TrEMBL;Acc:Q19699])

HSP 1 Score: 447.973 bits (1151), Expect = 0.000e+0
Identity = 226/440 (51.36%), Postives = 312/440 (70.91%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFD-----KNINGEIALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGD---------------NFITRYDSMTEL-----HPVGSNK----------------QVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGA-TDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            MCGIFAYLN++ P  R +I++IL+ GL+R+EYRGYDSAG+A D     +N + +IAL R +GKV  L + +K+  + ++ D E   H GIAHTRWATHG P + NSHP RS++NNEF+V+HNGIITNY+ IKE L +KG KFE++TDTEVI KL +  +D   D   SFRQLVE VI +LEG+FAL FKS+ FPG++VA+RRGSPLLVGI+S+ +L T H P+ YS                 +F+   +++ +L     +P GS K                +VEYF ASDA+AI+EHT +V++LEDDDVA ++DG L +HR++R A +  Q R+V  L +E+++IMKG++  FM+KEI++QPESV+NTMRGRV   + +++LGGL E+L AI+RCRRL+ + CGTSYHSA+A R ++EEL+ELPV+VELA +   ++T
Sbjct:    1 MCGIFAYLNFLAPKKRSEIVDILVQGLQRMEYRGYDSAGIAIDGSNDIENPHSKIALLRKRGKVSVLNDYIKENNEKLNMDMEYNIHCGIAHTRWATHGSPRDVNSHPHRSNDNNEFLVVHNGIITNYREIKEYLEKKGHKFESETDTEVIAKLTQHVHDRYPD--FSFRQLVETVIQQLEGAFALAFKSSRFPGQLVASRRGSPLLVGIKSNSTLHTSHFPVSYSKGRCFMSNNATHLREETSFVETPNNILDLSIAVRNPSGSAKLPDNNSTTRPFDSTDFEVEYFIASDAAAIIEHTKQVLFLEDDDVAFVEDGSLTIHRISRHADSGEQKREVQLLELEIQEIMKGSYKTFMQKEIFEQPESVVNTMRGRV-LPSGQVVLGGLKEYLPAIKRCRRLIMVACGTSYHSAIACRQVLEELSELPVVVELASDFLDRET 437          

HSP 2 Score: 333.183 bits (853), Expect = 0.000e+0
Identity = 159/262 (60.69%), Postives = 211/262 (80.53%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVK-DLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC+ RGAL +G+TN VGS+I R+S CG+HINAGPEIGVASTKAYTSQ VSL++ AL +SEDR     RR EI++ L+ LP LI++VL  +  V  IAE++  ++S+LIMGRG N+ATCLEGALK+KEL+Y+H EGIMSGELKHGPLA+VD+ + I M+V  D ++ KS+NA+ +V+ARKG PI I  + + + DL  ++  + VP+TVDC+Q +L+VIPLQ+LSY++A+L G ++D PRNLAKSVTVE
Sbjct:  449 SQSGETADTLMALRYCKPRGALTIGVTNTVGSSIGRESHCGIHINAGPEIGVASTKAYTSQIVSLLLFALTISEDRISKMKRRAEIIDALNNLPILIRDVLDLDDQVLKIAEQIYKDKSLLIMGRGLNFATCLEGALKIKELSYMHCEGIMSGELKHGPLAMVDEFLSICMVVCNDHVYKKSLNALQQVVARKGAPIIIADSSVPESDLAGMKHVLRVPRTVDCVQNILTVIPLQLLSYHIAELNGANVDRPRNLAKSVTVE 710          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Celegans
Match: gfat-1 (Glutamine-Fructose 6-phosphate AminoTransferase homolog [Source:UniProtKB/TrEMBL;Acc:Q95QM8])

HSP 1 Score: 446.817 bits (1148), Expect = 0.000e+0
Identity = 225/442 (50.90%), Postives = 308/442 (69.68%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFD-----KNINGEIALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYS-GDNFITRY------------------------------------DSMTELHPVGSNK-QVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDS-QFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            MCGIFAYLN++TP  R +I++IL+ GL+R+EYRGYDSAG+A D     ++ +  +AL R  GKV  L + +K+   D+D D E   H GIAHTRWATHG P + NSHP RS++ NEF+V+HNGIITNY+ IKE L +KG KFE++TDTEVI KL +  +D   D   SFRQLVE VI +LEG+FAL FKS+ FPG++VA+RRGSPLLVGI+S+  L T+H P+ +S G  F++ +                                    DS T + P  S+  +VEYF ASDA+AI+EHT +V++LEDDDVA ++DG L +HR++R A +  Q R+V  L MEL++IMKG+F  +M+KEI++QP+SV+NTMRGRV   + +++LGG+ E+L  I+RCRRL+ + CGTSYHSA+A R ++EEL+ELPV+VELA +   ++T
Sbjct:    1 MCGIFAYLNFLTPKKRSEIVDILVQGLQRMEYRGYDSAGIAIDGSNEIESPHSSVALLRKAGKVSVLSDFIKESSSDLDMDMEYNIHCGIAHTRWATHGSPRDVNSHPHRSNDKNEFLVVHNGIITNYREIKEYLEKKGHKFESETDTEVIAKLAQHIHDRYPD--FSFRQLVETVIQQLEGAFALAFKSSRFPGQLVASRRGSPLLVGIKSNSRLQTNHFPVSFSKGRRFMSNHATHLRDETSFVETPNNILDLSIAVRSSNGSAKMEISDSTTAVRPFDSDDWEVEYFVASDAAAIIEHTKQVLFLEDDDVAFVEDGALTIHRISRHADNGEQKREVKLLEMELQEIMKGSFKTYMQKEIFEQPDSVVNTMRGRV-LPSGQVVLGGIKEYLPDIKRCRRLIMVACGTSYHSAIACRQILEELSELPVVVELASDFLDRET 439          

HSP 2 Score: 339.732 bits (870), Expect = 0.000e+0
Identity = 161/262 (61.45%), Postives = 215/262 (82.06%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVK-DLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTL+AL+YC+ RGAL +G+TN VGS+I R+S CG+HINAGPEIGVASTKAYTSQ +SL+M AL LS+DR  M  RREEI++ L+ LP LI+EVL+ +  V +IA+++  E+S+LIMGRG N+ATCLEGALK+KEL+Y+H EGIMSGELKHGPLA+VD+ + I M+V  D+++ KS+NA+ +V+ARKG PI I    + + DL  ++  + VP+TVDC+Q +L+VIPLQ+LSY++A+L G ++D PRNLAKSVTVE
Sbjct:  451 SQSGETADTLLALRYCKPRGALTIGVTNTVGSSICRESHCGIHINAGPEIGVASTKAYTSQILSLLMFALTLSDDRISMAKRREEIIDALNDLPELIREVLQLDEKVLDIAKQIYKEKSLLIMGRGLNFATCLEGALKIKELSYMHCEGIMSGELKHGPLAMVDEFLSICMVVCNDRVYKKSLNALQQVVARKGAPIIIADCTVPEGDLAGMKHILRVPKTVDCVQNILTVIPLQLLSYHIAELNGANVDRPRNLAKSVTVE 712          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Celegans
Match: gfat-1 (Glutamine-Fructose 6-phosphate AminoTransferase homolog [Source:UniProtKB/TrEMBL;Acc:Q95QM8])

HSP 1 Score: 446.817 bits (1148), Expect = 0.000e+0
Identity = 225/442 (50.90%), Postives = 308/442 (69.68%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFD-----KNINGEIALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYS-GDNFITRY------------------------------------DSMTELHPVGSNK-QVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDS-QFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            MCGIFAYLN++TP  R +I++IL+ GL+R+EYRGYDSAG+A D     ++ +  +AL R  GKV  L + +K+   D+D D E   H GIAHTRWATHG P + NSHP RS++ NEF+V+HNGIITNY+ IKE L +KG KFE++TDTEVI KL +  +D   D   SFRQLVE VI +LEG+FAL FKS+ FPG++VA+RRGSPLLVGI+S+  L T+H P+ +S G  F++ +                                    DS T + P  S+  +VEYF ASDA+AI+EHT +V++LEDDDVA ++DG L +HR++R A +  Q R+V  L MEL++IMKG+F  +M+KEI++QP+SV+NTMRGRV   + +++LGG+ E+L  I+RCRRL+ + CGTSYHSA+A R ++EEL+ELPV+VELA +   ++T
Sbjct:    1 MCGIFAYLNFLTPKKRSEIVDILVQGLQRMEYRGYDSAGIAIDGSNEIESPHSSVALLRKAGKVSVLSDFIKESSSDLDMDMEYNIHCGIAHTRWATHGSPRDVNSHPHRSNDKNEFLVVHNGIITNYREIKEYLEKKGHKFESETDTEVIAKLAQHIHDRYPD--FSFRQLVETVIQQLEGAFALAFKSSRFPGQLVASRRGSPLLVGIKSNSRLQTNHFPVSFSKGRRFMSNHATHLRDETSFVETPNNILDLSIAVRSSNGSAKMEISDSTTAVRPFDSDDWEVEYFVASDAAAIIEHTKQVLFLEDDDVAFVEDGALTIHRISRHADNGEQKREVKLLEMELQEIMKGSFKTYMQKEIFEQPDSVVNTMRGRV-LPSGQVVLGGIKEYLPDIKRCRRLIMVACGTSYHSAIACRQILEELSELPVVVELASDFLDRET 439          

HSP 2 Score: 339.732 bits (870), Expect = 0.000e+0
Identity = 161/262 (61.45%), Postives = 215/262 (82.06%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVK-DLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTL+AL+YC+ RGAL +G+TN VGS+I R+S CG+HINAGPEIGVASTKAYTSQ +SL+M AL LS+DR  M  RREEI++ L+ LP LI+EVL+ +  V +IA+++  E+S+LIMGRG N+ATCLEGALK+KEL+Y+H EGIMSGELKHGPLA+VD+ + I M+V  D+++ KS+NA+ +V+ARKG PI I    + + DL  ++  + VP+TVDC+Q +L+VIPLQ+LSY++A+L G ++D PRNLAKSVTVE
Sbjct:  451 SQSGETADTLLALRYCKPRGALTIGVTNTVGSSICRESHCGIHINAGPEIGVASTKAYTSQILSLLMFALTLSDDRISMAKRREEIIDALNDLPELIREVLQLDEKVLDIAKQIYKEKSLLIMGRGLNFATCLEGALKIKELSYMHCEGIMSGELKHGPLAMVDEFLSICMVVCNDRVYKKSLNALQQVVARKGAPIIIADCTVPEGDLAGMKHILRVPKTVDCVQNILTVIPLQLLSYHIAELNGANVDRPRNLAKSVTVE 712          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Celegans
Match: gfat-1 (Glutamine-Fructose 6-phosphate AminoTransferase homolog [Source:UniProtKB/TrEMBL;Acc:Q95QM8])

HSP 1 Score: 446.817 bits (1148), Expect = 0.000e+0
Identity = 225/442 (50.90%), Postives = 308/442 (69.68%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFD-----KNINGEIALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYS-GDNFITRY------------------------------------DSMTELHPVGSNK-QVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDS-QFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            MCGIFAYLN++TP  R +I++IL+ GL+R+EYRGYDSAG+A D     ++ +  +AL R  GKV  L + +K+   D+D D E   H GIAHTRWATHG P + NSHP RS++ NEF+V+HNGIITNY+ IKE L +KG KFE++TDTEVI KL +  +D   D   SFRQLVE VI +LEG+FAL FKS+ FPG++VA+RRGSPLLVGI+S+  L T+H P+ +S G  F++ +                                    DS T + P  S+  +VEYF ASDA+AI+EHT +V++LEDDDVA ++DG L +HR++R A +  Q R+V  L MEL++IMKG+F  +M+KEI++QP+SV+NTMRGRV   + +++LGG+ E+L  I+RCRRL+ + CGTSYHSA+A R ++EEL+ELPV+VELA +   ++T
Sbjct:    1 MCGIFAYLNFLTPKKRSEIVDILVQGLQRMEYRGYDSAGIAIDGSNEIESPHSSVALLRKAGKVSVLSDFIKESSSDLDMDMEYNIHCGIAHTRWATHGSPRDVNSHPHRSNDKNEFLVVHNGIITNYREIKEYLEKKGHKFESETDTEVIAKLAQHIHDRYPD--FSFRQLVETVIQQLEGAFALAFKSSRFPGQLVASRRGSPLLVGIKSNSRLQTNHFPVSFSKGRRFMSNHATHLRDETSFVETPNNILDLSIAVRSSNGSAKMEISDSTTAVRPFDSDDWEVEYFVASDAAAIIEHTKQVLFLEDDDVAFVEDGALTIHRISRHADNGEQKREVKLLEMELQEIMKGSFKTYMQKEIFEQPDSVVNTMRGRV-LPSGQVVLGGIKEYLPDIKRCRRLIMVACGTSYHSAIACRQILEELSELPVVVELASDFLDRET 439          

HSP 2 Score: 339.732 bits (870), Expect = 0.000e+0
Identity = 161/262 (61.45%), Postives = 215/262 (82.06%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVK-DLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTL+AL+YC+ RGAL +G+TN VGS+I R+S CG+HINAGPEIGVASTKAYTSQ +SL+M AL LS+DR  M  RREEI++ L+ LP LI+EVL+ +  V +IA+++  E+S+LIMGRG N+ATCLEGALK+KEL+Y+H EGIMSGELKHGPLA+VD+ + I M+V  D+++ KS+NA+ +V+ARKG PI I    + + DL  ++  + VP+TVDC+Q +L+VIPLQ+LSY++A+L G ++D PRNLAKSVTVE
Sbjct:  451 SQSGETADTLLALRYCKPRGALTIGVTNTVGSSICRESHCGIHINAGPEIGVASTKAYTSQILSLLMFALTLSDDRISMAKRREEIIDALNDLPELIREVLQLDEKVLDIAKQIYKEKSLLIMGRGLNFATCLEGALKIKELSYMHCEGIMSGELKHGPLAMVDEFLSICMVVCNDRVYKKSLNALQQVVARKGAPIIIADCTVPEGDLAGMKHILRVPKTVDCVQNILTVIPLQLLSYHIAELNGANVDRPRNLAKSVTVE 712          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Fly
Match: Gfat1 (gene:FBgn0027341 transcript:FBtr0113692)

HSP 1 Score: 489.189 bits (1258), Expect = 0.000e+0
Identity = 230/404 (56.93%), Postives = 302/404 (74.75%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDE-IETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGD------NFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            MCGIFAYLNY+TP +R +++++L+ GLKRLEYRGYDS GVA D   N  I + +  GKV  LEE +++     +  E + TH GIAHTRWATHG+P EKNSHP RSD+ N F+V+HNGIITNY  +K  L ++G++FE+DTDTEV  KL+   +  +T    SFR+LVE  I ++EG+FA+  KS +FPGE VA+RR SPLLVGI++   L TDHIPI+Y  D        + R +S +E  P+   K+VEYFFASDASA++EHTN+VIYLEDDDVAA++DG L +HRL +   D   R++ TL+ME++QIMKGN+D FM+KEI++QP+SV+NTMRGRV F+   I+LGG+ +++  I+RCRRLM IGCGTSYHSA+ATR L+EELTELPVMVELA +   + T
Sbjct:    1 MCGIFAYLNYLTPKSRQEVLDLLVTGLKRLEYRGYDSTGVAIDSPDNKNIVMVKRTGKVKVLEEAIQEHFSGREYSEPVLTHVGIAHTRWATHGVPCEKNSHPHRSDDENGFVVVHNGIITNYNDVKTFLSKRGYEFESDTDTEVFAKLVHHLW--KTHPTYSFRELVEQAILQVEGAFAIAVKSKYFPGECVASRRSSPLLVGIKTKTRLATDHIPILYGKDADSGKPQVLPRSESTSEFMPL-EEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKSLDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFDGNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVMVELASDFLDRNT 401          

HSP 2 Score: 358.221 bits (918), Expect = 0.000e+0
Identity = 170/261 (65.13%), Postives = 214/261 (81.99%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC++RGALIVGITN VGS+I R+S CGVHINAGPEIGVASTKAYTSQF+SLVM ALV+SEDR  ++ RR EI+  L  L   I++VL+ +S VK +A++L   +S+LIMGRGYN+ATCLEGALKVKEL Y+HSEGIM+GELKHGPLALVDD M ++MIV +D ++ K MNA+ +V +RKG PI I      +   +   H+ +P+TVDCLQG+L+VIP+Q+LSY++A L+G D+DCPRNLAKSVTVE
Sbjct:  413 SQSGETADTLMALRYCKQRGALIVGITNTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRLSLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGYNFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDPVYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGILTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE 673          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Fly
Match: Gfat1 (gene:FBgn0027341 transcript:FBtr0302849)

HSP 1 Score: 489.189 bits (1258), Expect = 0.000e+0
Identity = 229/398 (57.54%), Postives = 301/398 (75.63%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDE-IETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            MCGIFAYLNY+TP +R +++++L+ GLKRLEYRGYDS GVA D   N  I + +  GKV  LEE +++     +  E + TH GIAHTRWATHG+P EKNSHP RSD+ N F+V+HNGIITNY  +K  L ++G++FE+DTDTEV  KL+   +  +T    SFR+LVE  I ++EG+FA+  KS +FPGE VA+RR SPLLVGI++   L TDHIPI+Y     + R +S +E  P+   K+VEYFFASDASA++EHTN+VIYLEDDDVAA++DG L +HRL +   D   R++ TL+ME++QIMKGN+D FM+KEI++QP+SV+NTMRGRV F+   I+LGG+ +++  I+RCRRLM IGCGTSYHSA+ATR L+EELTELPVMVELA +   + T
Sbjct:    1 MCGIFAYLNYLTPKSRQEVLDLLVTGLKRLEYRGYDSTGVAIDSPDNKNIVMVKRTGKVKVLEEAIQEHFSGREYSEPVLTHVGIAHTRWATHGVPCEKNSHPHRSDDENGFVVVHNGIITNYNDVKTFLSKRGYEFESDTDTEVFAKLVHHLW--KTHPTYSFRELVEQAILQVEGAFAIAVKSKYFPGECVASRRSSPLLVGIKTKTRLATDHIPILYG--KVLPRSESTSEFMPL-EEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKSLDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFDGNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVMVELASDFLDRNT 393          

HSP 2 Score: 357.836 bits (917), Expect = 0.000e+0
Identity = 170/261 (65.13%), Postives = 214/261 (81.99%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC++RGALIVGITN VGS+I R+S CGVHINAGPEIGVASTKAYTSQF+SLVM ALV+SEDR  ++ RR EI+  L  L   I++VL+ +S VK +A++L   +S+LIMGRGYN+ATCLEGALKVKEL Y+HSEGIM+GELKHGPLALVDD M ++MIV +D ++ K MNA+ +V +RKG PI I      +   +   H+ +P+TVDCLQG+L+VIP+Q+LSY++A L+G D+DCPRNLAKSVTVE
Sbjct:  405 SQSGETADTLMALRYCKQRGALIVGITNTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRLSLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGYNFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDPVYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGILTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE 665          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Fly
Match: Gfat2 (gene:FBgn0039580 transcript:FBtr0085297)

HSP 1 Score: 487.649 bits (1254), Expect = 0.000e+0
Identity = 234/406 (57.64%), Postives = 304/406 (74.88%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE---IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDN------------FITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQ-DGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY+TP +R +++++L+ GLKRLEYRGYDS G+A D   +GE   I L +  GKV  LE+ V +  +  D    I+TH GIAHTRWATHG+PSE NSHP RSDE+N F+V+HNGIITNY+ +K +L ++G+ FE+DTDTEVI KL+   +        +F +LVE  I +LEG+FA+ FKS HFPGE VA+RRGSPLLVGI++   L TDHIPI+Y+  +             +   D   E  P+   K+VEYFFASDASA++EHTN+VIYLEDDDVAA++ DG L +HRLN+ + D   R++ITL+ME++QIMKGN+D FM KEI++QPESV+NTMRGR+ F+T+ ++LGG+ E++  I+RCRRLM I CGTSYHSA+ATR L+EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYLTPKSRQEVLDLLLQGLKRLEYRGYDSTGIAIDALNSGEAQSIMLVKRTGKVKVLEDAVAEVCRGQDYSLPIDTHIGIAHTRWATHGVPSEVNSHPQRSDEDNSFVVVHNGIITNYKDVKTLLEKRGYVFESDTDTEVIAKLVHHLWQQHP--GYTFGELVEQAIQQLEGAFAIAFKSKHFPGECVASRRGSPLLVGIKAKTKLATDHIPILYAKAHRPHGQPQQQAYQLLPPGDCNAEFQPL-ERKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVKSDGTLSIHRLNKSSDDPHAREIITLKMEIQQIMKGNYDYFMLKEIFEQPESVVNTMRGRMRFDTQTVVLGGIKEYIPEIKRCRRLMLIACGTSYHSAVATRQLLEELTELPVMVELA 403          

HSP 2 Score: 358.607 bits (919), Expect = 0.000e+0
Identity = 170/261 (65.13%), Postives = 215/261 (82.38%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC++RGALIVG+TN VGS+I R+S CGVHINAGPEIGVASTKAYTSQF+SLVM ALV+SEDR  ++ RR EI++GL  L   I+ VLK  S V+ +A+EL   +S+LIMGRG+N+ATCLEGALKVKEL Y+HSEGI++GELKHGPLALVD  M ++MIV +D ++TK MNA+ +V +RKG+PI I      + + +    + +P+TVDCLQGVL+VIPLQ+LSY++A L+G D+DCPRNLAKSVTVE
Sbjct:  423 SQSGETADTLMALRYCKQRGALIVGVTNTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRLSLQQRRLEIIDGLSQLDEHIRTVLKLNSQVQQLAKELYEHKSLLIMGRGFNFATCLEGALKVKELTYMHSEGILAGELKHGPLALVDKEMPVLMIVLRDPVYTKCMNALQQVTSRKGRPILICEEGDNETMSFSTRSLQIPRTVDCLQGVLTVIPLQLLSYHIAVLRGCDVDCPRNLAKSVTVE 683          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Fly
Match: Gfat1 (gene:FBgn0027341 transcript:FBtr0302848)

HSP 1 Score: 486.493 bits (1251), Expect = 0.000e+0
Identity = 230/413 (55.69%), Postives = 303/413 (73.37%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDE-IETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDN---------------FITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            MCGIFAYLNY+TP +R +++++L+ GLKRLEYRGYDS GVA D   N  I + +  GKV  LEE +++     +  E + TH GIAHTRWATHG+P EKNSHP RSD+ N F+V+HNGIITNY  +K  L ++G++FE+DTDTEV  KL+   +  +T    SFR+LVE  I ++EG+FA+  KS +FPGE VA+RR SPLLVGI++   L TDHIPI+Y  D+                + R +S +E  P+   K+VEYFFASDASA++EHTN+VIYLEDDDVAA++DG L +HRL +   D   R++ TL+ME++QIMKGN+D FM+KEI++QP+SV+NTMRGRV F+   I+LGG+ +++  I+RCRRLM IGCGTSYHSA+ATR L+EELTELPVMVELA +   + T
Sbjct:    1 MCGIFAYLNYLTPKSRQEVLDLLVTGLKRLEYRGYDSTGVAIDSPDNKNIVMVKRTGKVKVLEEAIQEHFSGREYSEPVLTHVGIAHTRWATHGVPCEKNSHPHRSDDENGFVVVHNGIITNYNDVKTFLSKRGYEFESDTDTEVFAKLVHHLW--KTHPTYSFRELVEQAILQVEGAFAIAVKSKYFPGECVASRRSSPLLVGIKTKTRLATDHIPILYGKDDKKLCTDQDADSGKPQVLPRSESTSEFMPL-EEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKSLDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFDGNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVMVELASDFLDRNT 410          

HSP 2 Score: 358.221 bits (918), Expect = 0.000e+0
Identity = 170/261 (65.13%), Postives = 214/261 (81.99%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC++RGALIVGITN VGS+I R+S CGVHINAGPEIGVASTKAYTSQF+SLVM ALV+SEDR  ++ RR EI+  L  L   I++VL+ +S VK +A++L   +S+LIMGRGYN+ATCLEGALKVKEL Y+HSEGIM+GELKHGPLALVDD M ++MIV +D ++ K MNA+ +V +RKG PI I      +   +   H+ +P+TVDCLQG+L+VIP+Q+LSY++A L+G D+DCPRNLAKSVTVE
Sbjct:  422 SQSGETADTLMALRYCKQRGALIVGITNTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRLSLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGYNFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDPVYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGILTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE 682          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Fly
Match: Gfat1 (gene:FBgn0027341 transcript:FBtr0113694)

HSP 1 Score: 484.182 bits (1245), Expect = 0.000e+0
Identity = 230/416 (55.29%), Postives = 302/416 (72.60%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDE-IETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDN------------------FITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            MCGIFAYLNY+TP +R +++++L+ GLKRLEYRGYDS GVA D   N  I + +  GKV  LEE +++     +  E + TH GIAHTRWATHG+P EKNSHP RSD+ N F+V+HNGIITNY  +K  L ++G++FE+DTDTEV  KL+   +  +T    SFR+LVE  I ++EG+FA+  KS +FPGE VA+RR SPLLVGI++   L TDHIPI+Y  D                    + R +S +E  P+   K+VEYFFASDASA++EHTN+VIYLEDDDVAA++DG L +HRL +   D   R++ TL+ME++QIMKGN+D FM+KEI++QP+SV+NTMRGRV F+   I+LGG+ +++  I+RCRRLM IGCGTSYHSA+ATR L+EELTELPVMVELA +   + T
Sbjct:    1 MCGIFAYLNYLTPKSRQEVLDLLVTGLKRLEYRGYDSTGVAIDSPDNKNIVMVKRTGKVKVLEEAIQEHFSGREYSEPVLTHVGIAHTRWATHGVPCEKNSHPHRSDDENGFVVVHNGIITNYNDVKTFLSKRGYEFESDTDTEVFAKLVHHLW--KTHPTYSFRELVEQAILQVEGAFAIAVKSKYFPGECVASRRSSPLLVGIKTKTRLATDHIPILYGKDADSGKPQDIRPHGQSRELPVLPRSESTSEFMPL-EEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKSLDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFDGNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVMVELASDFLDRNT 413          

HSP 2 Score: 357.836 bits (917), Expect = 0.000e+0
Identity = 170/261 (65.13%), Postives = 214/261 (81.99%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC++RGALIVGITN VGS+I R+S CGVHINAGPEIGVASTKAYTSQF+SLVM ALV+SEDR  ++ RR EI+  L  L   I++VL+ +S VK +A++L   +S+LIMGRGYN+ATCLEGALKVKEL Y+HSEGIM+GELKHGPLALVDD M ++MIV +D ++ K MNA+ +V +RKG PI I      +   +   H+ +P+TVDCLQG+L+VIP+Q+LSY++A L+G D+DCPRNLAKSVTVE
Sbjct:  425 SQSGETADTLMALRYCKQRGALIVGITNTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRLSLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGYNFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDPVYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGILTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE 685          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Zebrafish
Match: gfpt1 (glutamine--fructose-6-phosphate transaminase 1 [Source:ZFIN;Acc:ZDB-GENE-070423-1])

HSP 1 Score: 496.123 bits (1276), Expect = 0.000e+0
Identity = 244/404 (60.40%), Postives = 304/404 (75.25%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-------IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY--SGD-----NFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY  P TR +I+E+LI GL+RLEYRGYDSAGV  D   + +       I L +  GKV +L+E ++ Q +DID D E + H GIAHTRWATHG+PS  NSHP RSD+ NEFIVIHNGIITNY+ +K+ L  K ++FE++TDTE I KL+K  YDNR   +++F  LVE V  +LEG+FALVFKS HFPG+ V +RRG PLL+G+RS H L+TDHIPI+Y  SG      N + R D  T L PV   K VEY+FASDASA++EHTN+VI+LEDDD+AA+ DG L +HR+ R A D   R + TL+MEL+QIMKGNF  FM+KEI++QPESV+NTMRGRVNFE   +ILGGL +H+  I+RCRRL+ I CGTSYH+ +ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYHVPHTRREILEVLIKGLRRLEYRGYDSAGVGIDGGNSKDWESNSKCIHLIKQTGKVQALDEEIQRQ-QDIDLDVEFDVHLGIAHTRWATHGVPSPVNSHPQRSDKTNEFIVIHNGIITNYKDLKKFLESKNYEFESETDTETIAKLVKYMYDNRESNDITFATLVEQVTQQLEGAFALVFKSVHFPGQAVGSRRGGPLLIGVRSDHRLSTDHIPILYRSSGKDKKTCNTLPRMDEDTCLFPV-DEKAVEYYFASDASAVIEHTNRVIFLEDDDIAAVSDGRLSIHRIKRTAGDHPARAIQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFENNTVILGGLKDHIKEIQRCRRLIMIACGTSYHAGVATRQVLEELTELPVMVELA 402          

HSP 2 Score: 357.836 bits (917), Expect = 0.000e+0
Identity = 166/261 (63.60%), Postives = 216/261 (82.76%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTL+AL+YC++RGAL VGITN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQFV+LVM AL++ +DR  ++ RR+EI+ GL +LP LIKEVL  +  ++ +A EL  ++S+LIMGRGY+YATCLEGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IMI+ +D  +TK  NA+ +V+AR+G+PI I   E  + +   +  + VP  VDCLQG+LSVIPLQ+LS++LA L+G+D+DCPRNLAKSVTVE
Sbjct:  422 SQSGETADTLLALRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVALVMFALLMCDDRISVQPRRKEIIQGLRILPDLIKEVLTLDEEIQKLAAELYPQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYTKCQNALQQVVARQGRPIVICDKEDNETINNSKRTIKVPHCVDCLQGILSVIPLQLLSFHLAVLRGYDVDCPRNLAKSVTVE 682          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Zebrafish
Match: gfpt2 (glutamine-fructose-6-phosphate transaminase 2 [Source:ZFIN;Acc:ZDB-GENE-071113-1])

HSP 1 Score: 489.574 bits (1259), Expect = 0.000e+0
Identity = 240/402 (59.70%), Postives = 302/402 (75.12%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFD---KNINGEIALFRNKGKVFSL-EELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGD---------NFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY  P  R  I E L+ GL+RLEYRGYDSAG+A D   K+   +I L++  GKV +L EE+ K+   D++  E++TH GIAHTRWATHG PS  NSHP RSD+NNEF+VIHNGIITNY+ +K+ L  KG++FE+DTDTEVIPKL+K  YDNR ++ +SF  LVE VI +LEG+FALVFKS +FPGE VATRRGSPLL+GIRS + L+T+ IP+ Y+           N      S   LH +     VE++FASDASAI+EHTNKVIY+EDDDVA + +G L++HR+ R A +   R + TL+MEL+QIMKGNF  FM+KEI++QPESV NTMRGR+ FE   + LGGL++HL  I+RCRRL+ IGCGTSYH+ +ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYRVPRKRRDIFETLVKGLQRLEYRGYDSAGIAVDGPVKDDEAKICLYKKTGKVKALNEEIYKNDSIDLEA-ELDTHFGIAHTRWATHGEPSPLNSHPHRSDKNNEFVVIHNGIITNYKELKKYLGSKGYEFESDTDTEVIPKLIKYLYDNRENDYVSFSTLVERVIKQLEGAFALVFKSINFPGEAVATRRGSPLLIGIRSQYELSTEQIPVQYNCSDSRRDEQEKNLHNGVGSSNALHSIDDRLAVEFYFASDASAIIEHTNKVIYVEDDDVAVVMEGKLYVHRVKRAAGEDPVRVIQTLQMELQQIMKGNFKAFMQKEIFEQPESVYNTMRGRIFFEKNTVFLGGLTDHLKEIKRCRRLIMIGCGTSYHAGVATRQILEELTELPVMVELA 401          

HSP 2 Score: 363.999 bits (933), Expect = 0.000e+0
Identity = 168/261 (64.37%), Postives = 217/261 (83.14%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC+KRGAL VGITN VGS+I R++ CGVHINAGPE+GVASTKAYTSQFVSL+M  L++ EDR  +K RR+EI++GL+ LP LIK+VL  +  +K IAEEL ++RS+L+MGRG+NYATCLEGALK+KE+ Y+HSEGI++GELKHGPLAL+D HM +IMI+ +D  + K  NA+ +V AR+G+PI I   +  +  K     + +PQTVDCLQG+LSVIPLQ++S++LA L+G+D+DCPRNLAKSVTVE
Sbjct:  421 SQSGETADTLMALRYCKKRGALTVGITNTVGSSICRETDCGVHINAGPEVGVASTKAYTSQFVSLIMFGLMMCEDRLSLKPRRKEIISGLNQLPELIKKVLAQDDNIKTIAEELHHQRSLLVMGRGFNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKHMPVIMIIMRDACYQKCHNALQQVTARQGRPIIICCQDDPEISKMAYKTIELPQTVDCLQGILSVIPLQLISFHLAVLRGYDVDCPRNLAKSVTVE 681          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Zebrafish
Match: gfpt1 (glutamine--fructose-6-phosphate transaminase 1 [Source:ZFIN;Acc:ZDB-GENE-070423-1])

HSP 1 Score: 124.405 bits (311), Expect = 3.096e-33
Identity = 64/112 (57.14%), Postives = 78/112 (69.64%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-------IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLR 371
            MCGIFAYLNY  P TR +I+E+LI GL+RLEYRGYDSAGV  D   + +       I L +  GKV +L+E ++ Q +DID D E + H GIAHTRWATHG+PS  NSHP R
Sbjct:    1 MCGIFAYLNYHVPHTRREILEVLIKGLRRLEYRGYDSAGVGIDGGNSKDWESNSKCIHLIKQTGKVQALDEEIQRQ-QDIDLDVEFDVHLGIAHTRWATHGVPSPVNSHPQR 111          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Zebrafish
Match: ppat (phosphoribosyl pyrophosphate amidotransferase [Source:ZFIN;Acc:ZDB-GENE-041210-323])

HSP 1 Score: 69.707 bits (169), Expect = 5.776e-12
Identity = 49/185 (26.49%), Postives = 91/185 (49.19%), Query Frame = 3
Query:   63 CGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-IALFRNKGKV---FSLEELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDE-NNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALV 602
            CG+F  +      T+ ++ +IL  GL  L++RG +SAG+      N    +  +  G V   F  E+L+K +  ++         GI HTR++T GI    N  P   D  + +  V HNG + N  A+++ ++R G    T +D+E+I +L+         +N  +   ++ +++E   S++L+
Sbjct:   12 CGVFGCVAAGEWPTQLEVAQILTLGLVALQHRGQESAGIVTSTGTNPPTFSTLKGMGLVNTAFKPEDLLKLRYGNL---------GIGHTRYSTTGISELHNCQPFVVDTLHGKIAVAHNGELVNASALRKKVMRHGVGLSTCSDSELITQLLALTPPMEELDNPDWVARIKNLMTETPTSYSLL 187          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Xenopus
Match: gfpt2 (glutamine-fructose-6-phosphate transaminase 2 [Source:NCBI gene;Acc:550089])

HSP 1 Score: 514.612 bits (1324), Expect = 0.000e+0
Identity = 249/400 (62.25%), Postives = 311/400 (77.75%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSL-EELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY-----SGDNFIT-----RYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY  P TR +I+E LI GL+RLEYRGYDSAGVA D  I   I L + KGKV +L EEL K +  D+  DE ETH GIAHTRWATHG+P+  NSHP RSD++NEF+VIHNGIITNY+ +++ L  KG+ FE++TDTEVIPKL+K  YDNR +E++ F  LVE VI +LEGSFALVFKS H PGE VATRRGSPLL+G+RS + L+T+ IP++Y     + DN        R DS T L+P+G+ K VEYFFASDASAI+EHTN+V++LEDDDVA + +G L +HR+ R   D   R + TL+MEL+QIMKGNF  FM+KEI++QPESV+NTMRGR+N+ET  ++LGGL +H+   +RCRRL+ IGCGTSYH+A+ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYCVPRTRKEIMETLIKGLQRLEYRGYDSAGVAVD--IEKHIRLIKKKGKVKALDEELHKQEETDL-KDEFETHFGIAHTRWATHGVPNAVNSHPQRSDKDNEFVVIHNGIITNYKDLRKFLESKGYDFESETDTEVIPKLLKYVYDNRENEDIRFSTLVERVIQQLEGSFALVFKSIHHPGEAVATRRGSPLLIGVRSKYRLSTEQIPVLYRTCSNNTDNRTNMPRTKRIDSSTCLYPMGNEKSVEYFFASDASAIIEHTNRVVFLEDDDVAYVAEGKLSIHRIKRSMGDESSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVVNTMRGRINYETNTVLLGGLQDHMKEFKRCRRLILIGCGTSYHAAVATRQVLEELTELPVMVELA 397          

HSP 2 Score: 363.614 bits (932), Expect = 0.000e+0
Identity = 166/261 (63.60%), Postives = 215/261 (82.38%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC++RGAL  G+TN VGS+ISRD+ CGVHINAGPEIGVASTKAYTSQFV+LVM  L++SEDR  M+ RR EI+  L  LP +IK+VL  +  +++IA EL N+RS+L+MGRGYNYATCLEGALK+KE+ Y+HSEGI++GELKHGPLAL+D  M +IMI+ KD  FTK  NA+ +++AR+G+PI + + +  +  K     + +PQTVDC+QG+LSVIPLQ+LS++LA L+G+D+D PRNLAKSVTVE
Sbjct:  417 SQSGETADTLMALRYCKERGALTCGVTNTVGSSISRDTDCGVHINAGPEIGVASTKAYTSQFVALVMFGLMMSEDRISMQERRMEIIKSLKSLPRMIKDVLALDEQIQDIAHELYNQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMIIMKDPCFTKCQNALQQIVARQGRPIILCSKDDAESKKLAYKTIELPQTVDCMQGILSVIPLQLLSFHLAVLRGYDVDFPRNLAKSVTVE 677          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Xenopus
Match: gfpt2 (glutamine-fructose-6-phosphate transaminase 2 [Source:NCBI gene;Acc:550089])

HSP 1 Score: 508.834 bits (1309), Expect = 0.000e+0
Identity = 244/405 (60.25%), Postives = 312/405 (77.04%), Query Frame = 3
Query:   15 ITNYSLLFLYLNFIIMCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSL-EELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            +  +++ +     + +  IFAYLNY  P TR +I+E LI GL+RLEYRGYDSAGVA D  I   I L + KGKV +L EEL K +  D+  DE ETH GIAHTRWATHG+P+  NSHP RSD++NEF+VIHNGIITNY+ +++ L  KG+ FE++TDTEVIPKL+K  YDNR +E++ F  LVE VI +LEGSFALVFKS H PGE VATRRGSPLL+G+RS + L+T+ IP++Y       R DS T L+P+G+ K VEYFFASDASAI+EHTN+V++LEDDDVA + +G L +HR+ R   D   R + TL+MEL+QIMKGNF  FM+KEI++QPESV+NTMRGR+N+ET  ++LGGL +H+   +RCRRL+ IGCGTSYH+A+ATR ++EELTELPVMVELA
Sbjct:    1 MAQFTIDYAVCKQLCLIRIFAYLNYCVPRTRKEIMETLIKGLQRLEYRGYDSAGVAVD--IEKHIRLIKKKGKVKALDEELHKQEETDL-KDEFETHFGIAHTRWATHGVPNAVNSHPQRSDKDNEFVVIHNGIITNYKDLRKFLESKGYDFESETDTEVIPKLLKYVYDNRENEDIRFSTLVERVIQQLEGSFALVFKSIHHPGEAVATRRGSPLLIGVRSKYRLSTEQIPVLYRTCK-TKRIDSSTCLYPMGNEKSVEYFFASDASAIIEHTNRVVFLEDDDVAYVAEGKLSIHRIKRSMGDESSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVVNTMRGRINYETNTVLLGGLQDHMKEFKRCRRLILIGCGTSYHAAVATRQVLEELTELPVMVELA 401          

HSP 2 Score: 340.887 bits (873), Expect = 0.000e+0
Identity = 154/248 (62.10%), Postives = 203/248 (81.85%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDI 1969
            +QSGETADTLMAL+YC++RGAL  G+TN VGS+ISRD+ CGVHINAGPEIGVASTKAYTSQFV+LVM  L++SEDR  M+ RR EI+  L  LP +IK+VL  +  +++IA EL N+RS+L+MGRGYNYATCLEGALK+KE+ Y+HSEGI++GELKHGPLAL+D  M +IMI+ KD  FTK  NA+ +++AR+G+PI + + +  +  K     + +PQTVDC+QG+LSVIPLQ+LS++LA L+G+D+
Sbjct:  421 SQSGETADTLMALRYCKERGALTCGVTNTVGSSISRDTDCGVHINAGPEIGVASTKAYTSQFVALVMFGLMMSEDRISMQERRMEIIKSLKSLPRMIKDVLALDEQIQDIAHELYNQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMIIMKDPCFTKCQNALQQIVARQGRPIILCSKDDAESKKLAYKTIELPQTVDCMQGILSVIPLQLLSFHLAVLRGYDV 668          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Xenopus
Match: gfpt2 (glutamine-fructose-6-phosphate transaminase 2 [Source:NCBI gene;Acc:550089])

HSP 1 Score: 507.294 bits (1305), Expect = 0.000e+0
Identity = 242/414 (58.45%), Postives = 311/414 (75.12%), Query Frame = 3
Query:   15 ITNYSLLFLYLNFIIMCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYS----------GDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            +  +++ +     + +  IFAYLNY  P TR +I+E LI GL+RLEYRGYDSAGVA D  I   I L + KGKV +L+E +  Q +    DE ETH GIAHTRWATHG+P+  NSHP RSD++NEF+VIHNGIITNY+ +++ L  KG+ FE++TDTEVIPKL+K  YDNR +E++ F  LVE VI +LEGSFALVFKS H PGE VATRRGSPLL+G+RS + L+T+ IP++Y            D    R DS T L+P+G+ K VEYFFASDASAI+EHTN+V++LEDDDVA + +G L +HR+ R   D   R + TL+MEL+QIMKGNF  FM+KEI++QPESV+NTMRGR+N+ET  ++LGGL +H+   +RCRRL+ IGCGTSYH+A+ATR ++EELTELPVMVELA
Sbjct:    1 MAQFTIDYAVCKQLCLIRIFAYLNYCVPRTRKEIMETLIKGLQRLEYRGYDSAGVAVD--IEKHIRLIKKKGKVKALDEELHKQEETDLKDEFETHFGIAHTRWATHGVPNAVNSHPQRSDKDNEFVVIHNGIITNYKDLRKFLESKGYDFESETDTEVIPKLLKYVYDNRENEDIRFSTLVERVIQQLEGSFALVFKSIHHPGEAVATRRGSPLLIGVRSKYRLSTEQIPVLYRTCKMLGTKGIPDKGTKRIDSSTCLYPMGNEKSVEYFFASDASAIIEHTNRVVFLEDDDVAYVAEGKLSIHRIKRSMGDESSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVVNTMRGRINYETNTVLLGGLQDHMKEFKRCRRLILIGCGTSYHAAVATRQVLEELTELPVMVELA 412          

HSP 2 Score: 340.887 bits (873), Expect = 0.000e+0
Identity = 154/248 (62.10%), Postives = 203/248 (81.85%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDI 1969
            +QSGETADTLMAL+YC++RGAL  G+TN VGS+ISRD+ CGVHINAGPEIGVASTKAYTSQFV+LVM  L++SEDR  M+ RR EI+  L  LP +IK+VL  +  +++IA EL N+RS+L+MGRGYNYATCLEGALK+KE+ Y+HSEGI++GELKHGPLAL+D  M +IMI+ KD  FTK  NA+ +++AR+G+PI + + +  +  K     + +PQTVDC+QG+LSVIPLQ+LS++LA L+G+D+
Sbjct:  432 SQSGETADTLMALRYCKERGALTCGVTNTVGSSISRDTDCGVHINAGPEIGVASTKAYTSQFVALVMFGLMMSEDRISMQERRMEIIKSLKSLPRMIKDVLALDEQIQDIAHELYNQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMIIMKDPCFTKCQNALQQIVARQGRPIILCSKDDAESKKLAYKTIELPQTVDCMQGILSVIPLQLLSFHLAVLRGYDV 679          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Xenopus
Match: GFPT1 (glutamine--fructose-6-phosphate transaminase 1 [Source:NCBI gene;Acc:100485575])

HSP 1 Score: 501.13 bits (1289), Expect = 0.000e+0
Identity = 250/402 (62.19%), Postives = 307/402 (76.37%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFD----KNI--NGEIALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY------SGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            + GIFAYLNY  P TR +I+E LI GL+RLEYRGYDSAGV  D    KN   N +I L + KGKV +L+E + ++L+D+D D E E H GIAHTRWATHG PS  NSHP RSD+NNEFIVIHNGIITNY+ +K+ L  KG++FE++TDTE I KL+K  YDNR  + +SF  LVE VI +LEG+FALVFKS HFPG+ V TRRGSPLL+G+RS H L+TDHIPI+Y       G   + R DS T L PV   K VEY+FASDASA++EHTN+VI+LEDDDVAA+ DG L +HR+ R A D   R + TL+MEL+QIMKGNF  FM+KEI++QPESV+NTMRGRVNF+   + LGGL +H+  I+RCRRL+ I CGTSYH+ +ATR ++EELTELPVMVELA
Sbjct:    1 LIGIFAYLNYHVPRTRREILERLIRGLQRLEYRGYDSAGVGIDGGNEKNWENNNQIQLIKKKGKVKALDEEI-NKLEDMDLDIEFEVHLGIAHTRWATHGEPSPTNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKGYEFESETDTETIAKLVKYMYDNRESDEISFTTLVERVIQQLEGAFALVFKSVHFPGQAVGTRRGSPLLMGVRSEHKLSTDHIPILYRSGLDKKGSCSLPRLDSTTCLFPV-EEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRSAGDHPARAIQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDLTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQILEELTELPVMVELA 400          

HSP 2 Score: 336.65 bits (862), Expect = 0.000e+0
Identity = 153/248 (61.69%), Postives = 205/248 (82.66%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDI 1969
            +QSGETADTL+AL+YC++RGAL VG+TN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQFVSL+M AL++ +DR  M  RRE+I+NGL +LP  IKEVL  +  ++ +AEEL  ++S+LIMGRGY+YATC+EGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IMI+ +D  +TK  NA+ +V+AR+G+P+ I   E  + +  ++  + VP TVDCLQGVLSVIPLQ+L+++LA L+G+D+
Sbjct:  420 SQSGETADTLLALRYCKERGALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLIMFALMMCDDRISMLGRREQIINGLKILPDNIKEVLSLDDEIQKLAEELYQQKSVLIMGRGYHYATCMEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHAYTKCQNALQQVVARQGRPVVICDKEDTETINTIKRTIKVPHTVDCLQGVLSVIPLQLLAFHLAVLRGYDV 667          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Xenopus
Match: gfpt2 (glutamine-fructose-6-phosphate transaminase 2 [Source:NCBI gene;Acc:550089])

HSP 1 Score: 500.36 bits (1287), Expect = 0.000e+0
Identity = 246/420 (58.57%), Postives = 315/420 (75.00%), Query Frame = 3
Query:   15 ITNYSLLFLYLNFIIMCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSA-----GVAFDKNINGEIALFRNKGKVFSL-EELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY-----SGDNFIT-----RYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            +  +++ +     + +  IFAYLNY  P TR +I+E LI GL+RLEYRGYDSA     GVA D  I   I L + KGKV +L EEL K +  D+  DE ETH GIAHTRWATHG+P+  NSHP RSD++NEF+VIHNGIITNY+ +++ L  KG+ FE++TDTEVIPKL+K  YDNR +E++ F  LVE VI +LEGSFALVFKS H PGE VATRRGSPLL+G+RS + L+T+ IP++Y     + DN        R DS T L+P+G+ K VEYFFASDASAI+EHTN+V++LEDDDVA + +G L +HR+ R   D   R + TL+MEL+QIMKGNF  FM+KEI++QPESV+NTMRGR+N+ET  ++LGGL +H+   +RCRRL+ IGCGTSYH+A+ATR ++EELTELPVMVELA
Sbjct:    1 MAQFTIDYAVCKQLCLIRIFAYLNYCVPRTRKEIMETLIKGLQRLEYRGYDSAVLILTGVAVD--IEKHIRLIKKKGKVKALDEELHKQEETDL-KDEFETHFGIAHTRWATHGVPNAVNSHPQRSDKDNEFVVIHNGIITNYKDLRKFLESKGYDFESETDTEVIPKLLKYVYDNRENEDIRFSTLVERVIQQLEGSFALVFKSIHHPGEAVATRRGSPLLIGVRSKYRLSTEQIPVLYRTCSNNTDNRTNMPRTKRIDSSTCLYPMGNEKSVEYFFASDASAIIEHTNRVVFLEDDDVAYVAEGKLSIHRIKRSMGDESSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVVNTMRGRINYETNTVLLGGLQDHMKEFKRCRRLILIGCGTSYHAAVATRQVLEELTELPVMVELA 417          

HSP 2 Score: 340.887 bits (873), Expect = 0.000e+0
Identity = 154/248 (62.10%), Postives = 203/248 (81.85%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDI 1969
            +QSGETADTLMAL+YC++RGAL  G+TN VGS+ISRD+ CGVHINAGPEIGVASTKAYTSQFV+LVM  L++SEDR  M+ RR EI+  L  LP +IK+VL  +  +++IA EL N+RS+L+MGRGYNYATCLEGALK+KE+ Y+HSEGI++GELKHGPLAL+D  M +IMI+ KD  FTK  NA+ +++AR+G+PI + + +  +  K     + +PQTVDC+QG+LSVIPLQ+LS++LA L+G+D+
Sbjct:  437 SQSGETADTLMALRYCKERGALTCGVTNTVGSSISRDTDCGVHINAGPEIGVASTKAYTSQFVALVMFGLMMSEDRISMQERRMEIIKSLKSLPRMIKDVLALDEQIQDIAHELYNQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMIIMKDPCFTKCQNALQQIVARQGRPIILCSKDDAESKKLAYKTIELPQTVDCMQGILSVIPLQLLSFHLAVLRGYDV 684          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Mouse
Match: Gfpt2 (glutamine fructose-6-phosphate transaminase 2 [Source:MGI Symbol;Acc:MGI:1338883])

HSP 1 Score: 509.22 bits (1310), Expect = 0.000e+0
Identity = 251/405 (61.98%), Postives = 311/405 (76.79%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIA-----LFRNKGKVFSL-EELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNF----------ITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAY+NY  P TR +I E LI GL+RLEYRGYDSAGVA D N N E+      L + +GKV +L EEL K    D+   E ETH GIAHTRWATHG+P+  NSHP RSD++NEF+VIHNGIITNY+ +++ L  KG++FE++TDTE I KL+K  +DNR  E+++F  LVE VI +LEG+FALVFKS H+PGE VATRRGSPLL+G+RS + L+T+ IP++Y   N           + R DS T LH VG +K VE+FFASDASAI+EHTN+VI+LEDDD+AA+ DG L +HR+ R ATD   R + TL+MEL+QIMKGNF  FM+KEI++QPESV NTMRGRVNFET  ++LGGL +HL  IRRCRRL+ IGCGTSYH+A+ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYMNYRVPKTRKEIFETLIRGLQRLEYRGYDSAGVAIDGN-NHEVKERHIHLVKKRGKVKALDEELYKQDSMDL-KVEFETHFGIAHTRWATHGVPNAVNSHPQRSDKDNEFVVIHNGIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPVLYPTCNIENVKNICKTRMKRLDSSTCLHAVG-DKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSATDDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDHLKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELA 402          

HSP 2 Score: 361.688 bits (927), Expect = 0.000e+0
Identity = 166/261 (63.60%), Postives = 213/261 (81.61%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTL+AL+YC+ RGAL VGITN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQF+SLVM  L++SEDR  ++ RR+EI+ GL  LP LIKEVL  +  + ++A EL  +RS+L+MGRGYNYATCLEGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IM++ KD  F K  NA+ +V AR+G+PI + + +  +  K+    + +P TVDCLQG+LSVIPLQ+LS++LA L+G+D+D PRNLAKSVTVE
Sbjct:  422 SQSGETADTLLALRYCKDRGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLDEKIHDLALELYTQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKQMPVIMVIMKDPCFAKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHLAVLRGYDVDFPRNLAKSVTVE 682          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Mouse
Match: Gfpt1 (glutamine fructose-6-phosphate transaminase 1 [Source:MGI Symbol;Acc:MGI:95698])

HSP 1 Score: 498.819 bits (1283), Expect = 0.000e+0
Identity = 248/403 (61.54%), Postives = 304/403 (75.43%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-------IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY------SGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY  P TR +I+E LI GL+RLEYRGYDSAGV  D   + +       I L + KGKV +L+E V  Q +D+D D E + H GIAHTRWATHG P+  NSHP RSD+NNEFIVIHNGIITNY+ +K+ L  KG+ FE++TDTE I KL+K  YDN   +++SF  LVE VI +LEG+FALVFKS HFPG+ V TRRGSPLL+G+RS H L+TDHIPI+Y       G   ++R DS T L PV   K VEY+FASDASA++EHTN+VI+LEDDDVAA+ DG L +HR+ R A D   R V TL+MEL+QIMKGNF  FM+KEI++QPESV+NTMRGRVNF+   + LGGL +H+  I+RCRRL+ I CGTSYH+ +ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGLDGGNDKDWEANACKIQLIKKKGKVKALDEEVHKQ-QDMDLDIEFDVHLGIAHTRWATHGEPNPVNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNWESQDVSFTTLVERVIQQLEGAFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLSTDHIPILYRTGKDKKGSCGLSRVDSTTCLFPV-EEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELA 401          

HSP 2 Score: 354.369 bits (908), Expect = 0.000e+0
Identity = 165/261 (63.22%), Postives = 215/261 (82.38%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLM L+YC++RGAL VGITN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQFVSLVM AL++ +DR  M+ RR+EI+ GL  LP LIKEVL  +  ++ +A EL +++S+LIMGRGY+YATCLEGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IMI+ +D  + K  NA+ +V+AR+G+P+ I   E  + +K  +  + VP +VDCLQG+LSVIPLQ+L+++LA L+G+D+D PRNLAKSVTVE
Sbjct:  421 SQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE 681          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Mouse
Match: Gfpt1 (glutamine fructose-6-phosphate transaminase 1 [Source:MGI Symbol;Acc:MGI:95698])

HSP 1 Score: 493.041 bits (1268), Expect = 0.000e+0
Identity = 248/419 (59.19%), Postives = 304/419 (72.55%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-------IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY----------------------SGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY  P TR +I+E LI GL+RLEYRGYDSAGV  D   + +       I L + KGKV +L+E V  Q +D+D D E + H GIAHTRWATHG P+  NSHP RSD+NNEFIVIHNGIITNY+ +K+ L  KG+ FE++TDTE I KL+K  YDN   +++SF  LVE VI +LEG+FALVFKS HFPG+ V TRRGSPLL+G+RS H L+TDHIPI+Y                       G   ++R DS T L PV   K VEY+FASDASA++EHTN+VI+LEDDDVAA+ DG L +HR+ R A D   R V TL+MEL+QIMKGNF  FM+KEI++QPESV+NTMRGRVNF+   + LGGL +H+  I+RCRRL+ I CGTSYH+ +ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGLDGGNDKDWEANACKIQLIKKKGKVKALDEEVHKQ-QDMDLDIEFDVHLGIAHTRWATHGEPNPVNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNWESQDVSFTTLVERVIQQLEGAFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLSTDHIPILYRTARTQIGSTWWGSQAERGKDKKGSCGLSRVDSTTCLFPV-EEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELA 417          

HSP 2 Score: 355.14 bits (910), Expect = 0.000e+0
Identity = 165/261 (63.22%), Postives = 215/261 (82.38%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLM L+YC++RGAL VGITN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQFVSLVM AL++ +DR  M+ RR+EI+ GL  LP LIKEVL  +  ++ +A EL +++S+LIMGRGY+YATCLEGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IMI+ +D  + K  NA+ +V+AR+G+P+ I   E  + +K  +  + VP +VDCLQG+LSVIPLQ+L+++LA L+G+D+D PRNLAKSVTVE
Sbjct:  437 SQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE 697          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Mouse
Match: Gfpt1 (glutamine fructose-6-phosphate transaminase 1 [Source:MGI Symbol;Acc:MGI:95698])

HSP 1 Score: 129.413 bits (324), Expect = 8.436e-35
Identity = 68/117 (58.12%), Postives = 81/117 (69.23%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-------IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENN 386
            MCGIFAYLNY  P TR +I+E LI GL+RLEYRGYDSAGV  D   + +       I L + KGKV +L+E V  Q +D+D D E + H GIAHTRWATHG P+  NSHP RSD+NN
Sbjct:    1 MCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGLDGGNDKDWEANACKIQLIKKKGKVKALDEEVHKQ-QDMDLDIEFDVHLGIAHTRWATHGEPNPVNSHPQRSDKNN 116          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Mouse
Match: Gfpt1 (glutamine fructose-6-phosphate transaminase 1 [Source:MGI Symbol;Acc:MGI:95698])

HSP 1 Score: 67.781 bits (164), Expect = 2.275e-13
Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSA 173
            MCGIFAYLNY  P TR +I+E LI GL+RLEYRGYDSA
Sbjct:    1 MCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSA 38          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. UniProt/SwissProt
Match: sp|Q08DQ2|GFPT2_BOVIN (Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Bos taurus OX=9913 GN=GFPT2 PE=2 SV=1)

HSP 1 Score: 510.375 bits (1313), Expect = 0.000e+0
Identity = 251/404 (62.13%), Postives = 308/404 (76.24%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNIN----GEIALFRNKGKVFSL-EELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNF----------ITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAY+NY  P TR +I E LI GL+RLEYRGYDSAGVA D N N      I L + +G V +L EEL K    D+   E ETH GIAHTRWATHG+PS  NSHP RSD+ NEF+VIHNGIITNY+ +++ L  KG++FE++TDTE I KL+K  +DNR  E+++F  LVE VI +LEG+FALVFKS H+PGE VATRRGSPLL+G+RS + L+T+ IP++Y   N           + R DS T LH VG NK VE+FFASDASAI+EHTN+VI+LEDDD+AA+ DG L +HR+ R A+D   R + TL+MEL+QIMKGNF  FM+KEI++QPESV NTMRGRVNFET  ++LGGL +HL  IRRCRRL+ IGCGTSYH+A+ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNNEVKERHIQLVKKRGNVKALDEELYKQDSMDL-KVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVVIHNGIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPVLYRTRNIENVKNICKTRMKRLDSSTCLHAVG-NKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRLASDDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDHLKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELA 402          

HSP 2 Score: 357.451 bits (916), Expect = 0.000e+0
Identity = 163/261 (62.45%), Postives = 212/261 (81.23%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTL+AL+YC+ R AL VG+TN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQF+SLVM  L++SEDR  ++ RR EI++GL  LP LIKEVL  +  + ++A EL  +RS+L+MGRGYNYATCLEGALK+KE+ Y+HSEGI++GELKHGPLAL+D  M +IM++ KD  F K  NA+ +V AR+G+PI + + +  +  K+    + +P TVDCLQG+LSVIPLQ+LS++LA L+G+D+D PRNLAKSVTVE
Sbjct:  422 SQSGETADTLLALRYCKDRRALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFISLVMFGLMMSEDRISLQNRRREIIHGLKSLPELIKEVLSLDEKIHDLALELYTQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCFAKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHLAVLRGYDVDFPRNLAKSVTVE 682          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. UniProt/SwissProt
Match: sp|Q9Z2Z9|GFPT2_MOUSE (Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Mus musculus OX=10090 GN=Gfpt2 PE=1 SV=3)

HSP 1 Score: 509.22 bits (1310), Expect = 0.000e+0
Identity = 251/405 (61.98%), Postives = 311/405 (76.79%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIA-----LFRNKGKVFSL-EELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNF----------ITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAY+NY  P TR +I E LI GL+RLEYRGYDSAGVA D N N E+      L + +GKV +L EEL K    D+   E ETH GIAHTRWATHG+P+  NSHP RSD++NEF+VIHNGIITNY+ +++ L  KG++FE++TDTE I KL+K  +DNR  E+++F  LVE VI +LEG+FALVFKS H+PGE VATRRGSPLL+G+RS + L+T+ IP++Y   N           + R DS T LH VG +K VE+FFASDASAI+EHTN+VI+LEDDD+AA+ DG L +HR+ R ATD   R + TL+MEL+QIMKGNF  FM+KEI++QPESV NTMRGRVNFET  ++LGGL +HL  IRRCRRL+ IGCGTSYH+A+ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYMNYRVPKTRKEIFETLIRGLQRLEYRGYDSAGVAIDGN-NHEVKERHIHLVKKRGKVKALDEELYKQDSMDL-KVEFETHFGIAHTRWATHGVPNAVNSHPQRSDKDNEFVVIHNGIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPVLYPTCNIENVKNICKTRMKRLDSSTCLHAVG-DKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSATDDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDHLKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELA 402          

HSP 2 Score: 361.688 bits (927), Expect = 0.000e+0
Identity = 166/261 (63.60%), Postives = 213/261 (81.61%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTL+AL+YC+ RGAL VGITN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQF+SLVM  L++SEDR  ++ RR+EI+ GL  LP LIKEVL  +  + ++A EL  +RS+L+MGRGYNYATCLEGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IM++ KD  F K  NA+ +V AR+G+PI + + +  +  K+    + +P TVDCLQG+LSVIPLQ+LS++LA L+G+D+D PRNLAKSVTVE
Sbjct:  422 SQSGETADTLLALRYCKDRGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLDEKIHDLALELYTQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKQMPVIMVIMKDPCFAKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHLAVLRGYDVDFPRNLAKSVTVE 682          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. UniProt/SwissProt
Match: sp|O94808|GFPT2_HUMAN (Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Homo sapiens OX=9606 GN=GFPT2 PE=1 SV=3)

HSP 1 Score: 506.908 bits (1304), Expect = 0.000e+0
Identity = 251/405 (61.98%), Postives = 308/405 (76.05%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-----IALFRNKGKVFSL-EELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNF----------ITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAY+NY  P TR +I E LI GL+RLEYRGYDSAGVA D N N E     I L + +GKV +L EEL K    D+   E ETH GIAHTRWATHG+PS  NSHP RSD+ NEF+VIHNGIITNY+ +++ L  KG++FE++TDTE I KL+K  +DNR  E+++F  LVE VI +LEG+FALVFKS H+PGE VATRRGSPLL+G+RS + L+T+ IPI+Y               + R DS   LH VG +K VE+FFASDASAI+EHTN+VI+LEDDD+AA+ DG L +HR+ R A+D   R + TL+MEL+QIMKGNF  FM+KEI++QPESV NTMRGRVNFET  ++LGGL +HL  IRRCRRL+ IGCGTSYH+A+ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGN-NHEVKERHIQLVKKRGKVKALDEELYKQDSMDL-KVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVVIHNGIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAFALVFKSVHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTCTLENVKNICKTRMKRLDSSACLHAVG-DKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSASDDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDHLKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELA 402          

HSP 2 Score: 362.844 bits (930), Expect = 0.000e+0
Identity = 165/261 (63.22%), Postives = 213/261 (81.61%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTL+AL+YC+ RGAL VG+TN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQF+SLVM  L++SEDR  ++ RR+EI+ GL  LP LIKEVL  E  + ++A EL  +RS+L+MGRGYNYATCLEGALK+KE+ Y+HSEGI++GELKHGPLAL+D  M +IM++ KD  F K  NA+ +V AR+G+PI + + +  +  K+    + +P TVDCLQG+LSVIPLQ+LS++LA L+G+D+D PRNLAKSVTVE
Sbjct:  422 SQSGETADTLLALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLEEKIHDLALELYTQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCFAKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHLAVLRGYDVDFPRNLAKSVTVE 682          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. UniProt/SwissProt
Match: sp|Q4KMC4|GFPT2_RAT (Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Rattus norvegicus OX=10116 GN=Gfpt2 PE=1 SV=3)

HSP 1 Score: 506.523 bits (1303), Expect = 0.000e+0
Identity = 250/405 (61.73%), Postives = 310/405 (76.54%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIA-----LFRNKGKVFSL-EELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNF----------ITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAY+NY  P TR +I E LI GL+RLEYRGYDSAGVA D N N E+      L + KGKV +L EEL K    D+   E ETH GIAHTRWATHG+P+  NSHP RSD++NEF+VIHNGIITNY+ +++ L  KG++FE++TDTE I KL+K  +DNR  E+++F  LVE VI +LEG+FALVFKS H+PGE VATRRGSPLL+G+RS + L+T+ IP++Y               + R DS T LH VG +K VE+FFASDASAI+EHTN+VI+LEDDD+AA+ DG L +HR+ R A+D   R + TL+MEL+QIMKGNF  FM+KEI++QPESV NTMRGRVNFET  ++LGGL +HL  IRRCRRL+ IGCGTSYH+A+ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYMNYRVPKTRKEIFETLIRGLQRLEYRGYDSAGVAIDGN-NHEVKERHIHLVKKKGKVKALDEELYKQDSMDL-KVEFETHFGIAHTRWATHGVPNVVNSHPQRSDKDNEFVVIHNGIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPVLYRTCTIENVKNICKTRLKRLDSSTCLHAVG-DKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSASDDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDHLKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELA 402          

HSP 2 Score: 363.999 bits (933), Expect = 0.000e+0
Identity = 167/261 (63.98%), Postives = 214/261 (81.99%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTL+AL+YC+ RGAL VGITN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQF+SLVM  L++SEDR  ++TRR+EI+ GL  LP LIKEVL  +  + ++A EL  +RS+L+MGRGYNYATCLEGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IM++ KD  F K  NA+ +V AR+G+PI + + +  +  K+    + +P TVDCLQG+LSVIPLQ+LS++LA L+G+D+D PRNLAKSVTVE
Sbjct:  422 SQSGETADTLLALRYCKDRGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFISLVMFGLMMSEDRISLQTRRQEIIRGLRSLPELIKEVLSLDEKIHDLALELYTQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKQMPVIMVIMKDPCFAKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHLAVLRGYDVDFPRNLAKSVTVE 682          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. UniProt/SwissProt
Match: sp|P82808|GFPT1_RAT (Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Rattus norvegicus OX=10116 GN=Gfpt1 PE=1 SV=3)

HSP 1 Score: 500.745 bits (1288), Expect = 0.000e+0
Identity = 249/403 (61.79%), Postives = 304/403 (75.43%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-------IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY------SGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY  P TR +I+E LI GL+RLEYRGYDSAGV  D   + +       I L + KGKV +L+E V  Q +D+D D E + H GIAHTRWATHG PS  NSHP RSD+NNEFIVIHNGIITNY+ +K+ L  KG+ FE++TDTE I KL+K  YDN   +++SF  LVE VI +LEG+FALVFKS HFPG+ V TRRGSPLL+G+RS H L+TDHIPI+Y       G   ++R DS T L PV   K VEY+FASDASA++EHTN+VI+LEDDDVAA+ DG L +HR+ R A D   R V TL+MEL+QIMKGNF  FM+KEI++QPESV+NTMRGRVNF+   + LGGL +H+  I+RCRRL+ I CGTSYH+ +ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGLDGGNDKDWEANACKIQLIKKKGKVKALDEEVHKQ-QDMDLDIEFDVHLGIAHTRWATHGEPSPVNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNWESQDVSFTTLVERVIQQLEGAFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLSTDHIPILYRTGKDKKGSCGLSRVDSTTCLFPV-EEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRTARDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGMATRQVLEELTELPVMVELA 401          

HSP 2 Score: 354.755 bits (909), Expect = 0.000e+0
Identity = 165/261 (63.22%), Postives = 215/261 (82.38%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLM L+YC++RGAL VGITN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQFVSLVM AL++ +DR  M+ RR+EI+ GL  LP LIKEVL  +  ++ +A EL +++S+LIMGRGY+YATCLEGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IMI+ +D  + K  NA+ +V+AR+G+P+ I   E  + +K  +  + VP +VDCLQG+LSVIPLQ+L+++LA L+G+D+D PRNLAKSVTVE
Sbjct:  421 SQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE 681          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. TrEMBL
Match: V3ZXV3 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_235105 PE=4 SV=1)

HSP 1 Score: 528.094 bits (1359), Expect = 0.000e+0
Identity = 251/408 (61.52%), Postives = 319/408 (78.19%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNING----EIALFRNKGKVFSLEELVKDQLKDIDNDE-IETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYS-GDNFIT-------------RYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY+ P TR +I++ILINGLKRLEYRGYDSAGV FD +I      +I L +++GKV  LEE V+ + KD+  ++  + H GIAHTRWATHG PS+ NSHP RSD +NEFI++HNGIITNY+ IK  L++KG +FE++TDTEVI KL+K  Y    D N++FR+LVE+ I +LEG+FAL   S H+PGEIV TRRGSPLL+G++S   LTTDHIPI+YS G   I+             R +  TE HP+G NK VEYFFASDASA++EHTN+VI+LEDDDVAA+++GCL +HR++R   DS  R+VITL+ME++QIMKG+F  FM+KEI++QPESV+NTMRGRVNF T +++LGG+ + +  IRRCRRL+FI CGTSYHSA+ATR L+EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYLVPATRKEILDILINGLKRLEYRGYDSAGVGFDGSIEDCKECQIKLIKSQGKVCRLEEAVQ-KCKDVSFEKSFDIHVGIAHTRWATHGEPSDVNSHPQRSDTSNEFILVHNGIITNYKDIKSFLMKKGHQFESETDTEVIAKLIKHLYGTHKDSNITFRELVEIAIQQLEGAFALGVTSVHYPGEIVVTRRGSPLLIGVKSQTKLTTDHIPILYSKGKKDISLHEEHRGFIGSGKRNEEQTEFHPIGPNKIVEYFFASDASAVIEHTNQVIFLEDDDVAAVKNGCLTIHRVSRNVDDSTIREVITLKMEIQQIMKGSFSSFMQKEIFEQPESVVNTMRGRVNFATNKVVLGGIKDFMCEIRRCRRLLFIACGTSYHSAIATRQLLEELTELPVMVELA 407          

HSP 2 Score: 350.903 bits (899), Expect = 0.000e+0
Identity = 164/261 (62.84%), Postives = 208/261 (79.69%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC+ RGALIVGITNVVGS+ISRDS CGVHINAGPEIGVASTKAYTSQF++LV+  L++ EDR  M+ RR EI+ GL  LP  IKEVLK +  +  +A EL  ++S+L+MGRGYNYATCLEGALK+KEL Y+HSEGI++GELKHGPLALVD  M +IM++++D ++ K +NA+ +V AR+G+PI I  +            V VP  +DCLQG+L+ IPLQ+LS ++A+L+  D+DCPRNLAKSVTVE
Sbjct:  427 SQSGETADTLMALRYCKTRGALIVGITNVVGSSISRDSHCGVHINAGPEIGVASTKAYTSQFIALVLFGLIMCEDRISMQERRNEIIQGLKTLPEQIKEVLKMDEQIHKLALELYQQKSLLVMGRGYNYATCLEGALKIKELTYMHSEGILAGELKHGPLALVDKAMPVIMVITRDLVYKKCINALEQVKARQGEPILICNSGDTDTQSQANKSVSVPLAIDCLQGILTCIPLQLLSLHIAELRKLDVDCPRNLAKSVTVE 687          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. TrEMBL
Match: A0A0N7Z9G6 (Putative glucosamine 6-phosphate synthetase OS=Rhodnius neglectus OX=72488 PE=2 SV=1)

HSP 1 Score: 525.398 bits (1352), Expect = 0.000e+0
Identity = 249/398 (62.56%), Postives = 310/398 (77.89%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDEI-ETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDN--------FITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY+TP +R +I+E+LINGLKRLEYRGYDSAGVA D+    EIA+ +  GKV +LEE +  +   ++ D   E H GIAHTRWATHG+PSE NSHP RSD N  F+V+HNGI+TNY+ +K  L+ KG KFE++TDTEVI KL++  Y    D   SFR+LVE VIS+LEG+FAL FKS HFPGE VATRRGSPLLVGI++   L TDH+PI+YS D+         I R DS  E  P+  +K+VEYFFASDASA++EHTN+VI+LEDDDVAA++DG L +HRL R   D   R++ T++ME++QIMKGN+  FM+KEI++QPESV+NTMRGRVNFETK ++LGG+ E++  IRRCRRLM IGCGTSYHSA+A R L+EELTELPVMV+LA
Sbjct:    1 MCGIFAYLNYLTPKSRKEILEVLINGLKRLEYRGYDSAGVAVDEPDGKEIAIVKKSGKVQALEEEIMLRANQLEFDATTECHVGIAHTRWATHGVPSEVNSHPQRSDSNQAFVVVHNGILTNYKDVKVFLMNKGHKFESETDTEVIAKLVQHMYQQHPD--YSFRELVEQVISQLEGAFALCFKSKHFPGECVATRRGSPLLVGIKTKTRLATDHVPILYSKDHRPHGREMPIIPRSDSTAEFRPL-EDKEVEYFFASDASAVIEHTNRVIFLEDDDVAAVKDGLLSIHRLRRSLDDPHAREITTVKMEIQQIMKGNYSSFMQKEIFEQPESVVNTMRGRVNFETKNVVLGGIKEYIPEIRRCRRLMLIGCGTSYHSAVACRQLLEELTELPVMVDLA 395          

HSP 2 Score: 354.369 bits (908), Expect = 0.000e+0
Identity = 164/261 (62.84%), Postives = 216/261 (82.76%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETAD+LMAL+YC++RGALIVG+TN VGS+I R+S CG+HINAGPEIGVASTKAYTSQF+SLVM ALV+SEDR  ++ RR+EI+ GL  L   I+EVL+ +  V+++A +L  ++S+LIMGRGYN+ATC+EGALKVKEL Y+HSEGI++GELKHGPLALVD  M II+IV++D ++ K MNA+ +V AR+G+PI I     ++   +    + VP TVDCLQG+L+VIP+Q+LSY++A L+G ++DCPRNLAKSVTVE
Sbjct:  415 SQSGETADSLMALRYCKQRGALIVGVTNTVGSSICRESHCGIHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRISLQERRKEIIKGLQNLDEQIREVLQVDDKVQSLANDLYQQKSLLIMGRGYNFATCMEGALKVKELTYMHSEGILAGELKHGPLALVDKAMPIILIVTRDPVYQKCMNALQQVTAREGRPIVICEKGDLETQGFASRTIEVPHTVDCLQGILTVIPMQLLSYHIAVLRGCNVDCPRNLAKSVTVE 675          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. TrEMBL
Match: K1QYG7 (Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Crassostrea gigas OX=29159 GN=CGI_10020409 PE=4 SV=1)

HSP 1 Score: 524.242 bits (1349), Expect = 0.000e+0
Identity = 250/408 (61.27%), Postives = 318/408 (77.94%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFD----KNINGEIALFRNKGKVFSLEELVKDQLKDID-NDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDN------FITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            MCGIFAYLNY+ P  R +I+EIL+NGLKR+EYRGYDSAGV F+    KN + E+   + KGKV  LEE +  Q  D+D   E +TH GIAHTRWATHG PS  NSHP RSD +NEF+V HNGIITNY+ +K  LI KG  FE++TDTEVI KL+K   D   D  +SFR+LVE+ + +LEG+F+LVF S+ FPGE V+TRRGSPL++G++S   L+TDHIPI+YS D+       +   DS TE HP+G NK+VEYFFASDASAI+EHTN+VI+LEDDDVAA+Q+GCL +HR+ R   +S  R+V T++ME++QIMKG++  FM+KEI++QPESV+NTMRGRVNFET +++LGG+ + +T IRRCRRL+FI CGTS+HSA+ATR LMEELTELPVMVELA +   +QT
Sbjct:    1 MCGIFAYLNYLVPAKRKEILEILVNGLKRMEYRGYDSAGVGFEGTNTKNGSHELKTIKQKGKVARLEEEIA-QTTDLDFEKEFDTHIGIAHTRWATHGEPSPTNSHPQRSDPSNEFLVCHNGIITNYKDLKSFLITKGMVFESETDTEVIVKLVKHISDKHKDSAISFRELVELTVQQLEGAFSLVFMSSKFPGECVSTRRGSPLVIGVKSKAKLSTDHIPILYSKDHRGLMNPALHHTDSTTEFHPIG-NKEVEYFFASDASAIIEHTNQVIFLEDDDVAAVQNGCLTIHRIKRTLDESATREVTTIKMEIQQIMKGSYSSFMQKEIFEQPESVVNTMRGRVNFETNQVVLGGIKDFMTEIRRCRRLLFIACGTSFHSAVATRQLMEELTELPVMVELASDFLDRQT 406          

HSP 2 Score: 335.495 bits (859), Expect = 0.000e+0
Identity = 155/247 (62.75%), Postives = 202/247 (81.78%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFD 1966
            +QSGETADTLMAL+YC++RGALIVGITN VGS+I R+S CGVHINAGPEIGVASTKAYTSQF+SLVM ALV+ EDR  M+ RR EI+ GL  LPS IK VL+T+  V  +A EL  ++S+L+MGRGYNYATCLEGALK+KEL Y+HSEGI++GELKHGPLALVD  M ++M+V++DK++ K MNA+ +V AR G PI +  N+  +  + +  ++ VP T+DCLQG+L++IP+Q+LS ++A+L+G D
Sbjct:  418 SQSGETADTLMALRYCKQRGALIVGITNTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMCEDRISMQDRRTEIIQGLKNLPSQIKAVLETDEHVNTLARELYQQKSLLVMGRGYNYATCLEGALKIKELTYMHSEGILAGELKHGPLALVDKAMPVMMVVTRDKVYPKCMNALQQVKARHGNPIVLGNNDDKETQQQVNKYIGVPSTIDCLQGILTIIPMQLLSMHIAQLRGCD 664          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. TrEMBL
Match: A0A1S3IWU4 (glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 isoform X7 OS=Lingula unguis OX=7574 GN=LOC106168234 PE=4 SV=1)

HSP 1 Score: 522.316 bits (1344), Expect = 0.000e+0
Identity = 249/405 (61.48%), Postives = 309/405 (76.30%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-----IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDN----------FITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY+ P  R +I+ ILI GL+RLEYRGYDSAGVA D + N E     IA+ + +GKV +LEE +    + +D D E   H GIAHTRWATHG PS  NSHP RSD NNEF+VIHNGIITNY+ IK  L +KG  FE++TDTE I KL+K  YD + + N  FRQLVE VI +LEG+F+LVFKS HFPGE VATRRGSPLL+G+++ + L+ DH P+ YS D            + R DS TE  P+G N++VEYFFASDASAI+EHTN+VIYLEDDDVAA+ +G L +HR+ R   +S  R+VITL+ME++QIMKG+F  FM+KEI++Q ESV+NTMRGRVNFET E++LGG+ +++  I+RCRRL+FI CGTSYHSA+ATR L+EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYLVPAKREEILRILIKGLQRLEYRGYDSAGVAIDSSNNAEDSVSDIAIIKKRGKVKALEEEIAASTQSLDFDREFNCHIGIAHTRWATHGEPSACNSHPQRSDPNNEFVVIHNGIITNYKDIKTFLEKKGHVFESETDTETIAKLIKHIYDTKNEVN--FRQLVEAVIQQLEGAFSLVFKSKHFPGECVATRRGSPLLIGVKTRYKLSADHFPVCYSKDARHSDKSTSNLALQRSDSTTEFQPIGPNREVEYFFASDASAIIEHTNQVIYLEDDDVAAVSEGALSIHRIKRSIDESTVREVITLKMEIQQIMKGSFSSFMQKEIFEQTESVVNTMRGRVNFETNEVVLGGIKDYMGEIKRCRRLLFIACGTSYHSAVATRQLLEELTELPVMVELA 403          

HSP 2 Score: 360.147 bits (923), Expect = 0.000e+0
Identity = 167/261 (63.98%), Postives = 214/261 (81.99%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC+ RGALIVGITN VGS+I R+S CGVHINAGPEIGVASTKAYTSQF+SLVM  L++S+DR  M+ RR+EI+ GL  LP  IKEVLKT+  + ++++EL  ++S+L+MGRGYNYATCLEGALK+KEL Y+HSEGI++GELKHGPLALVD  M +IMI+++D L+ K MNA+ +V AR G+P+ I      + ++     + VP TVDCLQG++SVIPLQ++SY++A L+  D+DCPRNLAKSVTVE
Sbjct:  423 SQSGETADTLMALRYCKGRGALIVGITNTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFGLMMSDDRLSMQQRRKEIIQGLQKLPEQIKEVLKTDEKIHSLSQELYQQKSLLVMGRGYNYATCLEGALKIKELTYMHSEGILAGELKHGPLALVDKAMPVIMIITRDNLYPKCMNALQQVKARHGQPVVICNEGDEETIRMAYKCLEVPLTVDCLQGIISVIPLQLVSYHIATLRNLDVDCPRNLAKSVTVE 683          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. TrEMBL
Match: A0A1S3IXG4 (glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 isoform X8 OS=Lingula unguis OX=7574 GN=LOC106168234 PE=4 SV=1)

HSP 1 Score: 521.546 bits (1342), Expect = 0.000e+0
Identity = 249/405 (61.48%), Postives = 309/405 (76.30%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-----IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDN----------FITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY+ P  R +I+ ILI GL+RLEYRGYDSAGVA D + N E     IA+ + +GKV +LEE +    + +D D E   H GIAHTRWATHG PS  NSHP RSD NNEF+VIHNGIITNY+ IK  L +KG  FE++TDTE I KL+K  YD + + N  FRQLVE VI +LEG+F+LVFKS HFPGE VATRRGSPLL+G+++ + L+ DH P+ YS D            + R DS TE  P+G N++VEYFFASDASAI+EHTN+VIYLEDDDVAA+ +G L +HR+ R   +S  R+VITL+ME++QIMKG+F  FM+KEI++Q ESV+NTMRGRVNFET E++LGG+ +++  I+RCRRL+FI CGTSYHSA+ATR L+EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYLVPAKREEILRILIKGLQRLEYRGYDSAGVAIDSSNNAEDSVSDIAIIKKRGKVKALEEEIAASTQSLDFDREFNCHIGIAHTRWATHGEPSACNSHPQRSDPNNEFVVIHNGIITNYKDIKTFLEKKGHVFESETDTETIAKLIKHIYDTKNEVN--FRQLVEAVIQQLEGAFSLVFKSKHFPGECVATRRGSPLLIGVKTRYKLSADHFPVCYSKDARHSDKSTSNLALQRSDSTTEFQPIGPNREVEYFFASDASAIIEHTNQVIYLEDDDVAAVSEGALSIHRIKRSIDESTVREVITLKMEIQQIMKGSFSSFMQKEIFEQTESVVNTMRGRVNFETNEVVLGGIKDYMGEIKRCRRLLFIACGTSYHSAVATRQLLEELTELPVMVELA 403          

HSP 2 Score: 364.385 bits (934), Expect = 0.000e+0
Identity = 168/261 (64.37%), Postives = 215/261 (82.38%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC+ RGALIVGITN VGS+I R+S CGVHINAGPEIGVASTKAYTSQF+SLVM  L++S+DR  M+ RR+EI+ GL  LP  IKEVLKT+  + ++++EL  ++S+L+MGRGYNYATCLEGALK+KEL Y+HSEGI++GELKHGPLALVD  M +IMI+++D L+ K MNA+ +V AR G+PI +      +   +    V VP TVDCLQG+L+VIP+Q+LS+++A L+G+D+DCPRNLAKSVTVE
Sbjct:  423 SQSGETADTLMALRYCKGRGALIVGITNTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFGLMMSDDRLSMQQRRKEIIQGLQKLPEQIKEVLKTDEKIHSLSQELYQQKSLLVMGRGYNYATCLEGALKIKELTYMHSEGILAGELKHGPLALVDKAMPVIMIITRDNLYPKCMNALQQVKARHGRPIVVCNKGDAETQSHAYKIVDVPYTVDCLQGILTVIPMQLLSFHIAVLRGYDVDCPRNLAKSVTVE 683          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Cavefish
Match: gfpt2 (glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Source:NCBI gene;Acc:103041744])

HSP 1 Score: 508.834 bits (1309), Expect = 0.000e+0
Identity = 248/402 (61.69%), Postives = 306/402 (76.12%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFD---KNINGEIALFRNKGKVFSL-EELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGD---------NFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY  P TR  I   L+ GL+RLEYRGYDSAGVA D   K     I LF+ KGKV +L EEL K+   D++  E++TH GIAHTRWATHG PS  NSHP RSD+NNEF+VIHNGIITNY+ +K+ LI KG++FE++TDTEVIPKL+K  YDNR    +SF  LVE VI +LEG+FALVFKS HFPG+ VATRRGSPLL+G+RS + L+T+ +PI Y+           N+I R DS   LH V     VE++FASDASAI+EHTNKV+YLEDDD+AA+ DG L +HR++R A +   R + TL+MEL+QIMKGNF  FM+KEI++QPESV NTMRGR+ F+T  +ILGGL +HL  I+RCRRL+ IGCGTS+H+ +ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYRVPKTRKDIFTTLVKGLQRLEYRGYDSAGVAVDGCGKVDTNSICLFKKKGKVKALDEELYKNDSIDLEL-ELDTHFGIAHTRWATHGEPSAVNSHPQRSDKNNEFVVIHNGIITNYKELKKYLISKGYEFESETDTEVIPKLIKYLYDNRESNYVSFSTLVERVIQQLEGAFALVFKSIHFPGQAVATRRGSPLLIGVRSQYKLSTEQVPIQYNNSDTRIDVQSKNYINRVDSSNALHSVNDRMAVEFYFASDASAIIEHTNKVMYLEDDDIAAVADGKLSVHRMSRSAGEDPVRVIQTLQMELQQIMKGNFKAFMQKEIFEQPESVFNTMRGRICFDTNTVILGGLKDHLKEIKRCRRLIIIGCGTSFHAGVATRQILEELTELPVMVELA 401          

HSP 2 Score: 342.428 bits (877), Expect = 0.000e+0
Identity = 168/294 (57.14%), Postives = 213/294 (72.45%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTK---------------------------------AYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC+ RGAL VG+TN VGS+ISR++ CGVHINAGPEIGVASTK                                 AYTSQFVSLVM  L++SEDR  ++ RREEI+NGL  LP LIKEVL  +  +K IA+EL  E+S+L+MGRGY+YATCLEGALKVKE+ Y+HSEGI++GELKHGPLAL+D HM +IM++ +D  +TK  NA+ +V AR+G+PI +   +     K     + +P TVDCLQG+L VIPLQ++S++LA L+G+D+D PRNLAKSVTVE
Sbjct:  421 SQSGETADTLMALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKVQYDILSLFCLSLILTHSRSFSPVSLVFDSPVQAYTSQFVSLVMFGLMMSEDRLSLQKRREEIINGLSKLPELIKEVLALDDKIKCIADELYQEKSLLVMGRGYHYATCLEGALKVKEITYMHSEGILAGELKHGPLALIDYHMPVIMVIMRDACYTKCHNALQQVTARQGRPIILCCQDDPDISKMAYKTIELPHTVDCLQGILCVIPLQLMSFHLAVLRGYDVDFPRNLAKSVTVE 714          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Cavefish
Match: gfpt2 (glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Source:NCBI gene;Acc:103041744])

HSP 1 Score: 508.449 bits (1308), Expect = 0.000e+0
Identity = 248/402 (61.69%), Postives = 306/402 (76.12%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFD---KNINGEIALFRNKGKVFSL-EELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGD---------NFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY  P TR  I   L+ GL+RLEYRGYDSAGVA D   K     I LF+ KGKV +L EEL K+   D++  E++TH GIAHTRWATHG PS  NSHP RSD+NNEF+VIHNGIITNY+ +K+ LI KG++FE++TDTEVIPKL+K  YDNR    +SF  LVE VI +LEG+FALVFKS HFPG+ VATRRGSPLL+G+RS + L+T+ +PI Y+           N+I R DS   LH V     VE++FASDASAI+EHTNKV+YLEDDD+AA+ DG L +HR++R A +   R + TL+MEL+QIMKGNF  FM+KEI++QPESV NTMRGR+ F+T  +ILGGL +HL  I+RCRRL+ IGCGTS+H+ +ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYRVPKTRKDIFTTLVKGLQRLEYRGYDSAGVAVDGCGKVDTNSICLFKKKGKVKALDEELYKNDSIDLEL-ELDTHFGIAHTRWATHGEPSAVNSHPQRSDKNNEFVVIHNGIITNYKELKKYLISKGYEFESETDTEVIPKLIKYLYDNRESNYVSFSTLVERVIQQLEGAFALVFKSIHFPGQAVATRRGSPLLIGVRSQYKLSTEQVPIQYNNSDTRIDVQSKNYINRVDSSNALHSVNDRMAVEFYFASDASAIIEHTNKVMYLEDDDIAAVADGKLSVHRMSRSAGEDPVRVIQTLQMELQQIMKGNFKAFMQKEIFEQPESVFNTMRGRICFDTNTVILGGLKDHLKEIKRCRRLIIIGCGTSFHAGVATRQILEELTELPVMVELA 401          

HSP 2 Score: 358.992 bits (920), Expect = 0.000e+0
Identity = 168/261 (64.37%), Postives = 213/261 (81.61%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC+ RGAL VG+TN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQFVSLVM  L++SEDR  ++ RREEI+NGL  LP LIKEVL  +  +K IA+EL  E+S+L+MGRGY+YATCLEGALKVKE+ Y+HSEGI++GELKHGPLAL+D HM +IM++ +D  +TK  NA+ +V AR+G+PI +   +     K     + +P TVDCLQG+L VIPLQ++S++LA L+G+D+D PRNLAKSVTVE
Sbjct:  421 SQSGETADTLMALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFGLMMSEDRLSLQKRREEIINGLSKLPELIKEVLALDDKIKCIADELYQEKSLLVMGRGYHYATCLEGALKVKEITYMHSEGILAGELKHGPLALIDYHMPVIMVIMRDACYTKCHNALQQVTARQGRPIILCCQDDPDISKMAYKTIELPHTVDCLQGILCVIPLQLMSFHLAVLRGYDVDFPRNLAKSVTVE 681          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Cavefish
Match: gfpt1 (glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 [Source:NCBI gene;Acc:103023534])

HSP 1 Score: 499.59 bits (1285), Expect = 0.000e+0
Identity = 242/402 (60.20%), Postives = 306/402 (76.12%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-------IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDN-----FITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY  P +R +I+EIL+ GL+RLEYRGYDSAGV  D   + +       I L + +GKV  L++ ++ Q +DID D E + H GIAHTRWATHG+PS  NSHP RSD++NEFIVIHNGIITNY+ +K+ L  KG++FE++TDTE I KL+K  YDNR +++ SF  LVE V  +LEG+FALVFKS HFPGE V TRRGSPLL+G++S H L+ DHIPI+YSG +      + R D  T L PV   K VEY+FASDASA++EHTN+VI+LEDDD+AA+ DG L +HR+ R A D   R + TL+MEL+QIMKGN+  FM+KEI++QPESV+NTMRGRVNFE   + LGGL +H+  I+RCRRL+ I CGTSYH+ +ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYHVPRSRREILEILLKGLRRLEYRGYDSAGVGIDGGNSKDWESNAKAIQLIKQRGKVKVLDDEIQKQ-QDIDLDVEFDVHLGIAHTRWATHGVPSPVNSHPQRSDKHNEFIVIHNGIITNYKDLKKFLESKGYEFESETDTETIAKLVKYMYDNRENDDTSFATLVEQVTQQLEGAFALVFKSVHFPGEAVGTRRGSPLLMGVKSDHKLSADHIPILYSGKDKKSCTTLPRLDQDTCLFPV-EEKAVEYYFASDASAVIEHTNRVIFLEDDDIAAVADGRLSIHRIKRTAGDHPARAIQTLQMELQQIMKGNYSSFMQKEIFEQPESVVNTMRGRVNFEDNTVTLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELA 400          

HSP 2 Score: 354.755 bits (909), Expect = 0.000e+0
Identity = 163/261 (62.45%), Postives = 213/261 (81.61%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETAD+L+AL+YC++RGAL VGITN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQFV+L+M AL++ +DR  ++ RR EI+ GL +LP LIKEVL  +  ++ +A EL  ++S+LIMGRGY+YATCLEGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IMI+ +D  +TK  NA+ +V AR+G+PI I   +  + +      + VP  VDCLQG+LSVIPLQ+LS++LA L+G+D+DCPRNLAKSVTVE
Sbjct:  420 SQSGETADSLLALRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVALIMFALLMCDDRISVQPRRREIIQGLKILPDLIKEVLSLDEEIQKLAAELYQQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYTKCQNALQQVAARQGRPIVICDKDDYETINNSSRTIKVPHCVDCLQGILSVIPLQLLSFHLAVLRGYDVDCPRNLAKSVTVE 680          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Cavefish
Match: gfpt2 (glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Source:NCBI gene;Acc:103041744])

HSP 1 Score: 467.618 bits (1202), Expect = 0.000e+0
Identity = 234/390 (60.00%), Postives = 287/390 (73.59%), Query Frame = 3
Query:   69 IFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFD---KNINGEIALFRNKGKVFSL-EELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            IFAYLNY  P TR  I   L+ GL+RLEYRGYDSAGVA D   K     I LF+ KGKV +L EEL K+   D++  E++TH GIAHTRWATHG PS  NSHP RSD+NNEF+VIHNGIITNY+ +K+ LI KG++FE++TDTEVIPKL+K  YDNR    +SF  LVE VI +LEG+FALVFKS HFPG+ VATR  + +   I        D   I     N+I R DS   LH V     VE++FASDASAI+EHTNKV+YLEDDD+AA+ DG L +HR++R A +   R + TL+MEL+QIMKGNF  FM+KEI++QPESV NTMRGR+ F+T  +ILGGL +HL  I+RCRRL+ IGCGTS+H+ +ATR ++EELTELPVMVELA
Sbjct:    3 IFAYLNYRVPKTRKDIFTTLVKGLQRLEYRGYDSAGVAVDGCGKVDTNSICLFKKKGKVKALDEELYKNDSIDLEL-ELDTHFGIAHTRWATHGEPSAVNSHPQRSDKNNEFVVIHNGIITNYKELKKYLISKGYEFESETDTEVIPKLIKYLYDNRESNYVSFSTLVERVIQQLEGAFALVFKSIHFPGQAVATRSAATVFSSIPPFSVFICD-TRIDVQSKNYINRVDSSNALHSVNDRMAVEFYFASDASAIIEHTNKVMYLEDDDIAAVADGKLSVHRMSRSAGEDPVRVIQTLQMELQQIMKGNFKAFMQKEIFEQPESVFNTMRGRICFDTNTVILGGLKDHLKEIKRCRRLIIIGCGTSFHAGVATRQILEELTELPVMVELA 390          

HSP 2 Score: 359.377 bits (921), Expect = 0.000e+0
Identity = 168/261 (64.37%), Postives = 213/261 (81.61%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC+ RGAL VG+TN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQFVSLVM  L++SEDR  ++ RREEI+NGL  LP LIKEVL  +  +K IA+EL  E+S+L+MGRGY+YATCLEGALKVKE+ Y+HSEGI++GELKHGPLAL+D HM +IM++ +D  +TK  NA+ +V AR+G+PI +   +     K     + +P TVDCLQG+L VIPLQ++S++LA L+G+D+D PRNLAKSVTVE
Sbjct:  410 SQSGETADTLMALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFGLMMSEDRLSLQKRREEIINGLSKLPELIKEVLALDDKIKCIADELYQEKSLLVMGRGYHYATCLEGALKVKEITYMHSEGILAGELKHGPLALIDYHMPVIMVIMRDACYTKCHNALQQVTARQGRPIILCCQDDPDISKMAYKTIELPHTVDCLQGILCVIPLQLMSFHLAVLRGYDVDFPRNLAKSVTVE 670          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Cavefish
Match: gfpt1 (glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 [Source:NCBI gene;Acc:103023534])

HSP 1 Score: 427.943 bits (1099), Expect = 0.000e+0
Identity = 216/386 (55.96%), Postives = 278/386 (72.02%), Query Frame = 3
Query:  114 IIEILINGLKRLEYRGYDSAGVAFDKNINGE-------IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATR--RGSPLLVGIRSSHSLTTDHIPIIYSGDN-----FITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            I+EIL+ GL+RLEYRGYDSAGV  D   + +       I L + +GKV  L++ ++ Q +DID D E + H GIAHTRWATHG+PS  NSHP RSD++NEFIVIHNGIITNY+ +K+ L  KG++FE++TDTE I KL+K  YDNR +++ SF  LVE V  +L        +  H       TR  RGSPLL+G++S H L+ DHIPI+YSG +      + R D  T L PV   K VEY+FASDASA++EHTN+VI+LEDDD+AA+ DG L +HR+ R A D   R + TL+MEL+QIMKGN+  FM+KEI++QPESV+NTMRGRVNFE   + LGGL +H+  I+RCRRL+ I CGTSYH+ +ATR ++EELTELPVMVELA
Sbjct:    1 ILEILLKGLRRLEYRGYDSAGVGIDGGNSKDWESNAKAIQLIKQRGKVKVLDDEIQKQ-QDIDLDVEFDVHLGIAHTRWATHGVPSPVNSHPQRSDKHNEFIVIHNGIITNYKDLKKFLESKGYEFESETDTETIAKLVKYMYDNRENDDTSFATLVEQVTQQL-------VRVCHLSNSCRTTRKLRGSPLLMGVKSDHKLSADHIPILYSGKDKKSCTTLPRLDQDTCLFPV-EEKAVEYYFASDASAVIEHTNRVIFLEDDDIAAVADGRLSIHRIKRTAGDHPARAIQTLQMELQQIMKGNYSSFMQKEIFEQPESVVNTMRGRVNFEDNTVTLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELA 377          

HSP 2 Score: 355.14 bits (910), Expect = 0.000e+0
Identity = 163/261 (62.45%), Postives = 213/261 (81.61%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETAD+L+AL+YC++RGAL VGITN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQFV+L+M AL++ +DR  ++ RR EI+ GL +LP LIKEVL  +  ++ +A EL  ++S+LIMGRGY+YATCLEGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IMI+ +D  +TK  NA+ +V AR+G+PI I   +  + +      + VP  VDCLQG+LSVIPLQ+LS++LA L+G+D+DCPRNLAKSVTVE
Sbjct:  397 SQSGETADSLLALRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVALIMFALLMCDDRISVQPRRREIIQGLKILPDLIKEVLSLDEEIQKLAAELYQQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYTKCQNALQQVAARQGRPIVICDKDDYETINNSSRTIKVPHCVDCLQGILSVIPLQLLSFHLAVLRGYDVDCPRNLAKSVTVE 657          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Sea Lamprey
Match: gfpt2 (glutamine-fructose-6-phosphate transaminase 2 [Source:ZFIN;Acc:ZDB-GENE-071113-1])

HSP 1 Score: 486.878 bits (1252), Expect = 0.000e+0
Identity = 240/416 (57.69%), Postives = 308/416 (74.04%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFD----KNINGE---IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY-SGDNF----------ITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            + GIFAYLNY  P +R  I++ L+ GL+RLEYRGYDSAGVA D    KN +     I L + +GKV +L++ +  Q   +D D E ETH GIAHTRWATHG P+  NSHP RSD+NNEF+VIHNGIITNY+ +K+ L  KG++FE++TDTE IPKL+K  YDNR  + +S   LVE V  +LEG+FALVFKS HFPG++V TRRG PLL+G++S H L+TDHIP++Y  G N           + R D  T L+P+G    VEY+FASDASAI+EHTN+VI+LEDDDVAAI DG L +HR+ R A D   R + TL+MEL+QIMKG++  FM+KEI++QPESV+NTMRGRVNF+   ++LGGL +H+  IRRCRRL+ IGCGTSYH+ +ATR ++EELTELPVMVEL+ +   + T
Sbjct:    1 LAGIFAYLNYNVPRSRKHILDTLVKGLQRLEYRGYDSAGVAVDGGNDKNWDKNSKVIHLIKKRGKVKALQDEIYKQ-DSLDFDIEFETHVGIAHTRWATHGEPNAVNSHPQRSDKNNEFVVIHNGIITNYKDLKKFLESKGYEFESETDTETIPKLLKYMYDNRESDEISLSTLVERVTQQLEGAFALVFKSVHFPGQLVGTRRGGPLLIGVQSKHKLSTDHIPVLYRCGCNTGGKEKKAVSTLPRVDGDTCLYPIGEETGVEYYFASDASAIIEHTNRVIFLEDDDVAAIVDGRLSIHRIKRTAGDDPARAIQTLQMELQQIMKGSYSSFMQKEIFEQPESVVNTMRGRVNFDDFTVLLGGLKDHIREIRRCRRLIVIGCGTSYHAGVATRQILEELTELPVMVELSSDFLDRNT 415          

HSP 2 Score: 350.903 bits (899), Expect = 0.000e+0
Identity = 166/263 (63.12%), Postives = 214/263 (81.37%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFI--TTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL YC++RGAL VG+TN VGS+ISR++ CG+HINAGPE+GVASTKAYTSQFV+LVM +L++ +DR  M+ RR+EI++ L  LP LIKEVL  +  + ++A EL  +RS+L+MGRG+NYATC+EGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IMI+ KD   TK  NA+ +V+ARKG+PI I    ++  K L Y    + +P TVDCLQGVL+VIPLQ+LS++LA L+GFD+D PRNLAKSVTVE
Sbjct:  427 SQSGETADTLMALHYCKERGALTVGVTNTVGSSISRETDCGIHINAGPEVGVASTKAYTSQFVALVMFSLMMCDDRLSMQKRRQEIISALRTLPDLIKEVLALDDQINSLAHELYQQRSLLVMGRGFNYATCMEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMKDPTHTKCQNALQQVVARKGRPILICEKNDDESKLLAYRT--IELPHTVDCLQGVLTVIPLQLLSFHLAVLRGFDVDFPRNLAKSVTVE 687          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Sea Lamprey
Match: gfpt2 (glutamine-fructose-6-phosphate transaminase 2 [Source:ZFIN;Acc:ZDB-GENE-071113-1])

HSP 1 Score: 458.759 bits (1179), Expect = 0.000e+0
Identity = 233/423 (55.08%), Postives = 301/423 (71.16%), Query Frame = 3
Query:   66 GIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKN------INGE-IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY----SGDNF----------------ITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            GIFAYLN+  P+ R +I+E LI GL+RLEYRGYDSAG+A D         N E I L + +GKV +L+E +  Q KD++ D E + H GIAHTRWATHG PS  NSHP RSD++NEF+VIHNGIITNY+ +K+ L  K + FE++TDTE IPKL+K  YDNR  +++ F  LVE V+ +LEG+FA+V KS+H+PGE+V  RRGSPLLVG+RS+   + D IPI Y     G +F                I+   + T  + +G +  VEY+FASDASAI+EHTNKVI+LEDDDVAA+ DG L +HR+ R A D   R V TL ME++QIMKG++  FM+KEI++QPES++NTMRGRVNFE   ++LGGL +H+  I RCRRL+ IGCGTSYH+ +ATR  +EELTELPVMVELA +   + T
Sbjct:    3 GIFAYLNHQVPVNRRQILETLIKGLQRLEYRGYDSAGIAIDGGNSKDWEKNAEHITLIKKRGKVKALDEEIYKQ-KDLEMDLEFKCHVGIAHTRWATHGEPSSVNSHPHRSDKDNEFVVIHNGIITNYKELKKFLESKNYLFESETDTESIPKLIKYMYDNREKDDIRFSVLVERVVQQLEGAFAIVVKSSHYPGEVVCARRGSPLLVGVRSN-GFSADEIPIRYRKGREGGSFVAGSLGYSGSHEKAVLISENSTDTSFNHLGDDVAVEYYFASDASAIIEHTNKVIFLEDDDVAAVLDGHLSIHRIKRKAGDQSARAVQTLEMEMQQIMKGSYSSFMQKEIFEQPESIMNTMRGRVNFEDFTVMLGGLKDHIKEIMRCRRLILIGCGTSYHACIATRQTLEELTELPVMVELASDFLDRST 423          

HSP 2 Score: 349.362 bits (895), Expect = 0.000e+0
Identity = 160/261 (61.30%), Postives = 209/261 (80.08%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC+ RGAL VGITN VGS+I R++ CGVH+NAGPEIGVASTKAYTSQFV+LVM  L++SEDR  ++ RR EI+  +H LP LI+EVL  +  +  +++EL  ERS+L+MGRGY+Y+TC+EGALK+KE+ Y+HSEGI++GELKHGPLAL+D +M +IMI  KD  + K  NA+ +V+AR+G+PI +      +  K     V +P TVDCLQG+L++IPLQ+LS +LA L+GFD+DCPRNLAKSVTVE
Sbjct:  435 SQSGETADTLMALRYCKDRGALTVGITNTVGSSICRETDCGVHVNAGPEIGVASTKAYTSQFVALVMFGLMMSEDRISLQERRREIIGAMHALPDLIREVLSLDEKMLELSQELYQERSLLVMGRGYHYSTCMEGALKIKEITYMHSEGILAGELKHGPLALIDKNMPVIMIAMKDPTYIKCQNALQQVVARQGRPILLCDKGDEEIAKQAYRAVGLPHTVDCLQGILTIIPLQLLSLHLANLRGFDVDCPRNLAKSVTVE 695          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Sea Lamprey
Match: gfpt2 (glutamine-fructose-6-phosphate transaminase 2 [Source:ZFIN;Acc:ZDB-GENE-071113-1])

HSP 1 Score: 454.136 bits (1167), Expect = 0.000e+0
Identity = 230/420 (54.76%), Postives = 295/420 (70.24%), Query Frame = 3
Query:   66 GIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKN------INGE-IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDN-------------------------FITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            GIFAYLN+  P+ R +I+E LI GL+RLEYRGYDSAG+A D         N E I L + +GKV +L+E +  Q KD++ D E + H GIAHTRWATHG PS  NSHP RSD++NEF+VIHNGIITNY+ +K+ L  K + FE++TDTE IPKL+K  YDNR  +++ F  LVE V+ +LEG+FA+V KS+H+PGE+V  RRGSPLLVG+RS+   + D IPI Y                              I+   + T  + +G +  VEY+FASDASAI+EHTNKVI+LEDDDVAA+ DG L +HR+ R A D   R V TL ME++QIMKG++  FM+KEI++QPES++NTMRGRVNFE   ++LGGL +H+  I RCRRL+ IGCGTSYH+ +ATR  +EELTELPVMVELA
Sbjct:    3 GIFAYLNHQVPVNRRQILETLIKGLQRLEYRGYDSAGIAIDGGNSKDWEKNAEHITLIKKRGKVKALDEEIYKQ-KDLEMDLEFKCHVGIAHTRWATHGEPSSVNSHPHRSDKDNEFVVIHNGIITNYKELKKFLESKNYLFESETDTESIPKLIKYMYDNREKDDIRFSVLVERVVQQLEGAFAIVVKSSHYPGEVVCARRGSPLLVGVRSN-GFSADEIPIRYRKGREGGLGQTVNVRVNVERGLCSHEKAVLISENSTDTSFNHLGDDVAVEYYFASDASAIIEHTNKVIFLEDDDVAAVLDGHLSIHRIKRKAGDQSARAVQTLEMEMQQIMKGSYSSFMQKEIFEQPESIMNTMRGRVNFEDFTVMLGGLKDHIKEIMRCRRLILIGCGTSYHACIATRQTLEELTELPVMVELA 420          

HSP 2 Score: 349.362 bits (895), Expect = 0.000e+0
Identity = 160/261 (61.30%), Postives = 209/261 (80.08%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC+ RGAL VGITN VGS+I R++ CGVH+NAGPEIGVASTKAYTSQFV+LVM  L++SEDR  ++ RR EI+  +H LP LI+EVL  +  +  +++EL  ERS+L+MGRGY+Y+TC+EGALK+KE+ Y+HSEGI++GELKHGPLAL+D +M +IMI  KD  + K  NA+ +V+AR+G+PI +      +  K     V +P TVDCLQG+L++IPLQ+LS +LA L+GFD+DCPRNLAKSVTVE
Sbjct:  440 SQSGETADTLMALRYCKDRGALTVGITNTVGSSICRETDCGVHVNAGPEIGVASTKAYTSQFVALVMFGLMMSEDRISLQERRREIIGAMHALPDLIREVLSLDEKMLELSQELYQERSLLVMGRGYHYSTCMEGALKIKEITYMHSEGILAGELKHGPLALIDKNMPVIMIAMKDPTYIKCQNALQQVVARQGRPILLCDKGDEEIAKQAYRAVGLPHTVDCLQGILTIIPLQLLSLHLANLRGFDVDCPRNLAKSVTVE 700          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Yeast
Match: GFA1 (Glutamine-fructose-6-phosphate amidotransferase; catalyzes the formation of glucosamine-6-P and glutamate from fructose-6-P and glutamine in the first step of chitin biosynthesis; GFA1 has a paralogous region, comprising ORFs YMR084W-YMR085W, that arose from the whole genome duplication [Source:SGD;Acc:S000001587])

HSP 1 Score: 390.193 bits (1001), Expect = 0.000e+0
Identity = 199/433 (45.96%), Postives = 274/433 (63.28%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDN--RTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDN-----------------------------------------FITRY-DSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIF Y NY+   +R +II+ L++GL+RLEYRGYDS G+A D +      +++  GKV +L+E +  Q  + D   + +H GIAHTRWATHG P + N HP RSD  ++F+V+HNGIITN++ +K +LI KG+KFE+DTDTE I KL    Y+   +   +L F +L ++V+ ELEGS+ L+ KS H+P E++ATR+GSPLL+G++S   L  D + + +  +N                                         F  R+  S   L   GS   VE+F +SDA+++V+HT KV++LEDDD+A I DG L +HR  R    S  R + TL MEL QIMKG +D FM+KEIY+QPES  NTMRGR+++E  ++ILGGL   L  +RR RRL+ I CGTSYHS LATRA+ EEL+++PV VELA
Sbjct:    1 MCGIFGYCNYLVERSRGEIIDTLVDGLQRLEYRGYDSTGIAIDGDEADSTFIYKQIGKVSALKEEITKQNPNRDVTFV-SHCGIAHTRWATHGRPEQVNCHPQRSDPEDQFVVVHNGIITNFRELKTLLINKGYKFESDTDTECIAKLYLHLYNTNLQNGHDLDFHELTKLVLLELEGSYGLLCKSCHYPNEVIATRKGSPLLIGVKSEKKLKVDFVDVEFPEENAGQPEIPLKSNNKSFGLGPKKAREFEAGSQNANLLPIAANEFNLRHSQSRAFLSEDGSPTPVEFFVSSDAASVVKHTKKVLFLEDDDLAHIYDGELHIHRSRREVGASMTRSIQTLEMELAQIMKGPYDHFMQKEIYEQPESTFNTMRGRIDYENNKVILGGLKAWLPVVRRARRLIMIACGTSYHSCLATRAIFEELSDIPVSVELA 432          

HSP 2 Score: 311.997 bits (798), Expect = 0.000e+0
Identity = 159/270 (58.89%), Postives = 208/270 (77.04%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNI-AEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFI-TTNEMVK-------DLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADT++AL YC +RGAL VGI N VGS+ISR + CGVHINAGPEIGVASTKAYTSQ+++LVM AL LS+DR     RR EI+ GL ++P  IK+VLK E  +K + A EL +++S+L++GRGY +A  LEGALK+KE++Y+HSEG+++GELKHG LALVD+++ II   ++D LF K +++I +V ARKG PI I   N+ V        DL+ LE    VPQTVDCLQG++++IPLQ++SY+LA  KG D+D PRNLAKSVTVE
Sbjct:  452 SQSGETADTMLALNYCLERGALTVGIVNSVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSDDRVSKIDRRIEIIQGLKLIPGQIKQVLKLEPRIKKLCATELKDQKSLLLLGRGYQFAAALEGALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVVSSIEQVTARKGHPIIICNENDEVWAQKSKSIDLQTLE----VPQTVDCLQGLINIIPLQLMSYWLAVNKGIDVDFPRNLAKSVTVE 717          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Yeast
Match: YMR085W_mRNA (Putative protein of unknown function; YMR085W and adjacent ORF YMR084W are merged in related strains, and together are paralogous to glutamine-fructose-6-phosphate amidotransferase GFA1 [Source:SGD;Acc:S000004690])

HSP 1 Score: 236.884 bits (603), Expect = 1.922e-99
Identity = 121/262 (46.18%), Postives = 177/262 (67.56%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNER-SILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTN-EMVKDLKYLETHVI---VPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKS 1996
            ++SGET DT+ AL YC K+ A+ +G+ N  GS+ISR + CGVH N GPE G+A+TK+YTSQ+++LVMIAL +SED      RR+EI+  L ++PS IKEVL+ E  +  + ++ L +  + L++GRGY +A+ LEGA K+KE++Y+HSE I++ EL H  LA+  D+  II   +KD    K  + I +++ RKG PI I      + +    + +V+   VPQTVDCLQG+L+VIPLQ++SY+LA  K   +D PR+ A S
Sbjct:  167 SRSGETTDTINALNYCIKKEAVTIGVVNCSGSSISRFTHCGVHTNTGPEKGIATTKSYTSQYIALVMIALWMSEDLVSKIERRKEIIQALTIVPSQIKEVLELEPLIIELCDKKLKQHDTFLLLGRGYQFASALEGASKMKEISYVHSESILTNELGHRVLAVASDNPPIIAFATKDAFSPKIASCIDQIIERKGNPIIICNKGHKIWEQDKQKGNVVTLEVPQTVDCLQGILNVIPLQLISYWLAIKKDIGVDLPRDSAMS 428          

HSP 2 Score: 144.05 bits (362), Expect = 1.922e-99
Identity = 69/150 (46.00%), Postives = 101/150 (67.33%), Query Frame = 3
Query:  786 VEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINL 1235
            +E++ +SD +++  + +KV+YLED+D+A I DG L +H    G+ D  FR V  L +EL +I KG +D FM+KEIY+Q E+  N MRGRV+  T  ++LGGL   LT +RR +R++ I    S+HS LA R + EEL E+PV VELA++ 
Sbjct:    1 MEFYLSSDCASLARYVSKVVYLEDNDIAHIYDGELHIHCSKIGSEDFSFRTVQKLELELSKIKKGPYDNFMQKEIYEQCETTKNVMRGRVDAFTNRVVLGGLENWLTELRRAKRIIMIASKASFHSCLAARPIFEELMEVPVNVELALDF 150          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Yeast
Match: YMR084W_mRNA (Putative protein of unknown function; YMR084W and adjacent ORF YMR085W are merged in related strains, and together are paralogous to glutamine-fructose-6-phosphate amidotransferase GFA1 [Source:SGD;Acc:S000004689])

HSP 1 Score: 198.749 bits (504), Expect = 6.141e-59
Identity = 97/221 (43.89%), Postives = 142/221 (64.25%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTD--ENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY 716
            MCGIF Y N++   TR +II+ LI GL+ LEY+ YDS+G++   +    + +++  GK+ SL+E + D      N    +H GIAHTR ATHG     N HP  SD +NEF+V+HNG+ITN+  +K +L+ KG+ F++DTDTE IPKL K  YD   +   NL F  L  +V+ ELEGS+ L+  S+HFP E+VA R+GSPL++G++    +  + + + Y
Sbjct:    1 MCGIFGYCNFLIEKTRGEIIDTLIEGLQALEYKEYDSSGISIQGDELESLNIYKQTGKISSLKEEI-DLYNLNKNLPFISHCGIAHTRRATHGGLRRANCHPHNSDPSNEFVVVHNGVITNFANLKALLMAKGYVFKSDTDTECIPKLYKHIYDTSIELGYNLDFHVLTNLVLKELEGSYGLLCTSSHFPDEVVAARKGSPLVIGVKGKTDMDVNFVEVEY 220          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Yeast
Match: ADE4 (Phosphoribosylpyrophosphate amidotransferase (PRPPAT); catalyzes first step of the 'de novo' purine nucleotide biosynthetic pathway; also known as amidophosphoribosyltransferase [Source:SGD;Acc:S000004915])

HSP 1 Score: 47.7506 bits (112), Expect = 4.363e-6
Identity = 56/245 (22.86%), Postives = 98/245 (40.00%), Query Frame = 3
Query:   60 MCGIFAYL--NYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEE--LVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFK-FETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVA--------TRRGSPLLVGIRSSHSLTTDHI----PIIYSGDNFITRY 743
            MCGI   +  N  TP+        L +G   L++RG D+AG          IA   ++G+++  +   + +D         +    GIAH R+ T G  +   + P   +      + HNG + N  ++K  +     +   TD+D+E    L+   +    +++  +R   E V   LEG + L        G +               PLL G R +   T D++     +++   NF T+Y
Sbjct:    1 MCGILGIVLANQTTPVAPE-----LCDGCIFLQHRGQDAAG----------IATCGSRGRIYQCKGNGMARDVFTQQRVSGLAGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGINLAHNGNLVNTASLKRYMDEDVHRHINTDSDSE----LLLNIFAAELEKHNKYRVNNEDVFHALEGVYRLCRGGYACVGLLAGFALFGFRDPNGIRPLLFGERENPDGTKDYMLASESVVFKAHNF-TKY 225          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Nematostella
Match: EDO31461 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXV0])

HSP 1 Score: 487.263 bits (1253), Expect = 0.000e+0
Identity = 244/417 (58.51%), Postives = 306/417 (73.38%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDEN--LSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY-SGDNFIT------RYDSMTELHPVG--SNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRL-NRGATDSQFRDVITLRMELKQIMKG--------NFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            MCGIFAYLN+  P  +  I+E LI GL+RLEYRGYDSAGVAFD N +  + + R KGKV SL + V+DQ +    DE + H GIAHTRWATHG PSE+NSHP  S + N+F+V+HNGIITNY+ IK  L  KGFKF++DTDTEVIPKL+K  +D    EN  + FRQLVEM +++LEG+FAL FKS HFPGEIVATRRGSPLL+GIRSS  L  D +PIIY SGD  +        Y   T    +     K +EY+FASDASA++EHTNKVI+LED+DVAA+ +G L +HR  N   +D  +RDV TL +EL+QIMKG        N+  FM+KEI++QPESV+NTMRGRVNFET +++LGG+  H+  IRRCRR+M I CGTS+HSA+ATR ++EELTELPV+VELA +   ++T
Sbjct:    1 MCGIFAYLNFCVPRKKRYILETLIKGLQRLEYRGYDSAGVAFDGN-DAVMKIVRKKGKVASLAKAVQDQEEIKCMDECDVHVGIAHTRWATHGEPSERNSHPQCSGKENDFVVVHNGIITNYKDIKTFLESKGFKFDSDTDTEVIPKLVKYIFDKTKAENKKMEFRQLVEMAMTQLEGAFALAFKSKHFPGEIVATRRGSPLLIGIRSSAPLKADKLPIIYNSGDKMMAGVYGEPEYADETGWSSLAREEGKPIEYYFASDASAVIEHTNKVIFLEDNDVAAVVNGNLSIHRFKNNDESDDYYRDVQTLHLELQQIMKGKSTMLFTWNYASFMQKEIFEQPESVVNTMRGRVNFETNQVVLGGMKAHIGTIRRCRRIMLIACGTSFHSAVATRQIIEELTELPVVVELASDFLDRRT 416          

HSP 2 Score: 197.208 bits (500), Expect = 0.000e+0
Identity = 89/137 (64.96%), Postives = 117/137 (85.40%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGAL 1636
            +QSGETADTLMAL+YC++RGALIVGITN VGS+ISR+S CG HINAGPEIGVASTKAYTSQF++LVM AL++SEDR  M+ +R+EI+  L  LP LIK+VL+ +  ++ ++ E+  ++S+L+MGRGY ++TCLEGAL
Sbjct:  428 SQSGETADTLMALRYCKERGALIVGITNTVGSSISRESACGCHINAGPEIGVASTKAYTSQFLALVMFALMMSEDRISMQEKRKEIIKTLKELPDLIKQVLQLDEQIQTLSREIYQQKSLLVMGRGYQFSTCLEGAL 564          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Nematostella
Match: EDO25764 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVJ5])

HSP 1 Score: 219.55 bits (558), Expect = 6.433e-66
Identity = 110/263 (41.83%), Postives = 179/263 (68.06%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEI--VNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTL A++  +++GA + GI NVVGSTI+R++  G++ +AGPEIGVASTKA+T+Q   L M+A+ L+++   + T  E    ++ L VL   + E +K    +K+I+    +  + + +GRGYN+   LEGALK+KE++YIH+EG  + E+KHGP+AL+D+ M  +++ + +K + K ++ + E+ ARKG  + +      K  +  +  + +P+T + +  +++ IPLQ+LSY++A +KG D+D PRNLAKSVTVE
Sbjct:   20 SQSGETADTLAAIELAKEKGAFVFGICNVVGSTIAREADAGMYTHAGPEIGVASTKAFTTQLTCLYMLAVELAKNNERL-TPAEYWGHLSELAVLEERVAETIKLNENIKDISSSFESAANFMYLGRGYNFPIALEGALKLKEISYIHAEGYPAAEMKHGPIALIDEKMPCLILANTEKGYEKVISNMQEIKARKGYVVAVAYEGDNKVSEIADEVIYIPKTNEQISAIIATIPLQLLSYHIAVIKGCDVDQPRNLAKSVTVE 281          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Nematostella
Match: EDO28779 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5I3])

HSP 1 Score: 77.0258 bits (188), Expect = 1.325e-17
Identity = 36/53 (67.92%), Postives = 45/53 (84.91%), Query Frame = 2
Query: 1850 KYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            K+LE    VP  VDCLQG+L+VIPLQ+LS+++A L+GFD+D PRNLAKSVTVE
Sbjct:   15 KFLE----VPHVVDCLQGILTVIPLQLLSFHIAVLRGFDVDFPRNLAKSVTVE 63          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Nematostella
Match: EDO29937 (Amidophosphoribosyltransferase [Source:UniProtKB/TrEMBL;Acc:A7T274])

HSP 1 Score: 58.9214 bits (141), Expect = 4.872e-9
Identity = 44/151 (29.14%), Postives = 72/151 (47.68%), Query Frame = 3
Query:   63 CGIFAYLNY--MTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDEN-NEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLM 506
            CGIFA +    ++P     +  ++  GL  L++RG +SAG+      N     +  KG       +V +  +D    E+E   GI HTR++T G     N  P   D   +   V HNG + N  +++  ++ +G    T +DTEVI +L+
Sbjct:   14 CGIFACVAAKGVSP-EEADVANVICLGLVGLQHRGQESAGIV----TNDGNRFYTKKGM-----GMVSNIFQDGCLKELEGCMGIGHTRYSTAGSSELLNCQPFVVDTVFSHIAVAHNGELINATSLRNRMLHQGIGLSTGSDTEVITQLL 154          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Medaka
Match: gfpt1 (glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 [Source:NCBI gene;Acc:101170101])

HSP 1 Score: 506.908 bits (1304), Expect = 0.000e+0
Identity = 251/404 (62.13%), Postives = 308/404 (76.24%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-------IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY--SGD-----NFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY  P TR +I+EILI GL+RLEYRGYDSAGV  D   N E       I L + +GKV +L+E +  + +DID D E + H GIAHTRWATHG+PS  NSHP RSD+NNEFIVIHNGIITNY+ +K+ L  KG++FE++TDTE I KL K  YDNR +++LSF  LVE VI +LEG+FALVFKS H+PGE V TRRG PLL+G+RS H L++DHIP++Y  SG      N I R D  T L PV   K VEYFFASDASA++EHTN+VI+LEDDDVAA+ +G L +HR+ R A D   R + TL+MEL+QIMKGNF  FM+KEI++QPESV+NTMRGRVNF+   +ILGGL +H+  I+RCRRL+ I CGTSYH+ +ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYHVPRTRREILEILIKGLQRLEYRGYDSAGVGIDGGNNKEWESNAKSIHLIKQRGKVKALDEEIHKE-QDIDLDVEFDVHLGIAHTRWATHGVPSPMNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKGYEFESETDTESIAKLTKYMYDNRENDDLSFATLVERVIQQLEGAFALVFKSVHYPGEAVGTRRGGPLLMGVRSDHKLSSDHIPVLYRSSGKDKKSCNSIPRTDQDTCLFPV-DEKAVEYFFASDASAVIEHTNRVIFLEDDDVAAVVEGRLSIHRIKRSAGDYPARAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVVNTMRGRVNFDDNTVILGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELA 402          

HSP 2 Score: 349.362 bits (895), Expect = 0.000e+0
Identity = 161/256 (62.89%), Postives = 209/256 (81.64%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAK 1993
            +QSGETAD+LMAL+YC++R AL VGITN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQFV+L+M AL++ +DR  M+ RR EI+ GL VLP LIKEVL  +  ++ +A EL   +S+LIMGRGY+YATCLEGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IMI+ +D  +TK  NA+ +V+AR+G+PI I   +  + ++     + VPQ VDCLQG+LSVIPLQ+LS++LA L+G+D+DCPRNLAK
Sbjct:  422 SQSGETADSLMALRYCKERSALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVALIMFALLMCDDRISMQPRRREIIQGLRVLPDLIKEVLSLDDEIQKLAAELYENKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYTKCQNALQQVVARQGRPIVICDKDDQETIRNSCRSIKVPQCVDCLQGILSVIPLQLLSFHLAVLRGYDVDCPRNLAK 677          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Medaka
Match: gfpt2 (glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Source:NCBI gene;Acc:101160918])

HSP 1 Score: 506.523 bits (1303), Expect = 0.000e+0
Identity = 247/406 (60.84%), Postives = 310/406 (76.35%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFD-------KNINGEIALFRNKGKVFSL-EELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNFI---------TRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLN+  P TR +I E L+ GL+RLEYRGYDSAGVA D        + N  I L + KGKV +L EEL K+   D++ +E+ TH G+AHTRWATHG PS  NSHP RSD+NNEF+VIHNGIITNY+ +KE LI KG++FE++TDTEVIPKL+K  YDNR ++ ++F  LVE VI +LEG+FALVFKS H+PG+ VATRRGSPLL+G+RS H L T+ IPI Y+   F           R DS   ++ VG  + VEY+FASDASAI+EHTNKV+YLEDDDVA +  G L +HR+NR A +   R + TL+ME++QIMKGNFD FM+KEI++QPESV+NTMRGR+ FET  ++LGGL +HL  I+RCRRL+ IGCGTS+H+A+ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYLNHQVPRTRKEIFETLVKGLQRLEYRGYDSAGVAVDGPNKTSTDSNNNYIRLIKKKGKVKALDEELHKNNSLDLE-EELSTHFGLAHTRWATHGEPSALNSHPQRSDKNNEFVVIHNGIITNYKELKEYLITKGYEFESETDTEVIPKLLKYVYDNRENDKVTFSTLVERVIQQLEGAFALVFKSQHYPGDAVATRRGSPLLIGVRSEHELLTEQIPIQYNSGQFKEGVQEKNSHNRSDS--SINSVGDGRAVEYYFASDASAIIEHTNKVLYLEDDDVAVVTGGKLSIHRINRQAGEDPVRAIQTLQMEMQQIMKGNFDAFMQKEIFEQPESVVNTMRGRICFETNRVLLGGLKDHLKEIKRCRRLIVIGCGTSFHAAVATRQMLEELTELPVMVELA 403          

HSP 2 Score: 361.688 bits (927), Expect = 0.000e+0
Identity = 165/261 (63.22%), Postives = 213/261 (81.61%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC++RGAL  GITN VGS+I R++ CGVH+NAGPEIGVASTKAYTSQFV+L+M  L++SEDR  ++ RR EI+ GL VLP LIK VL  +  +K+IA+EL  +RS+L+MGRGYNYATCLEGALK+KE+ Y+HSEGI++GELKHGPLAL+D HM +IMI+ +D  + K  NA+ +V AR G+PI I + +    +K     + +P TVDCLQG+LSVIPLQ+LS++LA ++G+D+DCPRNLAKSVTVE
Sbjct:  423 SQSGETADTLMALRYCKERGALTAGITNTVGSSICRETDCGVHVNAGPEIGVASTKAYTSQFVALIMFGLMMSEDRLSLQKRRLEIIEGLKVLPDLIKNVLSLDKKIKDIAQELYEQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKHMPVIMIIMRDACYIKCQNALQQVTARSGRPIIICSQDDSDVMKNAYQTIELPHTVDCLQGILSVIPLQLLSFHLAVMRGYDVDCPRNLAKSVTVE 683          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Medaka
Match: gfpt1 (glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 [Source:NCBI gene;Acc:101170101])

HSP 1 Score: 506.523 bits (1303), Expect = 0.000e+0
Identity = 251/404 (62.13%), Postives = 308/404 (76.24%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGE-------IALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY--SGD-----NFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            MCGIFAYLNY  P TR +I+EILI GL+RLEYRGYDSAGV  D   N E       I L + +GKV +L+E +  + +DID D E + H GIAHTRWATHG+PS  NSHP RSD+NNEFIVIHNGIITNY+ +K+ L  KG++FE++TDTE I KL K  YDNR +++LSF  LVE VI +LEG+FALVFKS H+PGE V TRRG PLL+G+RS H L++DHIP++Y  SG      N I R D  T L PV   K VEYFFASDASA++EHTN+VI+LEDDDVAA+ +G L +HR+ R A D   R + TL+MEL+QIMKGNF  FM+KEI++QPESV+NTMRGRVNF+   +ILGGL +H+  I+RCRRL+ I CGTSYH+ +ATR ++EELTELPVMVELA
Sbjct:    1 MCGIFAYLNYHVPRTRREILEILIKGLQRLEYRGYDSAGVGIDGGNNKEWESNAKSIHLIKQRGKVKALDEEIHKE-QDIDLDVEFDVHLGIAHTRWATHGVPSPMNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKGYEFESETDTESIAKLTKYMYDNRENDDLSFATLVERVIQQLEGAFALVFKSVHYPGEAVGTRRGGPLLMGVRSDHKLSSDHIPVLYRSSGKDKKSCNSIPRTDQDTCLFPV-DEKAVEYFFASDASAVIEHTNRVIFLEDDDVAAVVEGRLSIHRIKRSAGDYPARAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVVNTMRGRVNFDDNTVILGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELA 402          

HSP 2 Score: 357.451 bits (916), Expect = 0.000e+0
Identity = 166/261 (63.60%), Postives = 214/261 (81.99%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETAD+LMAL+YC++R AL VGITN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQFV+L+M AL++ +DR  M+ RR EI+ GL VLP LIKEVL  +  ++ +A EL   +S+LIMGRGY+YATCLEGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IMI+ +D  +TK  NA+ +V+AR+G+PI I   +  + ++     + VPQ VDCLQG+LSVIPLQ+LS++LA L+G+D+DCPRNLAKSVTVE
Sbjct:  422 SQSGETADSLMALRYCKERSALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVALIMFALLMCDDRISMQPRRREIIQGLRVLPDLIKEVLSLDDEIQKLAAELYENKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYTKCQNALQQVVARQGRPIVICDKDDQETIRNSCRSIKVPQCVDCLQGILSVIPLQLLSFHLAVLRGYDVDCPRNLAKSVTVE 682          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Medaka
Match: gfpt1 (glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 [Source:NCBI gene;Acc:101170101])

HSP 1 Score: 490.345 bits (1261), Expect = 0.000e+0
Identity = 249/407 (61.18%), Postives = 304/407 (74.69%), Query Frame = 3
Query:   60 MCGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEI--ALFRNKGKVFSLEELVKDQLKDIDND-EIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIY--SGD-----NFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            MC IFAYLNY  P TR +I+EILI GL+RLEYRGYDSAG   D  +N      LF+     FSL E +  Q  DID D E + H GIAHTRWATHG+PS  NSHP RSD+NNEFIVIHNGIITNY+ +K+ L  KG++FE++TDTE I KL K  YDNR +++LSF  LVE VI +LEG+FALVFKS H+PGE V TRRG PLL+G+RS H L++DHIP++Y  SG      N I R D  T L PV   K VEYFFASDASA++EHTN+VI+LEDDDVAA+ +G L +HR+ R A D   R + TL+MEL+QIMKGNF  FM+KEI++QPESV+NTMRGRVNF+   +ILGGL +H+  I+RCRRL+ I CGTSYH+ +ATR ++EELTELPVMVELA +   + T
Sbjct:    1 MCRIFAYLNYHVPRTRREILEILIKGLQRLEYRGYDSAGET-DPRLNCSCFYLLFKFISIFFSLTEKLFKQ--DIDLDVEFDVHLGIAHTRWATHGVPSPMNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKGYEFESETDTESIAKLTKYMYDNRENDDLSFATLVERVIQQLEGAFALVFKSVHYPGEAVGTRRGGPLLMGVRSDHKLSSDHIPVLYRSSGKDKKSCNSIPRTDQDTCLFPV-DEKAVEYFFASDASAVIEHTNRVIFLEDDDVAAVVEGRLSIHRIKRSAGDYPARAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVVNTMRGRVNFDDNTVILGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNT 403          

HSP 2 Score: 357.836 bits (917), Expect = 0.000e+0
Identity = 166/261 (63.60%), Postives = 214/261 (81.99%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETAD+LMAL+YC++R AL VGITN VGS+ISR++ CGVHINAGPEIGVASTKAYTSQFV+L+M AL++ +DR  M+ RR EI+ GL VLP LIKEVL  +  ++ +A EL   +S+LIMGRGY+YATCLEGALK+KE+ Y+HSEGI++GELKHGPLALVD  M +IMI+ +D  +TK  NA+ +V+AR+G+PI I   +  + ++     + VPQ VDCLQG+LSVIPLQ+LS++LA L+G+D+DCPRNLAKSVTVE
Sbjct:  415 SQSGETADSLMALRYCKERSALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVALIMFALLMCDDRISMQPRRREIIQGLRVLPDLIKEVLSLDDEIQKLAAELYENKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYTKCQNALQQVVARQGRPIVICDKDDQETIRNSCRSIKVPQCVDCLQGILSVIPLQLLSFHLAVLRGYDVDCPRNLAKSVTVE 675          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Medaka
Match: gfpt2 (glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Source:NCBI gene;Acc:101160918])

HSP 1 Score: 467.233 bits (1201), Expect = 0.000e+0
Identity = 232/394 (58.88%), Postives = 296/394 (75.13%), Query Frame = 3
Query:   69 IFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFD-------KNINGEIALFRNKGKVFSL-EELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA 1226
            IFAYLN+  P TR +I E L+ GL+RLEYRGYDSAGVA D        + N  I L + KGKV +L EEL K+   D++ +E+ TH G+AHTRWATHG PS  NSHP RSD+NNEF+VIHNGIITNY+ +KE LI KG++FE++TDTEVIPKL+K  YDNR ++ ++F  LVE VI +LEG+FALVFKS H+PG+ VATRRGSPLL+G+RS H L T+ IPI Y+         S   L P   ++ +       ++AI+EHTNKV+YLEDDDVA +  G L +HR+NR A +   R + TL+ME++QIMKGNFD FM+KEI++QPESV+NTMRGR+ FET  ++LGGL +HL  I+RCRRL+ IGCGTS+H+A+ATR ++EELTELPVMVELA
Sbjct:    3 IFAYLNHQVPRTRKEIFETLVKGLQRLEYRGYDSAGVAVDGPNKTSTDSNNNYIRLIKKKGKVKALDEELHKNNSLDLE-EELSTHFGLAHTRWATHGEPSALNSHPQRSDKNNEFVVIHNGIITNYKELKEYLITKGYEFESETDTEVIPKLLKYVYDNRENDKVTFSTLVERVIQQLEGAFALVFKSQHYPGDAVATRRGSPLLIGVRSEHELLTEQIPIQYNSGEL----RSSPRLLPHSLHECL------ISAAIIEHTNKVLYLEDDDVAVVTGGKLSIHRINRQAGEDPVRAIQTLQMEMQQIMKGNFDAFMQKEIFEQPESVVNTMRGRICFETNRVLLGGLKDHLKEIKRCRRLIVIGCGTSFHAAVATRQMLEELTELPVMVELA 385          

HSP 2 Score: 361.688 bits (927), Expect = 0.000e+0
Identity = 165/261 (63.22%), Postives = 213/261 (81.61%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMAL+YC++RGAL  GITN VGS+I R++ CGVH+NAGPEIGVASTKAYTSQFV+L+M  L++SEDR  ++ RR EI+ GL VLP LIK VL  +  +K+IA+EL  +RS+L+MGRGYNYATCLEGALK+KE+ Y+HSEGI++GELKHGPLAL+D HM +IMI+ +D  + K  NA+ +V AR G+PI I + +    +K     + +P TVDCLQG+LSVIPLQ+LS++LA ++G+D+DCPRNLAKSVTVE
Sbjct:  405 SQSGETADTLMALRYCKERGALTAGITNTVGSSICRETDCGVHVNAGPEIGVASTKAYTSQFVALIMFGLMMSEDRLSLQKRRLEIIEGLKVLPDLIKNVLSLDKKIKDIAQELYEQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKHMPVIMIIMRDACYIKCQNALQQVTARSGRPIIICSQDDSDVMKNAYQTIELPHTVDCLQGILSVIPLQLLSFHLAVMRGYDVDCPRNLAKSVTVE 665          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Planmine SMEST
Match: SMESG000073848.1 (SMESG000073848.1)

HSP 1 Score: 794.267 bits (2050), Expect = 0.000e+0
Identity = 381/387 (98.45%), Postives = 383/387 (98.97%), Query Frame = 3
Query:   90 MTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            MTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA +L  + T
Sbjct:    1 MTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELASDLLDRNT 387          

HSP 2 Score: 528.48 bits (1360), Expect = 0.000e+0
Identity = 260/261 (99.62%), Postives = 261/261 (100.00%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE
Sbjct:  399 SQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 659          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Planmine SMEST
Match: SMESG000073848.1 (SMESG000073848.1)

HSP 1 Score: 786.949 bits (2031), Expect = 0.000e+0
Identity = 378/384 (98.44%), Postives = 380/384 (98.96%), Query Frame = 3
Query:   99 MTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELAINLEKQQT 1250
            MTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELA +L  + T
Sbjct:    1 MTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNFITRYDSMTELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHRLNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGRVNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTELPVMVELASDLLDRNT 384          

HSP 2 Score: 528.48 bits (1360), Expect = 0.000e+0
Identity = 260/261 (99.62%), Postives = 261/261 (100.00%), Query Frame = 2
Query: 1226 NQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 2008
            +QSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE
Sbjct:  396 SQSGETADTLMALKYCQKRGALIVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVLSEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILIMGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMIVSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVDCLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE 656          
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Planmine SMEST
Match: SMESG000000843.1 (SMESG000000843.1)

HSP 1 Score: 66.2402 bits (160), Expect = 4.086e-11
Identity = 47/189 (24.87%), Postives = 92/189 (48.68%), Query Frame = 3
Query:   63 CGIFAYLNYMTPMTRHKIIEILINGLKRLEYRGYDSAGVAFDKNINGEIALFRNKG-----KVFSLEELVKDQLKDIDNDEIETHSGIAHTRWATHGIPSEKNSHPLRSDEN-NEFIVIHNGIITNYQAIKEILIRKGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALVFKS 611
            CGIF  +      +  +   I+  GL  L++RG +SAG+       GE +L+ ++G     ++F +E L K          +  + GI HTR++T G     N  P   +    +F V HNG + N   +K+ ++++G    + TD+EVI +++ Q         +++   ++ ++ + + +++LV  S
Sbjct:   10 CGIFGCVAANPWPSDLETANIISMGLVGLQHRGQESAGIVTS---TGEESLYHHRGMGLVNQLFDVETLTK----------LNGNLGIGHTRYSTVGASERTNCQPFIVESTYGQFAVAHNGELVNGSILKKKILQQGIGLSSGTDSEVITQILCQTPKCGEPYGVNWPSRIQHLMLQTQLAYSLVILS 185          
The following BLAST results are available for this feature:
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GFPT20.000e+061.98glutamine-fructose-6-phosphate transaminase 2 [Sou... [more]
GFPT10.000e+062.28glutamine--fructose-6-phosphate transaminase 1 [So... [more]
GFPT10.000e+059.62glutamine--fructose-6-phosphate transaminase 1 [So... [more]
GFPT21.022e-7156.16glutamine-fructose-6-phosphate transaminase 2 [Sou... [more]
PPAT2.097e-924.04phosphoribosyl pyrophosphate amidotransferase [Sou... [more]
back to top
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gfat-20.000e+051.36Glutamine-Fructose 6-phosphate AminoTransferase ho... [more]
gfat-20.000e+051.36Glutamine-Fructose 6-phosphate AminoTransferase ho... [more]
gfat-10.000e+050.90Glutamine-Fructose 6-phosphate AminoTransferase ho... [more]
gfat-10.000e+050.90Glutamine-Fructose 6-phosphate AminoTransferase ho... [more]
gfat-10.000e+050.90Glutamine-Fructose 6-phosphate AminoTransferase ho... [more]
back to top
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gfat10.000e+056.93gene:FBgn0027341 transcript:FBtr0113692[more]
Gfat10.000e+057.54gene:FBgn0027341 transcript:FBtr0302849[more]
Gfat20.000e+057.64gene:FBgn0039580 transcript:FBtr0085297[more]
Gfat10.000e+055.69gene:FBgn0027341 transcript:FBtr0302848[more]
Gfat10.000e+055.29gene:FBgn0027341 transcript:FBtr0113694[more]
back to top
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gfpt10.000e+060.40glutamine--fructose-6-phosphate transaminase 1 [So... [more]
gfpt20.000e+059.70glutamine-fructose-6-phosphate transaminase 2 [Sou... [more]
gfpt13.096e-3357.14glutamine--fructose-6-phosphate transaminase 1 [So... [more]
ppat5.776e-1226.49phosphoribosyl pyrophosphate amidotransferase [Sou... [more]
back to top
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gfpt20.000e+062.25glutamine-fructose-6-phosphate transaminase 2 [Sou... [more]
gfpt20.000e+060.25glutamine-fructose-6-phosphate transaminase 2 [Sou... [more]
gfpt20.000e+058.45glutamine-fructose-6-phosphate transaminase 2 [Sou... [more]
GFPT10.000e+062.19glutamine--fructose-6-phosphate transaminase 1 [So... [more]
gfpt20.000e+058.57glutamine-fructose-6-phosphate transaminase 2 [Sou... [more]
back to top
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gfpt20.000e+061.98glutamine fructose-6-phosphate transaminase 2 [Sou... [more]
Gfpt10.000e+061.54glutamine fructose-6-phosphate transaminase 1 [Sou... [more]
Gfpt10.000e+059.19glutamine fructose-6-phosphate transaminase 1 [Sou... [more]
Gfpt18.436e-3558.12glutamine fructose-6-phosphate transaminase 1 [Sou... [more]
Gfpt12.275e-1376.32glutamine fructose-6-phosphate transaminase 1 [Sou... [more]
back to top
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08DQ2|GFPT2_BOVIN0.000e+062.13Glutamine--fructose-6-phosphate aminotransferase [... [more]
sp|Q9Z2Z9|GFPT2_MOUSE0.000e+061.98Glutamine--fructose-6-phosphate aminotransferase [... [more]
sp|O94808|GFPT2_HUMAN0.000e+061.98Glutamine--fructose-6-phosphate aminotransferase [... [more]
sp|Q4KMC4|GFPT2_RAT0.000e+061.73Glutamine--fructose-6-phosphate aminotransferase [... [more]
sp|P82808|GFPT1_RAT0.000e+061.79Glutamine--fructose-6-phosphate aminotransferase [... [more]
back to top
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZXV30.000e+061.52Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A0N7Z9G60.000e+062.56Putative glucosamine 6-phosphate synthetase OS=Rho... [more]
K1QYG70.000e+061.27Glucosamine--fructose-6-phosphate aminotransferase... [more]
A0A1S3IWU40.000e+061.48glutamine--fructose-6-phosphate aminotransferase [... [more]
A0A1S3IXG40.000e+061.48glutamine--fructose-6-phosphate aminotransferase [... [more]
back to top
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gfpt20.000e+061.69glutamine--fructose-6-phosphate aminotransferase [... [more]
gfpt20.000e+061.69glutamine--fructose-6-phosphate aminotransferase [... [more]
gfpt10.000e+060.20glutamine--fructose-6-phosphate aminotransferase [... [more]
gfpt20.000e+060.00glutamine--fructose-6-phosphate aminotransferase [... [more]
gfpt10.000e+055.96glutamine--fructose-6-phosphate aminotransferase [... [more]
back to top
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gfpt20.000e+057.69glutamine-fructose-6-phosphate transaminase 2 [Sou... [more]
gfpt20.000e+055.08glutamine-fructose-6-phosphate transaminase 2 [Sou... [more]
gfpt20.000e+054.76glutamine-fructose-6-phosphate transaminase 2 [Sou... [more]
back to top
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
GFA10.000e+045.96Glutamine-fructose-6-phosphate amidotransferase; c... [more]
YMR085W_mRNA1.922e-9946.18Putative protein of unknown function; YMR085W and ... [more]
YMR084W_mRNA6.141e-5943.89Putative protein of unknown function; YMR084W and ... [more]
ADE44.363e-622.86Phosphoribosylpyrophosphate amidotransferase (PRPP... [more]
back to top
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO314610.000e+058.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO257646.433e-6641.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO287791.325e-1767.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299374.872e-929.14Amidophosphoribosyltransferase [Source:UniProtKB/... [more]
back to top
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gfpt10.000e+062.13glutamine--fructose-6-phosphate aminotransferase [... [more]
gfpt20.000e+060.84glutamine--fructose-6-phosphate aminotransferase [... [more]
gfpt10.000e+062.13glutamine--fructose-6-phosphate aminotransferase [... [more]
gfpt10.000e+061.18glutamine--fructose-6-phosphate aminotransferase [... [more]
gfpt20.000e+058.88glutamine--fructose-6-phosphate aminotransferase [... [more]
back to top
BLAST of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000073848.10.000e+098.45SMESG000073848.1[more]
SMESG000073848.10.000e+098.44SMESG000073848.1[more]
SMESG000000843.14.086e-1124.87SMESG000000843.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025303 ID=SMED30025303|Name=Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2227bp
CAAAATTTGCTTCAATTACTAATTACTCATTGCTGTTTTTATATTTGAAT
TTCATCATCATGTGTGGAATATTTGCTTACTTGAATTATATGACTCCGAT
GACAAGACATAAGATTATAGAAATATTAATAAATGGCTTGAAAAGATTAG
AATATAGAGGATATGATTCAGCTGGAGTTGCTTTCGATAAGAATATTAAT
GGGGAAATCGCACTATTTAGAAATAAAGGCAAAGTTTTTAGTTTAGAAGA
ATTAGTTAAAGACCAACTCAAGGACATAGATAACGATGAAATTGAGACAC
ACAGTGGAATTGCTCACACTAGATGGGCAACTCACGGTATTCCTAGTGAA
AAGAACAGTCATCCACTTCGATCTGATGAAAATAACGAATTTATAGTTAT
TCACAACGGAATAATTACAAATTATCAAGCTATCAAAGAGATATTAATAC
GCAAAGGATTTAAGTTTGAAACCGACACTGACACCGAGGTTATTCCCAAA
CTGATGAAACAGTTCTACGATAATCGCACGGATGAAAATTTATCATTTCG
ACAATTAGTAGAAATGGTCATATCAGAATTGGAAGGATCTTTCGCTTTGG
TTTTCAAGAGCACTCATTTCCCCGGTGAAATTGTGGCCACTCGGCGTGGA
AGTCCTTTGCTTGTTGGTATTAGAAGCTCACACAGTCTTACAACAGATCA
TATACCTATTATTTATAGTGGAGATAACTTTATAACTCGATATGATTCAA
TGACTGAGTTACATCCGGTTGGTTCAAATAAACAAGTCGAATACTTTTTT
GCTTCAGATGCAAGTGCTATAGTGGAACACACGAATAAAGTCATTTATCT
AGAAGATGATGATGTTGCTGCCATTCAAGATGGCTGTCTTTGGATGCATC
GTTTAAACAGAGGAGCTACGGATTCTCAATTTAGAGATGTTATCACTTTA
AGAATGGAATTAAAACAAATAATGAAAGGAAACTTCGATTGCTTTATGAA
AAAAGAAATTTATGATCAACCGGAATCTGTAATAAACACCATGAGAGGTC
GAGTTAATTTTGAAACGAAAGAAATTATTTTGGGTGGTTTATCTGAACAC
CTAACTGCCATCAGGCGTTGTAGACGTTTAATGTTTATTGGATGTGGAAC
GAGTTACCACAGTGCACTTGCGACAAGGGCACTAATGGAAGAATTAACAG
AATTACCAGTTATGGTGGAACTTGCAATCAATCTGGAGAAACAGCAGACA
CTTTAATGGCTTTGAAATACTGTCAAAAGCGAGGTGCATTAATTGTTGGT
ATCACTAATGTAGTTGGAAGCACAATATCTAGAGATAGTCAGTGTGGAGT
TCATATTAATGCTGGGCCAGAAATTGGTGTCGCTAGTACGAAAGCCTATA
CAAGTCAATTTGTATCTCTAGTAATGATTGCCCTTGTTCTTTCGGAAGAT
AGAAATTGTATGAAAACGAGACGCGAAGAAATAGTCAATGGCCTTCATGT
TTTACCATCATTAATTAAAGAAGTTTTGAAAACTGAAAGTACTGTCAAGA
ATATTGCTGAAGAATTATTGAATGAAAGGAGTATCTTAATAATGGGAAGA
GGCTATAACTATGCTACATGCTTGGAGGGCGCACTCAAAGTTAAAGAGTT
GGCGTATATTCATTCAGAAGGCATAATGAGTGGGGAACTCAAACATGGGC
CTCTGGCATTGGTTGACGATCACATGAAAATTATAATGATTGTCAGCAAA
GATAAACTATTTACTAAATCAATGAATGCTATTTCTGAAGTTTTAGCAAG
AAAAGGTAAACCAATTTTCATTACGACAAATGAAATGGTGAAAGACCTAA
AATATTTGGAAACCCATGTCATTGTTCCTCAAACAGTTGATTGCTTGCAA
GGAGTTCTATCCGTTATTCCATTGCAGATTCTTTCATATTATTTAGCCAA
ATTAAAAGGATTTGATATTGATTGTCCACGAAATCTTGCAAAATCAGTGA
CAGTTGAATAACGTAAATTTTGGAAACCGAATTTTGAAAGTCAAATACTA
TATTAATTTATTATTAATAACCTTTTATGTATTGAAAAAGCTTTACTGGA
TTTTTAATTTATTAATTTTTTTTGCATAATGTAGTAATTTTAATTTTTTT
GAAAAATGTGTTTTTTTGTTCTTATTTTACCGGTTTGTAAGTATAATATA
TTAAGTTGAAATAAAATGCGTTAATTT
back to top

protein sequence of SMED30025303-orf-1

>SMED30025303-orf-1 ID=SMED30025303-orf-1|Name=SMED30025303-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=290bp
MWNELPQCTCDKGTNGRINRITSYGGTCNQSGETADTLMALKYCQKRGAL
IVGITNVVGSTISRDSQCGVHINAGPEIGVASTKAYTSQFVSLVMIALVL
SEDRNCMKTRREEIVNGLHVLPSLIKEVLKTESTVKNIAEELLNERSILI
MGRGYNYATCLEGALKVKELAYIHSEGIMSGELKHGPLALVDDHMKIIMI
VSKDKLFTKSMNAISEVLARKGKPIFITTNEMVKDLKYLETHVIVPQTVD
CLQGVLSVIPLQILSYYLAKLKGFDIDCPRNLAKSVTVE*
back to top

protein sequence of SMED30025303-orf-2

>SMED30025303-orf-2 ID=SMED30025303-orf-2|Name=SMED30025303-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=418bp
KFASITNYSLLFLYLNFIIMCGIFAYLNYMTPMTRHKIIEILINGLKRLE
YRGYDSAGVAFDKNINGEIALFRNKGKVFSLEELVKDQLKDIDNDEIETH
SGIAHTRWATHGIPSEKNSHPLRSDENNEFIVIHNGIITNYQAIKEILIR
KGFKFETDTDTEVIPKLMKQFYDNRTDENLSFRQLVEMVISELEGSFALV
FKSTHFPGEIVATRRGSPLLVGIRSSHSLTTDHIPIIYSGDNFITRYDSM
TELHPVGSNKQVEYFFASDASAIVEHTNKVIYLEDDDVAAIQDGCLWMHR
LNRGATDSQFRDVITLRMELKQIMKGNFDCFMKKEIYDQPESVINTMRGR
VNFETKEIILGGLSEHLTAIRRCRRLMFIGCGTSYHSALATRALMEELTE
LPVMVELAINLEKQQTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR001347SIS
IPR029055Ntn_hydrolases_N
IPR017932GATase_2_dom
Vocabulary: molecular function
TermDefinition
GO:0030246carbohydrate binding
GO:0004360glutamine-fructose-6-phosphate transaminase (isomerizing) activity
GO:0008483transaminase activity
GO:0016740transferase activity
GO:0097367carbohydrate derivative binding
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0006048UDP-N-acetylglucosamine biosynthetic process
GO:0006541glutamine metabolic process
GO:1901135carbohydrate derivative metabolic process
GO:1901137carbohydrate derivative biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF13522GATase_6coord: 98..221
e-value: 3.5E-17
score: 62.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.10490coord: 316..417
e-value: 1.3E-26
score: 95.1
NoneNo IPR availablePANTHERPTHR10937:SF10GLUTAMINE--FRUCTOSE-6-PHOSPHATE AMINOTRANSFERASE [ISOMERIZING] 2coord: 20..411
NoneNo IPR availablePANTHERPTHR10937GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE AMINOTRANSFERASE, ISOMERIZINGcoord: 20..411
NoneNo IPR availableCDDcd00714GFATcoord: 21..291
e-value: 6.62489E-117
score: 337.882
NoneNo IPR availableSUPERFAMILYSSF53697SIS domaincoord: 310..403
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR001347Sugar isomerase (SIS)PFAMPF01380SIScoord: 370..411
e-value: 2.3E-6
score: 27.5
IPR017932Glutamine amidotransferase type 2 domainPROSITEPS51278GATASE_TYPE_2coord: 21..294
score: 42.294
IPR029055Nucleophile aminohydrolases, N-terminalSUPERFAMILYSSF56235N-terminal nucleophile aminohydrolases (Ntn hydrolases)coord: 21..300