E3 ubiquitin-protein ligase TRIM9

Overview
NameE3 ubiquitin-protein ligase TRIM9
Smed IDSMED30025299
Length (bp)2822
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase TRIM9 (SMED30025299) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase TRIM9 (SMED30025299) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase TRIM9 (SMED30025299) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase TRIM9 (SMED30025299) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025299

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025299SMESG000048786.1 SmedASXL_001232SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30025299SMESG000048786.1 dd_Smed_v4_8386_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025299SMESG000048786.1 dd_Smed_v4_8386_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025299SMESG000048786.1 dd_Smed_v6_8386_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Human
Match: TRIM9 (tripartite motif containing 9 [Source:HGNC Symbol;Acc:HGNC:16288])

HSP 1 Score: 474.167 bits (1219), Expect = 9.556e-155
Identity = 278/726 (38.29%), Postives = 414/726 (57.02%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNR-STHFA-----------ILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTV--ECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            +ME ELKCP C  +Y+ P++LPC H+LC  CA   L+   ++   Q  + A       +D++  D D++S++SEADSG        S+            ++   A    +TH +           I C  C R  +LDD G+     NR LE V++ +       QS   + + + C LCE+   E A+V+CEQC+V+YC  C  RCHP RGPLAKH L   + G  + +    +K + C  H  E  S+YCV C+  VC  C++E  H  HE+  L  + K  K++LSQ L  L+++AK    F+  L+++ ++I  N  + E  +++  D +I  L ++K +L++++  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S +LI +V   E  + +   L PR +TDFDL L N  +L+S         HQ          V   S  P  PI+  E+C   +N  T+ W+  P  TV  + Y LE+DDG  G FR+VY G E++CT++GLHF S Y  RVKA N+ G S YS  + LQTS V WF  DP +A +D+I SNDN T+T  S +++ VL  T  S+G+HYWE  VD+ +    P+FGVA+ D  K++MLGKD+  WAMY+D+ RSWF++NN H  RT+GGI  G+ +G+ +D ++ NL+++INDE  GPIAF  ++G  +PAVS N+ VQ+TL  G   P
Sbjct:    3 EMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAA---GSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRY------QQS---KAAALKCQLCEKAPKE-ATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGT-LTPRMTTDFDLSLDNSPLLQSI--------HQ-----LDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPADGYILELDDGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEVAWFAFDPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTFFINDEQQGPIAFDNVEGLFFPAVSLNRNVQVTLHTGLPVP 700          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Human
Match: TRIM67 (tripartite motif containing 67 [Source:HGNC Symbol;Acc:HGNC:31859])

HSP 1 Score: 440.654 bits (1132), Expect = 1.121e-141
Identity = 264/732 (36.07%), Postives = 397/732 (54.23%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCA-AASLMSPDDAVRLQQKQHADILSQNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFA---------ILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQ----------QKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQ--PYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            ME ELKCP C   ++ P++LPC H++C  CA   ++ +PD              +    DH    D++S++SE DSG    + +  S  G     ++       A                 I C  C R   LD  G+     NR LE +V  +          S   +  +C LC+    EPA+ +CEQC+V YC  C  +CHP RGP AKH L   S G                   +K   C  H  E  S+YCV+CRT VC +C++E  H KHE+  L  + K  K +LSQ L  +++KAK    F+  LK++ ++I  N    E  +++  D ++  L ++K +L++++  E+E K     D I+  T  L ++ GL+++C+E++KE+DP+ FL +S +LI +V  +++ +++   L+P+ S +FDL L +  +L+        A HQ       L  + M    P  P++  E+C   +N +T+ W+  P+    V+ Y LE+DDGA G FR+VY G E++CTI+GLHF S Y  RVKA N  G   YS  V LQTS V WF  DP +   D+I SNDN+T T  S +++ VL T + S+GVHYWE  VD+ +    P+FGVA++   K+MMLGKD+  WAMY+D+ RSWF++ N H  RT+GG+  G+ VG+ +D +K  L+++IN +  GP AF+ + G   PA+S N+ VQ+TL  G E P
Sbjct:    1 MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGGSAAGGLGGG---AGGGGDHA---DKLSLYSETDSGYGSYTPSLKSPNGVRVLPMVPAPPGSSAAAARGAACSSLSSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEAIVQRYQQGRGAVPGTSAAAAVAICQLCDRTPPEPAATLCEQCDVLYCSACQLKCHPSRGPFAKHRLGAPSGGGGCKSPGGAGAGATGGSTARKFPTCPEHEMENYSMYCVSCRTPVCYLCLEEGRHAKHEVKPLGAMWKQHKAQLSQALNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGA-LEPKVSAEFDLTLDSEPLLQ--------AIHQ-------LDFIQMKCRVPPVPLLQLEKCCTRNNSVTLAWRMPPFTHSPVDGYILELDDGAGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLEVP 710          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Human
Match: TRIM67 (tripartite motif containing 67 [Source:HGNC Symbol;Acc:HGNC:31859])

HSP 1 Score: 413.305 bits (1061), Expect = 1.405e-130
Identity = 235/632 (37.18%), Postives = 352/632 (55.70%), Query Frame = 2
Query:  530 ILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNL----------HEASTG----------------------TEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQ--PYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            I C  C R   LD  G+     NR LE +V  +          S   +  +C LC+    EPA+ +CEQC+V YC  C  +CHP RGP AKH L           EA++G                               +K   C  H  E  S+YCV+CRT VC +C++E  H KHE+  L  + K  K +LSQ L  +++KAK    F+  LK++ ++I  N    E  +++  D ++  L ++K +L++++  E+E K     D I+  T  L ++ GL+++C+E++KE+DP+ FL +S +LI +V  +++ +++   L+P+ S +FDL L +  +L+        A HQ       L  + M    P  P++  E+C   +N +T+ W+  P+    V+ Y LE+DDGA G FR+VY G E++CTI+GLHF S Y  RVKA N  G   YS  V LQTS V WF  DP +   D+I SNDN+T T  S +++ VL T + S+GVHYWE  VD+ +    P+FGVA++   K+MMLGKD+  WAMY+D+ RSWF++ N H  RT+GG+  G+ VG+ +D +K  L+++IN +  GP AF+ + G   PA+S N+ VQ+TL  G E P
Sbjct:  157 ITCPQCHRSASLDHRGLRGFQRNRLLEAIVQRYQQGRGAVPGTSAAAAVAICQLCDRTPPEPAATLCEQCDVLYCSACQLKCHPSRGPFAKHRLVQPPPPPPPPAEAASGPTGTAQGAPSGGGGCKSPGGAGAGATGGSTARKFPTCPEHEMENYSMYCVSCRTPVCYLCLEEGRHAKHEVKPLGAMWKQHKAQLSQALNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGA-LEPKVSAEFDLTLDSEPLLQ--------AIHQ-------LDFIQMKCRVPPVPLLQLEKCCTRNNSVTLAWRMPPFTHSPVDGYILELDDGAGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLEVP 772          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Human
Match: TRIM67 (tripartite motif containing 67 [Source:HGNC Symbol;Acc:HGNC:31859])

HSP 1 Score: 409.068 bits (1050), Expect = 7.155e-129
Identity = 235/632 (37.18%), Postives = 353/632 (55.85%), Query Frame = 2
Query:  530 ILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNL----------HEASTG----------------------TEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQ--PYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            I C  C R   LD  G+     NR LE +V  +          S   +  +C LC+    EPA+ +CEQC+V YC  C  +CHP RGP AKH L           EA++G                               +K   C  H  E  S+YCV+CRT VC +C++E  H KHE+  L  + K  K +LSQ L  +++KAK    F+  LK++ ++I  N    E  +++  D ++  L ++K +L++++  E+E K     D I+  T  L ++ GL+++C+E++KE+DP+ FL +S +LI +V  +++ +++   L+P+ S +FDL L +  +L+        A HQ       L  + M  + P  P++  E+C   +N +T+ W+  P+    V+ Y LE+DDGA G FR+VY G E++CTI+GLHF S Y  RVKA N  G   YS  V LQTS V WF  DP +   D+I SNDN+T T  S +++ VL T + S+GVHYWE  VD+ +    P+FGVA++   K+MMLGKD+  WAMY+D+ RSWF++ N H  RT+GG+  G+ VG+ +D +K  L+++IN +  GP AF+ + G   PA+S N+ VQ+TL  G E P
Sbjct:  157 ITCPQCHRSASLDHRGLRGFQRNRLLEAIVQRYQQGRGAVPGTSAAAAVAICQLCDRTPPEPAATLCEQCDVLYCSACQLKCHPSRGPFAKHRLVQPPPPPPPPAEAASGPTGTAQGAPSGGGGCKSPGGAGAGATGGSTARKFPTCPEHEMENYSMYCVSCRTPVCYLCLEEGRHAKHEVKPLGAMWKQHKAQLSQALNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGA-LEPKVSAEFDLTLDSEPLLQ--------AIHQ-------LDFIQM--KLPPVPLLQLEKCCTRNNSVTLAWRMPPFTHSPVDGYILELDDGAGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLEVP 770          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Human
Match: TRIM9 (tripartite motif containing 9 [Source:HGNC Symbol;Acc:HGNC:16288])

HSP 1 Score: 282.337 bits (721), Expect = 5.337e-84
Identity = 197/559 (35.24%), Postives = 298/559 (53.31%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNR-STHFA-----------ILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTV--ECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTS 1819
            +ME ELKCP C  +Y+ P++LPC H+LC  CA   L+   ++   Q  + A       +D++  D D++S++SEADSG        S+            ++   A    +TH +           I C  C R  +LDD G+     NR LE V++ +       QS   + + + C LCE+   E A+V+CEQC+V+YC  C  RCHP RGPLAKH L   + G  + +    +K + C  H  E  S+YCV C+  VC  C++E  H  HE+  L  + K  K++LSQ L  L+++AK    F+  L+++ ++I  N  + E  +++  D +I  L ++K +L++++  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S +LI +V   E  + +   L PR +TDFDL L N  +L+S         HQ          V   S  P  PI+  E+C   +N  T+ W+  P  TV  + Y LE+DDG  G FR+VY G E++CT++GLHF S Y  RVKA N+ G S YS  + LQTS
Sbjct:    3 EMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAA---GSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRY------QQS---KAAALKCQLCEKAPKE-ATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGT-LTPRMTTDFDLSLDNSPLLQSI--------HQ-----LDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPADGYILELDDGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTS 533          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Celegans
Match: madd-2 (pep chromosome:WBcel235:V:1223908:1235445:-1 gene:WBGene00016539.1 transcript:C39F7.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-2)

HSP 1 Score: 403.675 bits (1036), Expect = 1.953e-127
Identity = 270/773 (34.93%), Postives = 407/773 (52.65%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCA--------------------------------AASLMSPDDAVRLQQKQHADILSQNTN-DHESYDDRISVFSEADXXXXX-XXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRITLL-DDTGIECLLTNRALENVVNHFLTK------VTPNQSPSKQISPIL---------CNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTG-----TEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQE-SHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAE-HQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPY-PGPTVECYTLEIDDGAN-GSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPH----GPIAFTKL-KGSLYPAVSFNKFVQLTLVLGREAP 2320
            ME ELKC  C  +++ P++L C HSLC  CA                                A+S +SP  A           L  + N DHES  D++SV SE DSGVV  G  +  S         +H  +    T  ++   ++C  C + +   D+  I    TN A++NV+  +L        +TP+ S S   S            C LCE      A+V CEQC++YYC  C    HP RGPLAKHNL +A+ G     + I      +   RC  H  E L++YC+ C+  VC  C+Q+  H  H++  L   CK  KTELS  LQ L+EKAKT T  I  LK L + +  N    +  +   ID +I  L+ +K +L+  +  + + K    K  I + T  L + + L+QFCIE LKE DPT ++ +S +L+ + T+ E  + +E+  KP T ++F L L +   L+  I ++  A+    P+     G  S     P APII   +C  E+N +TV+W+P   G  V+ + LEID G + G+F++VY G ++ICTI+GLHF ++Y  RVK++N  G+S YS+ +CLQT+ V WF +    ++ D+I SN+  T++  S+E +T+L + + S+GVHYWE  +D+ +       GVA+   N+ +MLGKD  GW+MY+D +RSW+++N  H  R  GG+  G+V+G+R+DCD+G + Y +ND         +AFT + +G  YPA S N    +T+  G  +P
Sbjct:    1 MEEELKCTICIRFFEDPIILTCGHSLCRMCALKAHQPSTSSGSSSTSSPRPSTPGILSQILSSASSPISPQSAGSSSGASDTMSLCVSDNGDHES--DKLSVVSETDSGVVGCGRTSRPSSIIGPPLSRLHNIL----TPSTSGVQLVCNSCQKPSYFCDENSIVSAPTNLAMQNVIRRYLLAHPDKAFLTPSCSGSSGSSGSSQSSDEASSQCQLCEGSENRMANVFCEQCDIYYCTPCQTALHPARGPLAKHNLLQANDGERKKSSAITTATTVRDLLRCATHPGEGLTMYCLACKVPVCSRCLQDLRHANHDVQSLPIACKGHKTELSTTLQQLSEKAKTATEEIGRLKGLHDVVKNNCNDFKSSLCIQIDQLIEQLQMRKEKLMQHVDEQADNKRRILKSQIVKCTGKLTKTSALIQFCIEALKEPDPTVYMQISNALLHRSTSLEFLWHKEMRTKPETDSEFVLNL-DTKHLQYTIQTLDFAQLKAGPRGTRFKGDAS---RVPSAPIIETSECSAENNSVTVVWRPRNDGSAVDGFALEIDTGRDDGNFKEVYSGPDTICTIDGLHFNTVYAARVKSYNSAGESEYSESICLQTAHVAWFQLTKSPSQRDMILSNECATLSGSSLEYRTILGSIAFSKGVHYWEVTIDRHDGNSDIVIGVAQPAVNRNVMLGKDLHGWSMYVDGERSWYLHNETHHNRVLGGVTRGTVIGVRLDCDRGTMEYTVNDRKRIYQDDSMAFTNMPRGLYYPAFSVNANSSITVHTGLSSP 763          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Celegans
Match: madd-2 (pep chromosome:WBcel235:V:1223901:1235445:-1 gene:WBGene00016539.1 transcript:C39F7.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-2)

HSP 1 Score: 399.438 bits (1025), Expect = 5.638e-126
Identity = 267/772 (34.59%), Postives = 404/772 (52.33%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCA--------------------------------AASLMSPDDAVRLQQKQHADILSQNTN-DHESYDDRISVFSEADXXXXX-XXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRITLL-DDTGIECLLTNRALENVVNHFLTK------VTPNQSPSKQISPIL---------CNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTG-----TEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQE-SHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPY-PGPTVECYTLEIDDGAN-GSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPH----GPIAFTKL-KGSLYPAVSFNKFVQLTLVLGREAP 2320
            ME ELKC  C  +++ P++L C HSLC  CA                                A+S +SP  A           L  + N DHES  D++SV SE DSGVV  G  +  S         +H  +    T  ++   ++C  C + +   D+  I    TN A++NV+  +L        +TP+ S S   S            C LCE      A+V CEQC++YYC  C    HP RGPLAKHNL +A+ G     + I      +   RC  H  E L++YC+ C+  VC  C+Q+  H  H++  L   CK  KTELS  LQ L+EKAKT T  I  LK L + +  N    +  +   ID +I  L+ +K +L+  +  + + K    K  I + T  L + + L+QFCIE LKE DPT ++ +S +L+ + T+ E  + +E+  KP T ++F L L +   L+  I ++  A+ +                 P APII   +C  E+N +TV+W+P   G  V+ + LEID G + G+F++VY G ++ICTI+GLHF ++Y  RVK++N  G+S YS+ +CLQT+ V WF +    ++ D+I SN+  T++  S+E +T+L + + S+GVHYWE  +D+ +       GVA+   N+ +MLGKD  GW+MY+D +RSW+++N  H  R  GG+  G+V+G+R+DCD+G + Y +ND         +AFT + +G  YPA S N    +T+  G  +P
Sbjct:    1 MEEELKCTICIRFFEDPIILTCGHSLCRMCALKAHQPSTSSGSSSTSSPRPSTPGILSQILSSASSPISPQSAGSSSGASDTMSLCVSDNGDHES--DKLSVVSETDSGVVGCGRTSRPSSIIGPPLSRLHNIL----TPSTSGVQLVCNSCQKPSYFCDENSIVSAPTNLAMQNVIRRYLLAHPDKAFLTPSCSGSSGSSGSSQSSDEASSQCQLCEGSENRMANVFCEQCDIYYCTPCQTALHPARGPLAKHNLLQANDGERKKSSAITTATTVRDLLRCATHPGEGLTMYCLACKVPVCSRCLQDLRHANHDVQSLPIACKGHKTELSTTLQQLSEKAKTATEEIGRLKGLHDVVKNNCNDFKSSLCIQIDQLIEQLQMRKEKLMQHVDEQADNKRRILKSQIVKCTGKLTKTSALIQFCIEALKEPDPTVYMQISNALLHRSTSLEFLWHKEMRTKPETDSEFVLNL-DTKHLQYTIQTLDFAQLK----------------VPSAPIIETSECSAENNSVTVVWRPRNDGSAVDGFALEIDTGRDDGNFKEVYSGPDTICTIDGLHFNTVYAARVKSYNSAGESEYSESICLQTAHVAWFQLTKSPSQRDMILSNECATLSGSSLEYRTILGSIAFSKGVHYWEVTIDRHDGNSDIVIGVAQPAVNRNVMLGKDLHGWSMYVDGERSWYLHNETHHNRVLGGVTRGTVIGVRLDCDRGTMEYTVNDRKRIYQDDSMAFTNMPRGLYYPAFSVNANSSITVHTGLSSP 749          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Fly
Match: Trim9 (gene:FBgn0051721 transcript:FBtr0304114)

HSP 1 Score: 422.55 bits (1085), Expect = 6.767e-135
Identity = 249/685 (36.35%), Postives = 368/685 (53.72%), Query Frame = 2
Query:  353 SQNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFA--------------------ILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQE-SHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEV-ELKPRTSTDFDLKLSNIDILRSA----ISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDP---KTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            S++    +   D++S+FSEADS                      G +C   T+R   +A                    + C +C ++   DD G+  L T RA+E +V+ F  +             + C +CE  + + AS++CEQCE+ YC  C E  HP RGPLAKH L +        +   QQ+++ C  H +E LS YC++C+   C +C+ E  H  H++  +N  CKAQKTELS  LQ L+EKA++ T FIQ LK +S+K+  +  + E  + +  + +I+ +  ++  L+  ++++K+ K    KD     T  L +  GL+QFCIE LKE+D  AFL V   LI +VT  +  + QEV    PR S   DL L +  + R+        +R  +  + + P+          AP+ P I    C  E+N +TV WQP     VE Y LE+DDG+ G FR+VY G E+ICT++GLHF S+Y  RVKA N  G+  YS+ + LQT+ V WF  DP     A + +IFS +N T++ +  E +  L +   SRGVHYWEF +D       P+FGVA+ D  +  MLGKD   +AMYID +RSWF +N+ H  R +GGI +GS +G+ +D ++  LS+ +N+ P G +AF  L G  YPAVS N+ V LT+    +AP
Sbjct:  103 SESVTSDQDQSDKVSIFSEADS----------------------GVVCCSNTSRPVSYAGTGLLPGVGNVVAPPGAAYCLTCPLCRKLVFFDDGGVRNLPTYRAMEAIVDRFCAR-----------EALRCQMCET-DPKVASLICEQCEIRYCDACRELTHPARGPLAKHTLVKP-------RGAAQQRESVCGEH-EETLSQYCLSCKAPACGLCIGELRHQAHDVQSINVTCKAQKTELSHNLQQLSEKARSTTEFIQRLKGMSDKVTESCMEFERLVHAQCEALIQAIHDRREYLLEAIRMDKDTKIRILKDQQSNCTGKLQQTTGLIQFCIEALKETDSAAFLQVGSMLINRVTNTDMTWHQEVTNAAPRVSPIVDLTLDDAALARAIDNLNFIQMRAVKDGDERCPA----------APMTPTILPSDCSAENNSVTVAWQPPNHSFVEGYVLELDDGSGGEFREVYCGKETICTVDGLHFNSMYNARVKAFNSAGEGEYSELIGLQTAEVAWFTFDPVLSGGAGSGLIFSKNNATVSVEGWEHRVALGSVGFSRGVHYWEFTIDNYTADTDPAFGVARIDVARNKMLGKDEKSFAMYIDRQRSWFQHNSIHERRVEGGITTGSTIGVLLDLERHTLSFLVNEMPQGSVAFRDLYGVFYPAVSINRGVTLTMHTAMDAP 735          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Fly
Match: Trim9 (gene:FBgn0051721 transcript:FBtr0080096)

HSP 1 Score: 422.165 bits (1084), Expect = 7.121e-135
Identity = 249/681 (36.56%), Postives = 366/681 (53.74%), Query Frame = 2
Query:  353 SQNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFA--------------------ILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQE-SHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEV-ELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDP---KTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            S++    +   D++S+FSEADS                      G +C   T+R   +A                    + C +C ++   DD G+  L T RA+E +V+ F  +             + C +CE  + + AS++CEQCE+ YC  C E  HP RGPLAKH L +        +   QQ+++ C  H +E LS YC++C+   C +C+ E  H  H++  +N  CKAQKTELS  LQ L+EKA++ T FIQ LK +S+K+  +  + E  + +  + +I+ +  ++  L+  ++++K+ K    KD     T  L +  GL+QFCIE LKE+D  AFL V   LI +VT  +  + QEV    PR S   DL L +  + R AI ++   + +                AP+ P I    C  E+N +TV WQP     VE Y LE+DDG+ G FR+VY G E+ICT++GLHF S+Y  RVKA N  G+  YS+ + LQT+ V WF  DP     A + +IFS +N T++ +  E +  L +   SRGVHYWEF +D       P+FGVA+ D  +  MLGKD   +AMYID +RSWF +N+ H  R +GGI +GS +G+ +D ++  LS+ +N+ P G +AF  L G  YPAVS N+ V LT+    +AP
Sbjct:  103 SESVTSDQDQSDKVSIFSEADS----------------------GVVCCSNTSRPVSYAGTGLLPGVGNVVAPPGAAYCLTCPLCRKLVFFDDGGVRNLPTYRAMEAIVDRFCAR-----------EALRCQMCET-DPKVASLICEQCEIRYCDACRELTHPARGPLAKHTLVKP-------RGAAQQRESVCGEH-EETLSQYCLSCKAPACGLCIGELRHQAHDVQSINVTCKAQKTELSHNLQQLSEKARSTTEFIQRLKGMSDKVTESCMEFERLVHAQCEALIQAIHDRREYLLEAIRMDKDTKIRILKDQQSNCTGKLQQTTGLIQFCIEALKETDSAAFLQVGSMLINRVTNTDMTWHQEVTNAAPRVSPIVDLTLDDAALAR-AIDNLNFIQMR----------------APMTPTILPSDCSAENNSVTVAWQPPNHSFVEGYVLELDDGSGGEFREVYCGKETICTVDGLHFNSMYNARVKAFNSAGEGEYSELIGLQTAEVAWFTFDPVLSGGAGSGLIFSKNNATVSVEGWEHRVALGSVGFSRGVHYWEFTIDNYTADTDPAFGVARIDVARNKMLGKDEKSFAMYIDRQRSWFQHNSIHERRVEGGITTGSTIGVLLDLERHTLSFLVNEMPQGSVAFRDLYGVFYPAVSINRGVTLTMHTAMDAP 724          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Zebrafish
Match: TRIM67 (tripartite motif containing 67 [Source:NCBI gene;Acc:100332164])

HSP 1 Score: 452.21 bits (1162), Expect = 1.036e-146
Identity = 267/712 (37.50%), Postives = 411/712 (57.72%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCAA-ASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNL---HEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIW-----QPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLT 2296
            ME ELKCP C   +K P++LPC H++C  CA   ++ +P+     Q +      S  T+D++  D D++S++SE DSG    +    S          +G           H +I C +C R   LD+ G+  L  NR LE +V+ +       QS   + + + C LC+   V+ A+V+CEQC+V+YC  C +RCHP RGPLAKH L    +A  G+        +K+  C  H  E  S+YC +CRT VC  C++E  H KH++  L  + K  K +LSQ L  +++KAK    F+  LK+L ++I  N  + E  +++  D +I  L ++K +L++++  EKE K    KD I   T  L +  G+++FC+E++KE+DP+ FL +S +LI +V A++  +++   L+P+   +F L + N D L  +I  +   +++                 P AP++  E+C + +N  T+ W     Q  P   VE Y LE+DDG  G +R+VY G E++CT++GLHF S Y  RVKA+N  G  +YS  V L+TS V WF  DP +A  D++ +N+N+T+T +S +++ VL T + S+GVHYWE  VD+ +    P+FGVA+ +  K+MMLGKD+  WAMY+D+ RSWF++NN H  R +GGI  GS VGI +D  K  L+++IN + HGP+AF  L+G   PAVS N+ VQ++
Sbjct:    1 MEEELKCPVCGSLFKEPIILPCSHNVCLACARNITVQTPEGETPPQNR------SSGTSDYDYLDMDKMSMYSETDSGYGSYTPCLKSP---------NGVRVFPPALMHRHCSITCPLCHRSVSLDERGLRGLQRNRLLEAIVSRY------QQS---RAASVKCQLCDRNPVD-ATVMCEQCDVFYCSPCQQRCHPSRGPLAKHRLLPPTQAQAGSAQPPGAPARKQPTCVDHEAENYSMYCASCRTPVCYQCLEEGKHGKHDVKPLAAMWKQHKCQLSQALNGVSDKAKEAKEFLVQLKNLLQQIQENGVEFEACLVAQCDSLIEALTRQKAKLLTKVTKEKENKLKTVKDQITHCTMKLRQTTGMMEFCLEVIKENDPSGFLQISDALIKRVLASQDQWVKGA-LEPKVCPEFALTV-NTDPLMQSILQLDFTQNK----------------VPPAPLLQLEKCCMRNNSATLAWRITTVQALP---VEGYVLELDDGNGGPYREVYVGKETVCTVDGLHFNSSYSARVKAYNSAGVGAYSKVVVLKTSDVAWFTFDPTSAHRDIVLTNENQTVTCNSYDDRVVLGTAAFSKGVHYWELSVDRYDNHPDPAFGVARINTMKDMMLGKDDKAWAMYVDNNRSWFMHNNSHTNRAEGGISKGSTVGILLDLTKHTLTFFINKQQHGPMAFENLEGVFMPAVSLNRNVQVS 666          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Zebrafish
Match: trim9 (tripartite motif containing 9 [Source:ZFIN;Acc:ZDB-GENE-030131-8043])

HSP 1 Score: 419.853 bits (1078), Expect = 3.459e-134
Identity = 264/732 (36.07%), Postives = 395/732 (53.96%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQI---CLHATNRSTHF---------------AILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPT--VECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            +ME ELKCP C  +++ P++LPC H++C  CA   L+   DA   +  Q +       +D++  D D++S++SEADSG        S+            ++    +    ++ H                 + C  C R   LDD G+     NR LE VV+ +       QS +  +    C LCE+   E A+V+CEQC+V+YC  C  RCHP RGPLAKH L   + G  I +    +K + C  H  E LS+YCV C+T VC  C+++  H  HE+  L  + K  K +LSQ L  L+++A     F+  L+++ + I  N  + E  +++  D +I  L ++K +L+S++  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S +LI +V   E  +  +  L PR S+DFDL L +  +L++         HQ       L  V M  + P API+  E+C  +++  T+ W+  P  T  V+ Y LE+DDG  G FR+VY G E ICT++GLHF S Y+ RVKA N  G   YS  + +QTS + WF  D  +A  D+I SNDN T+T +S +++ V+  T  SRGVHYWE  +D+ +    P+FGVA++D  K++MLGKD+  WA+                  TDGGI  G+ VG+ +D  +G L + INDE  GP+AF  L+G  YPA+S N+ VQ+TL  G   P
Sbjct:    3 EMEEELKCPVCGSFFREPIILPCSHNICLACARNILVQTPDA---ESPQSSRASGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFVSAPTTPCQKSPNGVRVFPPSMPPPQQAQHHLLPHTGVLPPVPRNSCLTCPQCHRSLTLDDRGLRGFPKNRVLEGVVDRY------QQSKAAALK---CQLCEKSPRE-ATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RISRRASPRKISTCTEHELENLSMYCVQCKTPVCYQCLEDGKHSTHEVKALGAMWKLHKGQLSQALNVLSDRATEAKEFLVQLRNMVQHIQENGVEFEACLVAQCDALIEALNRRKAQLLSRVTKEHEHKLSVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHMTENQW-GKGSLTPRMSSDFDLTLDSGPLLQTI--------HQ-------LDFVQM--KVPAAPILQLEECCTQTSSATLSWKQPPLSTIAVDGYILELDDGTGGQFREVYVGTEMICTVDGLHFNSTYKSRVKAFNSSGVGQYSKTLVMQTSEIAWFTFDSASAHPDIILSNDNLTVTCNSYDDRVVMGNTGFSRGVHYWEMTIDRYDNHPDPAFGVARADVMKDVMLGKDDKAWAI------------------TDGGISKGATVGVLLDFTRGILLFLINDEQQGPVAFNTLEGMYYPAISLNRNVQVTLHSGLPIP 684          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Zebrafish
Match: mid1 (midline 1 [Source:ZFIN;Acc:ZDB-GENE-110411-205])

HSP 1 Score: 123.25 bits (308), Expect = 1.793e-28
Identity = 146/612 (23.86%), Postives = 240/612 (39.22%), Query Frame = 2
Query:  527 AILCGVCLRITLLDDTGIECLLTNRALENVVNHFL-TKVTPNQSPS---KQISP---------ILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIY-XXXXXXXXXXXXMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSL---ITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLE--IDDG-AN--------GSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKT--------------VLATTSLSRGVHYWEFIVDKIEPGGQPSF--GVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNND---------HFERTDGGIKSGSVVGIRIDCDKGNLSYY 2203
            A  C  C  +  LD  G++ L  N  L+N++  F    ++   SP+   KQISP         + C  CE+   + A   C  CEV YC+ C    HP + P   H L E      +       +   C  H +E++++Y     + +     +   H +H++  L       K  L   L +L ++       +  L    + +  N   +E ++    D +I  ++Q++  + +++K  K  +  K    I      + R++ L+    + LKE+D   FL ++ S+   ++  TA+ Q  + E+ L   T   F L  S    +   +  +                      AP AP I  E C    + ITV W      +V  Y L+  I  G AN         S+  V    ++  T+ GL   + Y   VKA N+ G  S S P  L+T+S   F +DPK+A   +  S+DN T+  D                    V     +  G HYWE ++     GG   F  G+A     K   +GKD+  W +      SW + +N          H  R          +G+ +D D G+L++Y
Sbjct:   54 AFQCPTCRYVITLDQQGLDGLKRNVTLQNIIERFQKASLSGPNSPTETRKQISPSAMSSACEAVQCQFCEQDPPQEAVKTCVTCEVSYCQECLRATHPNKKPFTGHRLTEPVPDARL-------RGLACPEHGEEKVNMYCITDEQLICSLCKLVGHHREHQVASLGERYDKLKQMLDSNLSNLIKRNSELENLMAKLIQTCQHVEHNAAHQESKLTEECDTLINIVQQRRQIIGTKIKEGKVVRLRKLAQQIANCKQFVERSSSLIIQADQALKETDHARFLQMAKSISERVSMATASSQVLIPEINLN-DTFDAFALDFSREKKMLEGLDYL---------------------TAPNAPTIREELCTASHDTITVHWTSEDEFSVVSYELQYTISTGQANVVSLCNSMDSWMIVPNIKQNHYTVHGLQSGTKYIFIVKAMNQAGSRS-SPPGQLKTNSQP-FKLDPKSAHRKLKVSHDNLTVERDEASSMKSHAQDRFGGTGNYGVTGNVYIDSGRHYWEVLI-----GGSTWFAIGIAYKSAPKHGWVGKDSTSWVLS-RCNTSWAVRHNSKEFPIEPSPHMRR----------LGVLLDYDSGSLAFY 618          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Zebrafish
Match: mid2 (midline 2 [Source:ZFIN;Acc:ZDB-GENE-090220-1])

HSP 1 Score: 108.612 bits (270), Expect = 1.007e-23
Identity = 139/614 (22.64%), Postives = 233/614 (37.95%), Query Frame = 2
Query:  527 AILCGVCLRITLLDDTGIECLLTNRALENVVNHFL-TKVTPNQSPSKQISP------------------------ILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIY-XXXXXXXXXXXXMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKV---TAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLE--IDDGANGSFRKVYRGCESIC----------TIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKT--------------VLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYY 2203
            A  C  C  +  L+  G+E L  N  L+N+++ F    V+   SP++   P                        + C  C++     A   C  CEV YC  C    HP + P   H L E     ++       +   C  H  E++++Y  V  + +     +   H +H++  L+      K  L   L +L ++       +  L  + +++  N    E +++   D ++  + Q+K  +  ++K  K  K  K    I      L R++ L+      LKE+D T FL  + ++  +V   TA+ Q  + +V L      +F L  S    +   +  +                      AP  P I  E C    + ITV W      +V  Y L+  I  G   +F  +Y   +S            T+ GL   + Y   VKA N+ G S  S+P  L+T+S   F +DPKTA   +  SND  TM  D    K                     +  G HYWE ++         + GVA     K    GK++  W ++     ++ + +N+     +  ++    VG+ +D D   LS+Y
Sbjct:   53 AFQCPTCRYVITLNQRGLEGLKRNVTLQNIIDRFQKASVSGPNSPNESRRPRPYSATLGGSARGSPASSAMSLERVGCQFCDQEPPREAVKTCVTCEVSYCDRCLRATHPNKKPFTSHRLVEPVADAQL-------RGLACLEHENEKVNMYCVVDDQLICALCKLVGRHREHQVTSLSDRFDKLKQTLENNLTNLVKRNSELENQMAKLIQICQQVEVNTAMHEAKLVEECDELVEIIRQRKQVIAVKIKESKVMKLRKLAQQIANCRQCLERSSALITQAEHSLKENDHTRFLQTARNVAERVAMATASSQVLIPDVNLN-EAFDNFALDFSREKKILEGLDYL---------------------TAPNPPSIREELCTASHDTITVHWTSEDEFSVTSYELQYTIYTGQT-NFISLYNSVDSWMIVPNIKQNHYTVHGLQSGTRYIFFVKAINQAG-SRNSEPARLKTNSQP-FKLDPKTAHKKLRLSNDCLTMEKDESSLKKSHTPERFSGTGSYGAAGNVFIDSGCHYWEVLLGA---STWYALGVAYKSAPKNEWSGKNSSSW-VFSRCNNNFLVRHNNKESIVEASLQLRR-VGVLLDYDNNTLSFY 629          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Zebrafish
Match: trim46a (tripartite motif containing 46a [Source:ZFIN;Acc:ZDB-GENE-110825-1])

HSP 1 Score: 88.5817 bits (218), Expect = 2.021e-17
Identity = 136/650 (20.92%), Postives = 240/650 (36.92%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTH-----FAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIY-XXXXXXXXXXXXMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILR--SAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQ-PYPGPTVECYTLEI------------------DDGANG---SFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQT--SSVLWFCMD------------------PKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPG 1993
            ME EL CP C +  K P++LPC HS+C  CA                  A++L Q            +  + +                     VI      H   R            C  C R   L + G+   L N  LE +V  +   V      S     I+C  C+      A+  C  C   +C  C +  HP   P A+H  H   T      H  + K   C  H QE L  Y     R +     ++ +H  H++  +    +  K ++++ +  +     +    I  ++S   +   N    +E++   ++ +   L +++  L   L+  + ++       + +  + L  A GLL +  E+LKESD + F+  +     ++  A +  LQ   L    S D   +   +D+ R   A+SS+                     +AP+AP+I   Q  +  + + + W+ P        Y++E                     G+NG   S++++     +   I+ L   S+Y +RV+  N+ G   YS+ V L T  + VL FC+D                   ++     +    +R +T+  +    ++A  S+++G HYW      +EPG
Sbjct:    4 MERELHCPVCEEMVKQPIVLPCSHSVCVLCA------------------AEVLVQRGYPPPELPPEPNTPTSSPLTRSPRQNRRPPPKTDRLDRVIRTVCGTHPGRRRKDTPPILMLFPCPTCRRDVELGERGLADCLRNLTLERIVERYRHTV------SLGTMAIMCQFCKPPQTLEATKGCADCRSNFCNECFKLYHPWGTPRAQHE-HILPT------HSFRPKVLVCVEHEQERLQFYCRSCQRLLCSLCKLRRAHSGHKIMPIALAYQTLKDKITKEMNYILANQDSVQAQITQVESGIAQTEVNSAVVKEQLSQCVNELRAVLAERQGALAMCLEGSRAQRAAALNAQLSEKQSLLENA-GLLTYTQELLKESDQSCFVQAARVTHNRLVKAIEN-LQHFSL----SADPSFRHFQMDVSRELKALSSMDFI------------------QAPLAPVI-DTQKTLAYDQLYLCWRLPQDSAPAWHYSVEFQRKVGGAGAVWGRVWSEGSSGSNGTHCSWQRLDDVGGTSAVIDKLEMDSVYVLRVRGCNKAGFGEYSEEVYLHTTPAPVLSFCLDSRWGLHAERVALGKGQTYARSVPGMTLLQAADRALTSCHLTSDLLVADVSITQGRHYWAC---SVEPG 594          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Xenopus
Match: stk35 (serine/threonine kinase 35 [Source:Xenbase;Acc:XB-GENE-5853374])

HSP 1 Score: 455.292 bits (1170), Expect = 1.653e-147
Identity = 268/733 (36.56%), Postives = 416/733 (56.75%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXX-------------------XIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTV--ECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            +ME ELKCP C  +Y+ P++LPC HSLC +CA   L+   D+   Q ++ + +     +D++  D D++S++SEADSG        S+                              G + L    R++   + C  C R  +LD+ G+     NR LE V+  +       QS   + + + C LCE+   E A+V+CEQC+V+YC+ C  RCHP RGPLAKH L   + G  + +    +K + C  H  E  S+YCV C+  VC  C++E  H  HE+  L  + K  K++LSQ L  L+++AK    F+  L+++ ++I  N  + E  +++  D +I  L ++K++L+S++  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S +LI +V   E  + +   L PR +TDFDL L +  +L+S I  +   + + P            S  P  P++  E+C   +N  T+ W+  P   V  E Y LE+DDG  G FR+V+ G E++CT++GLHF S Y  RVKA N+ G S YS  + LQTS V WF  DP +A  D+IFSNDN T+T +S +++ VL  +  S+GVHYWE  +D+ +    P+FGVA+ +  K++MLGKD+  WAMY+D+ RSWF+++N H  R++GGI  G+ VG+ +D  +  L++ IN+E  GP+AF  ++G  +PAVS N+ VQ+T+  G   P
Sbjct:    3 EMEEELKCPVCGSFYREPIILPCSHSLCLSCARNILVQTPDSESPQSRRASGV-----SDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPMQPHHQSSGALLLPIGPRNS--CLTCPQCHRSLILDERGLRGFAKNRVLEGVIERY------QQS---KAAALRCQLCEKSPKE-ATVMCEQCDVFYCEPCRLRCHPPRGPLAKHRLLPPAQG-RVSRRLSPRKISTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKVQLLSRVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGT-LTPRMTTDFDLNLDSAPLLQS-IHQLDFVQMKVP------------SLVPAPPLLQLEECCNHNNSATLSWKQPPMSMVQTEGYILELDDGNGGQFREVFVGKETMCTVDGLHFNSTYNARVKAFNKAGVSLYSKTLVLQTSEVPWFAFDPGSAHPDIIFSNDNLTVTCNSYDDRVVLGKSGFSKGVHYWELTIDRYDNHPDPAFGVARVEVMKDVMLGKDDKAWAMYVDNNRSWFMHSNSHTNRSEGGITKGATVGVLLDFTRRTLTFSINEEQQGPVAFENMEGLFFPAVSLNRNVQVTIHTGLPVP 703          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Xenopus
Match: stk35 (serine/threonine kinase 35 [Source:Xenbase;Acc:XB-GENE-5853374])

HSP 1 Score: 452.21 bits (1162), Expect = 2.724e-146
Identity = 267/726 (36.78%), Postives = 413/726 (56.89%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXX-------------------XXXXXXIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTV--ECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTL 2299
            +ME ELKCP C  +Y+ P++LPC HSLC +CA   L+   D+   Q ++ + +     +D++  D D++S++SEADSG        S+                              G + L    R++   + C  C R  +LD+ G+     NR LE V+  +       QS   + + + C LCE+   E A+V+CEQC+V+YC+ C  RCHP RGPLAKH L   + G  + +    +K + C  H  E  S+YCV C+  VC  C++E  H  HE+  L  + K  K++LSQ L  L+++AK    F+  L+++ ++I  N  + E  +++  D +I  L ++K++L+S++  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S +LI +V   E  + +   L PR +TDFDL L +  +L+S I  +   + + P            S  P  P++  E+C   +N  T+ W+  P   V  E Y LE+DDG  G FR+V+ G E++CT++GLHF S Y  RVKA N+ G S YS  + LQTS V WF  DP +A  D+IFSNDN T+T +S +++ VL  +  S+GVHYWE  +D+ +    P+FGVA+ +  K++MLGKD+  WAMY+D+ RSWF+++N H  R++GGI  G+ VG+ +D  +  L++ IN+E  GP+AF  ++G  +PAVS N+ VQL L
Sbjct:    3 EMEEELKCPVCGSFYREPIILPCSHSLCLSCARNILVQTPDSESPQSRRASGV-----SDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPMQPHHQSSGALLLPIGPRNS--CLTCPQCHRSLILDERGLRGFAKNRVLEGVIERY------QQS---KAAALRCQLCEKSPKE-ATVMCEQCDVFYCEPCRLRCHPPRGPLAKHRLLPPAQG-RVSRRLSPRKISTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKVQLLSRVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGT-LTPRMTTDFDLNLDSAPLLQS-IHQLDFVQMKVP------------SLVPAPPLLQLEECCNHNNSATLSWKQPPMSMVQTEGYILELDDGNGGQFREVFVGKETMCTVDGLHFNSTYNARVKAFNKAGVSLYSKTLVLQTSEVPWFAFDPGSAHPDIIFSNDNLTVTCNSYDDRVVLGKSGFSKGVHYWELTIDRYDNHPDPAFGVARVEVMKDVMLGKDDKAWAMYVDNNRSWFMHSNSHTNRSEGGITKGATVGVLLDFTRRTLTFSINEEQQGPVAFENMEGLFFPAVSLNRNVQLKL 696          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Xenopus
Match: stk35 (serine/threonine kinase 35 [Source:Xenbase;Acc:XB-GENE-5853374])

HSP 1 Score: 437.187 bits (1123), Expect = 5.317e-140
Identity = 268/770 (34.81%), Postives = 416/770 (54.03%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXX-------------------XIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTV--ECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSS-------------------------------------VLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            +ME ELKCP C  +Y+ P++LPC HSLC +CA   L+   D+   Q ++ + +     +D++  D D++S++SEADSG        S+                              G + L    R++   + C  C R  +LD+ G+     NR LE V+  +       QS   + + + C LCE+   E A+V+CEQC+V+YC+ C  RCHP RGPLAKH L   + G  + +    +K + C  H  E  S+YCV C+  VC  C++E  H  HE+  L  + K  K++LSQ L  L+++AK    F+  L+++ ++I  N  + E  +++  D +I  L ++K++L+S++  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S +LI +V   E  + +   L PR +TDFDL L +  +L+S I  +   + + P            S  P  P++  E+C   +N  T+ W+  P   V  E Y LE+DDG  G FR+V+ G E++CT++GLHF S Y  RVKA N+ G S YS  + LQTS                                      V WF  DP +A  D+IFSNDN T+T +S +++ VL  +  S+GVHYWE  +D+ +    P+FGVA+ +  K++MLGKD+  WAMY+D+ RSWF+++N H  R++GGI  G+ VG+ +D  +  L++ IN+E  GP+AF  ++G  +PAVS N+ VQ+T+  G   P
Sbjct:    3 EMEEELKCPVCGSFYREPIILPCSHSLCLSCARNILVQTPDSESPQSRRASGV-----SDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPMQPHHQSSGALLLPIGPRNS--CLTCPQCHRSLILDERGLRGFAKNRVLEGVIERY------QQS---KAAALRCQLCEKSPKE-ATVMCEQCDVFYCEPCRLRCHPPRGPLAKHRLLPPAQG-RVSRRLSPRKISTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKVQLLSRVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGT-LTPRMTTDFDLNLDSAPLLQS-IHQLDFVQMKVP------------SLVPAPPLLQLEECCNHNNSATLSWKQPPMSMVQTEGYILELDDGNGGQFREVFVGKETMCTVDGLHFNSTYNARVKAFNKAGVSLYSKTLVLQTSEGPFSRMSATLAGRLQIDAMPSPLEFLQSPDQESCASPVPWFAFDPGSAHPDIIFSNDNLTVTCNSYDDRVVLGKSGFSKGVHYWELTIDRYDNHPDPAFGVARVEVMKDVMLGKDDKAWAMYVDNNRSWFMHSNSHTNRSEGGITKGATVGVLLDFTRRTLTFSINEEQQGPVAFENMEGLFFPAVSLNRNVQVTIHTGLPVP 740          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Xenopus
Match: stk35 (serine/threonine kinase 35 [Source:Xenbase;Acc:XB-GENE-5853374])

HSP 1 Score: 436.802 bits (1122), Expect = 6.039e-140
Identity = 268/770 (34.81%), Postives = 416/770 (54.03%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXX-------------------XIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTV--ECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSS-------------------------------------VLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            +ME ELKCP C  +Y+ P++LPC HSLC +CA   L+   D+   Q ++ + +     +D++  D D++S++SEADSG        S+                              G + L    R++   + C  C R  +LD+ G+     NR LE V+  +       QS   + + + C LCE+   E A+V+CEQC+V+YC+ C  RCHP RGPLAKH L   + G  + +    +K + C  H  E  S+YCV C+  VC  C++E  H  HE+  L  + K  K++LSQ L  L+++AK    F+  L+++ ++I  N  + E  +++  D +I  L ++K++L+S++  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S +LI +V   E  + +   L PR +TDFDL L +  +L+S I  +   + + P            S  P  P++  E+C   +N  T+ W+  P   V  E Y LE+DDG  G FR+V+ G E++CT++GLHF S Y  RVKA N+ G S YS  + LQTS                                      V WF  DP +A  D+IFSNDN T+T +S +++ VL  +  S+GVHYWE  +D+ +    P+FGVA+ +  K++MLGKD+  WAMY+D+ RSWF+++N H  R++GGI  G+ VG+ +D  +  L++ IN+E  GP+AF  ++G  +PAVS N+ VQ+T+  G   P
Sbjct:    3 EMEEELKCPVCGSFYREPIILPCSHSLCLSCARNILVQTPDSESPQSRRASGV-----SDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPMQPHHQSSGALLLPIGPRNS--CLTCPQCHRSLILDERGLRGFAKNRVLEGVIERY------QQS---KAAALRCQLCEKSPKE-ATVMCEQCDVFYCEPCRLRCHPPRGPLAKHRLLPPAQG-RVSRRLSPRKISTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKVQLLSRVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGT-LTPRMTTDFDLNLDSAPLLQS-IHQLDFVQMKVP------------SLVPAPPLLQLEECCNHNNSATLSWKQPPMSMVQTEGYILELDDGNGGQFREVFVGKETMCTVDGLHFNSTYNARVKAFNKAGVSLYSKTLVLQTSEGPFRRMSATLAARLQVNSIPSPLEFLQHAEQESCGSPVPWFAFDPGSAHPDIIFSNDNLTVTCNSYDDRVVLGKSGFSKGVHYWELTIDRYDNHPDPAFGVARVEVMKDVMLGKDDKAWAMYVDNNRSWFMHSNSHTNRSEGGITKGATVGVLLDFTRRTLTFSINEEQQGPVAFENMEGLFFPAVSLNRNVQVTIHTGLPVP 740          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Xenopus
Match: stk35 (serine/threonine kinase 35 [Source:Xenbase;Acc:XB-GENE-5853374])

HSP 1 Score: 431.795 bits (1109), Expect = 4.033e-138
Identity = 268/773 (34.67%), Postives = 414/773 (53.56%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXX-------------------XIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTV--ECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTS--------------------------------------------SVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLG 2308
            +ME ELKCP C  +Y+ P++LPC HSLC +CA   L+   D+   Q ++ + +     +D++  D D++S++SEADSG        S+                              G + L    R++   + C  C R  +LD+ G+     NR LE V+  +       QS   + + + C LCE+   E A+V+CEQC+V+YC+ C  RCHP RGPLAKH L   + G  + +    +K + C  H  E  S+YCV C+  VC  C++E  H  HE+  L  + K  K++LSQ L  L+++AK    F+  L+++ ++I  N  + E  +++  D +I  L ++K++L+S++  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S +LI +V   E  + +   L PR +TDFDL L +  +L+S I  +   + + P            S  P  P++  E+C   +N  T+ W+  P   V  E Y LE+DDG  G FR+V+ G E++CT++GLHF S Y  RVKA N+ G S YS  + LQTS                                            S  WF  DP +A  D+IFSNDN T+T +S +++ VL  +  S+GVHYWE  +D+ +    P+FGVA+ +  K++MLGKD+  WAMY+D+ RSWF+++N H  R++GGI  G+ VG+ +D  +  L++ IN+E  GP+AF  ++G  +PAVS N+ VQL   LG
Sbjct:    3 EMEEELKCPVCGSFYREPIILPCSHSLCLSCARNILVQTPDSESPQSRRASGV-----SDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPMQPHHQSSGALLLPIGPRNS--CLTCPQCHRSLILDERGLRGFAKNRVLEGVIERY------QQS---KAAALRCQLCEKSPKE-ATVMCEQCDVFYCEPCRLRCHPPRGPLAKHRLLPPAQG-RVSRRLSPRKISTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKVQLLSRVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGT-LTPRMTTDFDLNLDSAPLLQS-IHQLDFVQMKVP------------SLVPAPPLLQLEECCNHNNSATLSWKQPPMSMVQTEGYILELDDGNGGQFREVFVGKETMCTVDGLHFNSTYNARVKAFNKAGVSLYSKTLVLQTSEGPFRRMSATLAARLQVNSIPSPLEFLQHAEQESCGSPGNGSFASFPWFAFDPGSAHPDIIFSNDNLTVTCNSYDDRVVLGKSGFSKGVHYWELTIDRYDNHPDPAFGVARVEVMKDVMLGKDDKAWAMYVDNNRSWFMHSNSHTNRSEGGITKGATVGVLLDFTRRTLTFSINEEQQGPVAFENMEGLFFPAVSLNRNVQLLDCLG 743          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Mouse
Match: Trim9 (tripartite motif-containing 9 [Source:MGI Symbol;Acc:MGI:2137354])

HSP 1 Score: 474.552 bits (1220), Expect = 5.833e-155
Identity = 277/728 (38.05%), Postives = 415/728 (57.01%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXX--------------XXXXXXIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTV--ECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            +ME ELKCP C  +Y+ P++LPC H+LC  CA   L+   ++   Q ++ +       +D++  D D++S++SEADSG        S+                 A      H    L    R++   I C  C R  +LDD G+     NR LE V++ +       QS   + + + C LCE+   E A+V+CEQC+V+YC  C  RCHP RGPLAKH L   + G  + +    +K + C  H  E  S+YCV C+  VC  C++E  H  HE+  L  + K  K++LSQ L  L+++AK    F+  L+++ ++I  N  + E  +++  D +I  L ++K +L++++  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S +LI +V   E  + +   L PR +TDFDL L N  +L+S         HQ          V   S  P  PI+  E+C   +N  T+ W+  P  TV  + Y LE+DDG+ G FR+VY G E++CT++GLHF S Y  RVKA N+ G S YS  + LQTS V WF  DP +A +D+IFSNDN T+T  S +++ VL  T  S+GVHYWE  +D+ +    P+FGVA+ D  K+MMLGKD+  WAMY+D+ RSWF++NN H  RT+GGI  G+ +G+ +D ++  L++++N+E  GPIAF  ++G  +PAVS N+ VQ+TL  G   P
Sbjct:    3 EMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSRRAS---GSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPPTHLSPALAPVPRNS--CITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRY------QQS---KAAALKCQLCEKAPKE-ATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRTMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGT-LTPRMTTDFDLSLDNSPLLQSI--------HQ-----LDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVAADGYILELDDGSGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEVAWFAFDPGSAHSDIIFSNDNLTVTCSSYDDRVVLGKTGFSKGVHYWELTIDRYDNHPDPAFGVARIDVMKDMMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKTLTFFVNNEQQGPIAFENVEGLFFPAVSLNRNVQVTLHTGLPVP 700          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Mouse
Match: Trim9 (tripartite motif-containing 9 [Source:MGI Symbol;Acc:MGI:2137354])

HSP 1 Score: 422.55 bits (1085), Expect = 4.414e-135
Identity = 266/750 (35.47%), Postives = 402/750 (53.60%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXX--------------XXXXXXIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTV--ECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTS----------------------SVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            +ME ELKCP C  +Y+ P++LPC H+LC  CA   L+   ++   Q ++ +       +D++  D D++S++SEADSG        S+                 A      H    L    R++   I C  C R  +LDD G+     NR LE V++ +       QS   + + + C LCE+   E A+V+CEQC+V+YC  C  RCHP RGPLAKH L   + G  + +    +K + C  H  E  S+YCV C+  VC  C++E  H  HE+  L  + K  K++LSQ L  L+++AK    F+  L+++ ++I  N  + E  +++  D +I  L ++K +L++++  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S +LI +V   E  + +   L PR +TDFDL L N  +L+S         HQ          V   S  P  PI+  E+C   +N  T+ W+  P  TV  + Y LE+DDG+ G FR+VY G E++CT++GLHF S Y  RVKA N+ G S YS  + LQTS                      +V WF  DP +A +D+IFSNDN T+T  S +++ VL  T  S+GVHYWE  +D+ +    P+FGVA+ D  K+MMLGKD+  WA+                  T+GGI  G+ +G+ +D ++  L++++N+E  GPIAF  ++G  +PAVS N+ VQ+TL  G   P
Sbjct:    3 EMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSRRAS---GSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPPTHLSPALAPVPRNS--CITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRY------QQS---KAAALKCQLCEKAPKE-ATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRTMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGT-LTPRMTTDFDLSLDNSPLLQSI--------HQ-----LDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVAADGYILELDDGSGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEGCNFETQSASYSQLVDIKKLLAVAWFAFDPGSAHSDIIFSNDNLTVTCSSYDDRVVLGKTGFSKGVHYWELTIDRYDNHPDPAFGVARIDVMKDMMLGKDDKAWAI------------------TEGGITKGATIGVLLDLNRKTLTFFVNNEQQGPIAFENVEGLFFPAVSLNRNVQVTLHTGLPVP 704          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Mouse
Match: Trim67 (tripartite motif-containing 67 [Source:MGI Symbol;Acc:MGI:3045323])

HSP 1 Score: 407.527 bits (1046), Expect = 1.337e-128
Identity = 263/775 (33.94%), Postives = 394/775 (50.84%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLL--------PCCHS----------------LCTNCAAASLMSPDD------AVRLQQKQHADILSQNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFA---------ILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEAS------------TGTEILKH------------KKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQ--PYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            ME ELKCP C   ++ P++L        PC  +                L +  AAA+   PD                A  L         + D++S++SE DSG    + +  S  G     ++       A                 I C  C R   LD  G+     NR LE +V  +          +   +  +C LC+    EPA+ +CEQC+V YC  C  +CHP RGP AKH L +              TGT                    +K   C  H  E  S+YCV+CR+ VC +C++E  H KHE+  L    K  K +LSQ L  +++KAK    F+  LK++ ++I  N    E  +++  D ++  L ++K +L++++  E+E K     D I+  T  L ++ GL+++C+E++KE DP+ FL +S +LI +V  +++ +++   L+P+ S +FDL L +  +L+        A HQ       L  V M  + P  P++  E+C   +N +T+ W+  P+     E Y LE+DDG  G FR+VY G E++CTI+GLHF S Y  RVKA N  G   YS  V LQTS V WF  DP +   D+I SNDN+T T  S +++ VL T + S+GVHYWE  VD+ +    P+FGVA++   K+MMLGKD+  WAMY+D+ RSWF++ N H  RT+GG+  G+ VG+ +D +K  L+++IN +  GP AF+ + G   PA+S N+ VQ+TL  G E P
Sbjct:    1 MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPPPLLLSRGAAAAATPPDQDAAAGATSGGAGANTAGGLGGGATGGGDHADKLSLYSETDSGYGSYTPSLKSPNGVRVLPMVPAPPGSSAAAARGAACSSLCSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEGIVQRYQQGRGVVPGAAAAPAVAICQLCDRTPPEPAATLCEQCDVLYCATCQLKCHPSRGPFAKHRLVQPPPPPTPPEATPAVTGTSTASSAGGCRSPGGAGASAPRKFPTCPEHEMENYSMYCVSCRSPVCYMCLEEGRHSKHEVKPLGATWKQHKAQLSQALNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQINHCTLKLRQSTGLMEYCLEVIKEDDPSGFLQISDALIKRVQTSQEQWVKGA-LEPKVSAEFDLTLDSEPLLQ--------AIHQ-------LDFVQM--KLPPVPLLQLEKCCTRNNSVTLAWRTPPFTHSPAEGYILELDDGDGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLEVP 757          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Mouse
Match: Trim67 (tripartite motif-containing 67 [Source:MGI Symbol;Acc:MGI:3045323])

HSP 1 Score: 407.527 bits (1046), Expect = 1.337e-128
Identity = 263/775 (33.94%), Postives = 394/775 (50.84%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLL--------PCCHS----------------LCTNCAAASLMSPDD------AVRLQQKQHADILSQNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFA---------ILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEAS------------TGTEILKH------------KKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQ--PYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            ME ELKCP C   ++ P++L        PC  +                L +  AAA+   PD                A  L         + D++S++SE DSG    + +  S  G     ++       A                 I C  C R   LD  G+     NR LE +V  +          +   +  +C LC+    EPA+ +CEQC+V YC  C  +CHP RGP AKH L +              TGT                    +K   C  H  E  S+YCV+CR+ VC +C++E  H KHE+  L    K  K +LSQ L  +++KAK    F+  LK++ ++I  N    E  +++  D ++  L ++K +L++++  E+E K     D I+  T  L ++ GL+++C+E++KE DP+ FL +S +LI +V  +++ +++   L+P+ S +FDL L +  +L+        A HQ       L  V M  + P  P++  E+C   +N +T+ W+  P+     E Y LE+DDG  G FR+VY G E++CTI+GLHF S Y  RVKA N  G   YS  V LQTS V WF  DP +   D+I SNDN+T T  S +++ VL T + S+GVHYWE  VD+ +    P+FGVA++   K+MMLGKD+  WAMY+D+ RSWF++ N H  RT+GG+  G+ VG+ +D +K  L+++IN +  GP AF+ + G   PA+S N+ VQ+TL  G E P
Sbjct:    1 MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPPPLLLSRGAAAAATPPDQDAAAGATSGGAGANTAGGLGGGATGGGDHADKLSLYSETDSGYGSYTPSLKSPNGVRVLPMVPAPPGSSAAAARGAACSSLCSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEGIVQRYQQGRGVVPGAAAAPAVAICQLCDRTPPEPAATLCEQCDVLYCATCQLKCHPSRGPFAKHRLVQPPPPPTPPEATPAVTGTSTASSAGGCRSPGGAGASAPRKFPTCPEHEMENYSMYCVSCRSPVCYMCLEEGRHSKHEVKPLGATWKQHKAQLSQALNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQINHCTLKLRQSTGLMEYCLEVIKEDDPSGFLQISDALIKRVQTSQEQWVKGA-LEPKVSAEFDLTLDSEPLLQ--------AIHQ-------LDFVQM--KLPPVPLLQLEKCCTRNNSVTLAWRTPPFTHSPAEGYILELDDGDGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLEVP 757          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Mouse
Match: Trim67 (tripartite motif-containing 67 [Source:MGI Symbol;Acc:MGI:3045323])

HSP 1 Score: 407.527 bits (1046), Expect = 1.337e-128
Identity = 263/775 (33.94%), Postives = 394/775 (50.84%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLL--------PCCHS----------------LCTNCAAASLMSPDD------AVRLQQKQHADILSQNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFA---------ILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEAS------------TGTEILKH------------KKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQ--PYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            ME ELKCP C   ++ P++L        PC  +                L +  AAA+   PD                A  L         + D++S++SE DSG    + +  S  G     ++       A                 I C  C R   LD  G+     NR LE +V  +          +   +  +C LC+    EPA+ +CEQC+V YC  C  +CHP RGP AKH L +              TGT                    +K   C  H  E  S+YCV+CR+ VC +C++E  H KHE+  L    K  K +LSQ L  +++KAK    F+  LK++ ++I  N    E  +++  D ++  L ++K +L++++  E+E K     D I+  T  L ++ GL+++C+E++KE DP+ FL +S +LI +V  +++ +++   L+P+ S +FDL L +  +L+        A HQ       L  V M  + P  P++  E+C   +N +T+ W+  P+     E Y LE+DDG  G FR+VY G E++CTI+GLHF S Y  RVKA N  G   YS  V LQTS V WF  DP +   D+I SNDN+T T  S +++ VL T + S+GVHYWE  VD+ +    P+FGVA++   K+MMLGKD+  WAMY+D+ RSWF++ N H  RT+GG+  G+ VG+ +D +K  L+++IN +  GP AF+ + G   PA+S N+ VQ+TL  G E P
Sbjct:    1 MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPPPLLLSRGAAAAATPPDQDAAAGATSGGAGANTAGGLGGGATGGGDHADKLSLYSETDSGYGSYTPSLKSPNGVRVLPMVPAPPGSSAAAARGAACSSLCSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEGIVQRYQQGRGVVPGAAAAPAVAICQLCDRTPPEPAATLCEQCDVLYCATCQLKCHPSRGPFAKHRLVQPPPPPTPPEATPAVTGTSTASSAGGCRSPGGAGASAPRKFPTCPEHEMENYSMYCVSCRSPVCYMCLEEGRHSKHEVKPLGATWKQHKAQLSQALNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQINHCTLKLRQSTGLMEYCLEVIKEDDPSGFLQISDALIKRVQTSQEQWVKGA-LEPKVSAEFDLTLDSEPLLQ--------AIHQ-------LDFVQM--KLPPVPLLQLEKCCTRNNSVTLAWRTPPFTHSPAEGYILELDDGDGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLEVP 757          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. UniProt/SwissProt
Match: sp|Q29RQ5|TRIM9_BOVIN (E3 ubiquitin-protein ligase TRIM9 OS=Bos taurus OX=9913 GN=TRIM9 PE=2 SV=1)

HSP 1 Score: 475.322 bits (1222), Expect = 1.872e-154
Identity = 279/730 (38.22%), Postives = 419/730 (57.40%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXX--------------XXXXXXIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPI--APIIWREQCRVESNIITVIWQPYPGPTV--ECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            +ME ELKCP C  +Y+ P++LPC H++C  CA   L+   ++   Q ++ +       +D++  D D++S++SEADSG        S+                 A      H    L +  R++   I C  C R  +LDD G+     NR LE V++ +       QS   + + + C LCE+   E A+V+CEQC+V+YC  C  RCHP RGPLAKH L   + G  + +    +K + C  H  E  S+YCV C+  VC  C++E  H  HE+  L  + K  K++LSQ L  L+++AK    F+  L+++ ++I  N  + E  +++  D +I  L ++K +L++++  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S +LI +V   E  + +   L PR +TDFDL L N  +L+S         HQ       L  V M + +P+   PI+  E C   +N  T+ W+  P  TV  E Y LE+DDG  G FR+VY G E++CT++GLHF S Y  R+KA N+ G S YS  + LQTS V WF  DP +A +D+IFSNDN T+T  S +++ VL  T  S+GVHYWE  VD+ +    P+FGVA+ D  K++MLGKD+  WAMY+D+ RSWF++NN H  RT+GGI  G+ +G+ +D ++  L+++INDE  GPIAF  ++G  +PAVS N+ VQ+TL  G + P
Sbjct:    3 EMEEELKCPVCGSFYREPIILPCSHNICQACARNILVQTPESESPQSRRAS---GSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALASVPRNS--CITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRY------QQS---KAAALKCQLCEKAPKE-ATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGT-LTPRMTTDFDLSLDNSPLLQSI--------HQ-------LDFVQMKASSPVPATPILQLEDCCTHNNSATLSWKQPPLSTVPAEGYILELDDGNGGQFREVYVGKETMCTVDGLHFNSTYNARIKAFNKTGVSQYSKTLVLQTSEVAWFAFDPGSAHSDIIFSNDNLTVTCSSYDDRVVLGKTGFSKGVHYWELTVDRYDNHPDPAFGVARIDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDFNRKTLTFFINDEQQGPIAFENVEGLFFPAVSLNRNVQVTLHTGLQVP 700          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. UniProt/SwissProt
Match: sp|Q91ZY8|TRIM9_RAT (E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1)

HSP 1 Score: 474.552 bits (1220), Expect = 4.080e-154
Identity = 277/728 (38.05%), Postives = 415/728 (57.01%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXX--------------XXXXXXIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTV--ECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            +ME ELKCP C  +Y+ P++LPC H+LC  CA   L+   ++   Q ++ +       +D++  D D++S++SEADSG        S+                 A      H    L    R++   I C  C R  +LDD G+     NR LE V++ +       QS   + + + C LCE+   E A+V+CEQC+V+YC  C  RCHP RGPLAKH L   + G  + +    +K + C  H  E  S+YCV C+  VC  C++E  H  HE+  L  + K  K++LSQ L  L+++AK    F+  L+++ ++I  N  + E  +++  D +I  L ++K +L++++  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S +LI +V   E  + +   L PR +TDFDL L N  +L+S         HQ          V   S  P  PI+  E+C   +N  T+ W+  P  TV  + Y LE+DDG+ G FR+VY G E++CT++GLHF S Y  RVKA N+ G S YS  + LQTS V WF  DP +A +D+IFSNDN T+T  S +++ VL  T  S+GVHYWE  +D+ +    P+FGVA+ D  K+MMLGKD+  WAMY+D+ RSWF++NN H  RT+GGI  G+ +G+ +D ++  L++++N+E  GPIAF  ++G  +PAVS N+ VQ+TL  G   P
Sbjct:    3 EMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSRRAS---GSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPPTHLSPALAPVPRNS--CITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRY------QQS---KAAALKCQLCEKAPKE-ATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRTMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGT-LTPRMTTDFDLSLDNSPLLQSI--------HQ-----LDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVAADGYILELDDGSGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEVAWFAFDPGSAHSDIIFSNDNLTVTCSSYDDRVVLGKTGFSKGVHYWELTIDRYDNHPDPAFGVARIDVMKDMMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKTLTFFVNNEQQGPIAFENVEGLFFPAVSLNRNVQVTLHTGLPVP 700          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. UniProt/SwissProt
Match: sp|Q9C026|TRIM9_HUMAN (E3 ubiquitin-protein ligase TRIM9 OS=Homo sapiens OX=9606 GN=TRIM9 PE=1 SV=1)

HSP 1 Score: 474.167 bits (1219), Expect = 4.589e-154
Identity = 278/726 (38.29%), Postives = 414/726 (57.02%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNR-STHFA-----------ILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTV--ECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            +ME ELKCP C  +Y+ P++LPC H+LC  CA   L+   ++   Q  + A       +D++  D D++S++SEADSG        S+            ++   A    +TH +           I C  C R  +LDD G+     NR LE V++ +       QS   + + + C LCE+   E A+V+CEQC+V+YC  C  RCHP RGPLAKH L   + G  + +    +K + C  H  E  S+YCV C+  VC  C++E  H  HE+  L  + K  K++LSQ L  L+++AK    F+  L+++ ++I  N  + E  +++  D +I  L ++K +L++++  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S +LI +V   E  + +   L PR +TDFDL L N  +L+S         HQ          V   S  P  PI+  E+C   +N  T+ W+  P  TV  + Y LE+DDG  G FR+VY G E++CT++GLHF S Y  RVKA N+ G S YS  + LQTS V WF  DP +A +D+I SNDN T+T  S +++ VL  T  S+G+HYWE  VD+ +    P+FGVA+ D  K++MLGKD+  WAMY+D+ RSWF++NN H  RT+GGI  G+ +G+ +D ++ NL+++INDE  GPIAF  ++G  +PAVS N+ VQ+TL  G   P
Sbjct:    3 EMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAA---GSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRY------QQS---KAAALKCQLCEKAPKE-ATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGT-LTPRMTTDFDLSLDNSPLLQSI--------HQ-----LDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPADGYILELDDGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEVAWFAFDPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTFFINDEQQGPIAFDNVEGLFFPAVSLNRNVQVTLHTGLPVP 700          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. UniProt/SwissProt
Match: sp|M9MRI4|TRIM9_DROME (E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 6.783e-134
Identity = 249/685 (36.35%), Postives = 368/685 (53.72%), Query Frame = 2
Query:  353 SQNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFA--------------------ILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQE-SHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEV-ELKPRTSTDFDLKLSNIDILRSA----ISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDP---KTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            S++    +   D++S+FSEADS                      G +C   T+R   +A                    + C +C ++   DD G+  L T RA+E +V+ F  +             + C +CE  + + AS++CEQCE+ YC  C E  HP RGPLAKH L +        +   QQ+++ C  H +E LS YC++C+   C +C+ E  H  H++  +N  CKAQKTELS  LQ L+EKA++ T FIQ LK +S+K+  +  + E  + +  + +I+ +  ++  L+  ++++K+ K    KD     T  L +  GL+QFCIE LKE+D  AFL V   LI +VT  +  + QEV    PR S   DL L +  + R+        +R  +  + + P+          AP+ P I    C  E+N +TV WQP     VE Y LE+DDG+ G FR+VY G E+ICT++GLHF S+Y  RVKA N  G+  YS+ + LQT+ V WF  DP     A + +IFS +N T++ +  E +  L +   SRGVHYWEF +D       P+FGVA+ D  +  MLGKD   +AMYID +RSWF +N+ H  R +GGI +GS +G+ +D ++  LS+ +N+ P G +AF  L G  YPAVS N+ V LT+    +AP
Sbjct:  103 SESVTSDQDQSDKVSIFSEADS----------------------GVVCCSNTSRPVSYAGTGLLPGVGNVVAPPGAAYCLTCPLCRKLVFFDDGGVRNLPTYRAMEAIVDRFCAR-----------EALRCQMCET-DPKVASLICEQCEIRYCDACRELTHPARGPLAKHTLVKP-------RGAAQQRESVCGEH-EETLSQYCLSCKAPACGLCIGELRHQAHDVQSINVTCKAQKTELSHNLQQLSEKARSTTEFIQRLKGMSDKVTESCMEFERLVHAQCEALIQAIHDRREYLLEAIRMDKDTKIRILKDQQSNCTGKLQQTTGLIQFCIEALKETDSAAFLQVGSMLINRVTNTDMTWHQEVTNAAPRVSPIVDLTLDDAALARAIDNLNFIQMRAVKDGDERCPA----------APMTPTILPSDCSAENNSVTVAWQPPNHSFVEGYVLELDDGSGGEFREVYCGKETICTVDGLHFNSMYNARVKAFNSAGEGEYSELIGLQTAEVAWFTFDPVLSGGAGSGLIFSKNNATVSVEGWEHRVALGSVGFSRGVHYWEFTIDNYTADTDPAFGVARIDVARNKMLGKDEKSFAMYIDRQRSWFQHNSIHERRVEGGITTGSTIGVLLDLERHTLSFLVNEMPQGSVAFRDLYGVFYPAVSINRGVTLTMHTAMDAP 735          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. UniProt/SwissProt
Match: sp|Q6ZTA4|TRI67_HUMAN (Tripartite motif-containing protein 67 OS=Homo sapiens OX=9606 GN=TRIM67 PE=2 SV=3)

HSP 1 Score: 413.305 bits (1061), Expect = 6.748e-130
Identity = 235/632 (37.18%), Postives = 352/632 (55.70%), Query Frame = 2
Query:  530 ILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNL----------HEASTG----------------------TEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQ--PYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            I C  C R   LD  G+     NR LE +V  +          S   +  +C LC+    EPA+ +CEQC+V YC  C  +CHP RGP AKH L           EA++G                               +K   C  H  E  S+YCV+CRT VC +C++E  H KHE+  L  + K  K +LSQ L  +++KAK    F+  LK++ ++I  N    E  +++  D ++  L ++K +L++++  E+E K     D I+  T  L ++ GL+++C+E++KE+DP+ FL +S +LI +V  +++ +++   L+P+ S +FDL L +  +L+        A HQ       L  + M    P  P++  E+C   +N +T+ W+  P+    V+ Y LE+DDGA G FR+VY G E++CTI+GLHF S Y  RVKA N  G   YS  V LQTS V WF  DP +   D+I SNDN+T T  S +++ VL T + S+GVHYWE  VD+ +    P+FGVA++   K+MMLGKD+  WAMY+D+ RSWF++ N H  RT+GG+  G+ VG+ +D +K  L+++IN +  GP AF+ + G   PA+S N+ VQ+TL  G E P
Sbjct:  157 ITCPQCHRSASLDHRGLRGFQRNRLLEAIVQRYQQGRGAVPGTSAAAAVAICQLCDRTPPEPAATLCEQCDVLYCSACQLKCHPSRGPFAKHRLVQPPPPPPPPAEAASGPTGTAQGAPSGGGGCKSPGGAGAGATGGSTARKFPTCPEHEMENYSMYCVSCRTPVCYLCLEEGRHAKHEVKPLGAMWKQHKAQLSQALNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGA-LEPKVSAEFDLTLDSEPLLQ--------AIHQ-------LDFIQMKCRVPPVPLLQLEKCCTRNNSVTLAWRMPPFTHSPVDGYILELDDGAGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLEVP 772          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. TrEMBL
Match: A0A4S2L9W5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009213 PE=4 SV=1)

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 354/835 (42.40%), Postives = 485/835 (58.08%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLM---SPDDAVRLQ----------------------------------------QKQHADILS---QNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRI-TLLDDTGIECLLTNRALENVVNHFLTKVTPNQS-------------------PSKQISPILCNLCEE---------GNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQ-------ESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKL----------------------------------------SNIDILRSAISSVRLAEHQNPQ-YPSSLG-SVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKL-KGSLYPAVSFNKFVQLTLVLGREAP 2320
            KM++EL+CP C  ++  PLLLPC HSLCT+CAAA L+    P  A  +Q                                        Q Q + I +    + +   S  D++SV SE DSGVVV S+ GS +   S     H      + N  TH  ++C  C RI  LLDD GI  L  NRALE VV  F +     Q+                   P  +    LC LCEE         GNV  ASV CEQCE++YC +C E+CHP RGPL +H LH A+ G EI++ K+Q +   C +HS   ++ YC+ C+  VC  C++       E+H KHE+  LN+ CK++KTELSQ LQ+L+EKA+TGT FIQ L+S +E +N+   + E  +I+ ++ ++  LE+KKLEL ++L+  +E K    K  I Q T  L R+ GL+QFCIEMLKESDP+AF++VS SLI +   AE  F QE++    TS   DL +                                        + ++ +R AI  + L E Q  + Y   L  + +   E P  P+   E+C  E N+IT++WQP    +++ YTLE+DDGANG+FRKVYRG E+ICT+EGLHF+S+YR RVKAHN+ G+S+YS+ +CLQTS   WF +D   A  +++ +N NRT+T+   E++ ++ +T LSRGVHYWEF VD+ + GGQP+FG+A+ DCNKE+MLG D   W++Y D KRSWF++N +HFERTDGG+++GSVVG+R DC++G LSYY+NDEPHGPIAFT L  G  YPAVS  + +QLTL  G EAP
Sbjct:   47 KMDSELRCPACRRYFYCPLLLPCGHSLCTSCAAAGLLPATEPHVAAAIQAALTLPTTDQYNTAAGASFSSASSTTGSSSGCSSQPFGQNQSQASHIPTSTIHHVSSAHSDSDQVSVLSETDSGVVVTSRPGSYIARTSVLAS-HSNGPSSSLNTITH-GLICPACNRIIALLDDKGIGHLPRNRALERVVFKFASPEMLQQNLIETTVVNTETFPLLSATDPLNRPGGPLCQLCEEPEKGASEQTGNV--ASVWCEQCEIFYCTSCREKCHPSRGPLVRHALHSAAKGVEIVRRKRQNQPPPCLVHSHSPVTFYCLNCQVAVCTECLESDGNLSNETHGKHEVQPLNSACKSKKTELSQALQALSEKARTGTEFIQQLRSRTEGVNQKMLESERLVIAQLNLLLEVLEKKKLELTNRLREARESKVCSMKGQISQITGLLTRSTGLIQFCIEMLKESDPSAFMVVSQSLIMRARDAEYHFTQELDQAVPTSDQEDLDVYQYPASPDHEMHLSKGVVRKVSHKNMRKYDRNVSETSLHGNAVEAIRQAILELHLQEDQTVKTYACELEETTNRKREVPAPPMFLVEECISERNVITLVWQPSSTTSIDRYTLELDDGANGNFRKVYRGPETICTVEGLHFRSVYRARVKAHNQVGESAYSERICLQTSDFTWFHLDSTVAAPEILLTNGNRTVTSQVAEDRVIIGSTGLSRGVHYWEFTVDRCDAGGQPAFGIARQDCNKEIMLGLDMRSWSVYFDHKRSWFLHNGEHFERTDGGVRAGSVVGVRFDCNRGTLSYYLNDEPHGPIAFTNLPPGVYYPAVSLTRAIQLTLHCGLEAP 877          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. TrEMBL
Match: A0A4S2LFT7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009213 PE=4 SV=1)

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 354/835 (42.40%), Postives = 485/835 (58.08%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLM---SPDDAVRLQ----------------------------------------QKQHADILS---QNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRI-TLLDDTGIECLLTNRALENVVNHFLTKVTPNQS-------------------PSKQISPILCNLCEE---------GNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQ-------ESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKL----------------------------------------SNIDILRSAISSVRLAEHQNPQ-YPSSLG-SVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKL-KGSLYPAVSFNKFVQLTLVLGREAP 2320
            KM++EL+CP C  ++  PLLLPC HSLCT+CAAA L+    P  A  +Q                                        Q Q + I +    + +   S  D++SV SE DSGVVV S+ GS +   S     H      + N  TH  ++C  C RI  LLDD GI  L  NRALE VV  F +     Q+                   P  +    LC LCEE         GNV  ASV CEQCE++YC +C E+CHP RGPL +H LH A+ G EI++ K+Q +   C +HS   ++ YC+ C+  VC  C++       E+H KHE+  LN+ CK++KTELSQ LQ+L+EKA+TGT FIQ L+S +E +N+   + E  +I+ ++ ++  LE+KKLEL ++L+  +E K    K  I Q T  L R+ GL+QFCIEMLKESDP+AF++VS SLI +   AE  F QE++    TS   DL +                                        + ++ +R AI  + L E Q  + Y   L  + +   E P  P+   E+C  E N+IT++WQP    +++ YTLE+DDGANG+FRKVYRG E+ICT+EGLHF+S+YR RVKAHN+ G+S+YS+ +CLQTS   WF +D   A  +++ +N NRT+T+   E++ ++ +T LSRGVHYWEF VD+ + GGQP+FG+A+ DCNKE+MLG D   W++Y D KRSWF++N +HFERTDGG+++GSVVG+R DC++G LSYY+NDEPHGPIAFT L  G  YPAVS  + +QLTL  G EAP
Sbjct:   47 KMDSELRCPACRRYFYCPLLLPCGHSLCTSCAAAGLLPATEPHVAAAIQAALTLPTTDQYNTAAGASFSSASSTTGSSSGCSSQPFGQNQSQASHIPTSTIHHVSSAHSDSDQVSVLSETDSGVVVTSRPGSYIARTSVLAS-HSNGPSSSLNTITH-GLICPACNRIIALLDDKGIGHLPRNRALERVVFKFASPEMLQQNLIETTVVNTETFPLLSATDPLNRPGGPLCQLCEEPEKGASEQTGNV--ASVWCEQCEIFYCTSCREKCHPSRGPLVRHALHSAAKGVEIVRRKRQNQPPPCLVHSHSPVTFYCLNCQVAVCTECLESDGNLSNETHGKHEVQPLNSACKSKKTELSQALQALSEKARTGTEFIQQLRSRTEGVNQKMLESERLVIAQLNLLLEVLEKKKLELTNRLREARESKVCSMKGQISQITGLLTRSTGLIQFCIEMLKESDPSAFMVVSQSLIMRARDAEYHFTQELDQAVPTSDQEDLDVYQYPASPDHEMHLSKGVVRKVSHKNMRKYDRNVSETSLHGNAVEAIRQAILELHLQEDQTVKTYACELEETTNRKREVPAPPMFLVEECISERNVITLVWQPSSTTSIDRYTLELDDGANGNFRKVYRGPETICTVEGLHFRSVYRARVKAHNQVGESAYSERICLQTSDFTWFHLDSTVAAPEILLTNGNRTVTSQVAEDRVIIGSTGLSRGVHYWEFTVDRCDAGGQPAFGIARQDCNKEIMLGLDMRSWSVYFDHKRSWFLHNGEHFERTDGGVRAGSVVGVRFDCNRGTLSYYLNDEPHGPIAFTNLPPGVYYPAVSLTRAIQLTLHCGLEAP 877          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. TrEMBL
Match: A0A075A1V1 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_00552 PE=4 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 353/835 (42.28%), Postives = 484/835 (57.96%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLM---SPDDAVRLQ----------------------------------------QKQHADILS---QNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRI-TLLDDTGIECLLTNRALENVVNHFLTKVTPNQS-------------------PSKQISPILCNLCEE---------GNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQ-------ESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFD----------------------------------------LKLSNIDILRSAISSVRLAEHQNPQYPS--SLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKL-KGSLYPAVSFNKFVQLTLVLGREAP 2320
            KM++EL+CP C  ++  PLLLPC HSLCT+CAAA L+    P  A  +Q                                        Q Q + I +    + +   S  D++SV SE DSGVVV S+ GS +   S  +         + N  TH  ++C  C RI  LLDD GI  L  NRALE VV  F +     Q+                   P  +    LC LCEE         GNV  ASV CEQCE++YC +C E+CHP RGPL +H LH A  G EI++ K+Q +   C +HS   ++ YC+ C+  VC  C++       ESH KHE+  LN+ CK++KTELSQ LQSL+EKA+TGT FIQ L+S +E +N+   + E  +I+ ++ ++  LE+KKLEL ++L+  +E K    K  I Q T  L R+ GL+QFCIEMLKESDP+AF++VS SLI +   AE  F QE++    TS   D                                        L  + ++ +R AI  +RL E Q  +  +  +  + +   E P  P+   E+C  E N+IT++WQP    +++ YTLE+DDGANG+FRKVYRG E+ICT+EGLHF+S+YR RVKAHN+ G+S+YS+ +CLQTS   WF +D   A  +++ +N NRT+T+   E++ ++ +T LSRGVHYWEF VD+ + GGQP+FG+A+ DCNKE+MLG D   W++Y D KRSWF++N +HFERTDGG+++GSVVG+R DC++G LSYY+NDEPHGPIAFT L  G  +PAVS  + +QLTL  G EAP
Sbjct:   47 KMDSELRCPACRRYFYCPLLLPCGHSLCTSCAAAGLLPATEPHVAAAIQAALTLPTTDQYNTAAGASFSSASSTTGSSSGCSSQPFGQNQSQPSHIPNSAIHHVSSAHSDSDQVSVLSETDSGVVVSSRPGSYIARTSVLVSHSNGS-SSSLNTITH-GLICPACNRIIALLDDKGIGHLPRNRALERVVFKFASPEILQQNLIKTTVVNTETFPLLSATDPLNRPGGPLCQLCEEPEKGESEQIGNV--ASVWCEQCEIFYCTSCREKCHPSRGPLMRHALHTAVKGVEIVRRKRQNQPPPCLVHSHSPVTFYCLNCQVAVCTECLESDSNLPSESHGKHEVQPLNSACKSKKTELSQALQSLSEKARTGTEFIQQLRSKTEAVNQKMLESERLVIAQLNILLEVLEKKKLELTNRLREARESKLCNMKGQISQITGLLTRSTGLIQFCIEMLKESDPSAFMVVSQSLIMRARDAEYHFTQELDQAVPTSDQEDSDVYQYPASPEHEVHLSKGVVRKVPNKNMRKYDRNVSETSLHGNAVEAIRQAILELRLQEDQTVRTYACETEEAPNRKREVPSPPVFIVEECISERNVITLVWQPSSTTSIDRYTLELDDGANGNFRKVYRGPETICTVEGLHFRSVYRARVKAHNQVGESAYSERICLQTSDFTWFHLDSTVAAPEILLTNGNRTVTSQVAEDRVIIGSTGLSRGVHYWEFTVDRCDAGGQPAFGIARQDCNKEIMLGLDMRSWSVYFDHKRSWFLHNGEHFERTDGGVRTGSVVGVRFDCNRGTLSYYLNDEPHGPIAFTNLPPGVYFPAVSLTRAIQLTLHCGLEAP 877          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. TrEMBL
Match: A0A419QB13 (Tripartite motif-containing protein 67 (Fragment) OS=Clonorchis sinensis OX=79923 GN=Trim67 PE=4 SV=1)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 352/835 (42.16%), Postives = 485/835 (58.08%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDD---------AVRLQQKQHADI-----------------------LSQNTN--------------DHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRI-TLLDDTGIECLLTNRALENVVNHFLTKVTPNQS-------------------PSKQISPILCNLCEE---------GNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQ-------ESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTS-------------TDFDLKLSN---------------------------IDILRSAISSVRLAEHQNPQYPS--SLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKL-KGSLYPAVSFNKFVQLTLVLGREAP 2320
            KM++EL+CP C  ++  PLLLPC HSLCT+CAAA L+   +         A+ L    H +                          QN N                 S  D++SV SE DSGVVV S+ GS +   S  +  H      + +  TH  ++C  C RI  LLDD GI  L  NRALE VV  F +     Q+                   P  +    LC LCEE         GNV  ASV CEQCE++YC +C E+CHP RGPL +H LH A+ G EI++ K+Q +   C +HS   ++ YC+ C+  VC  C++       E+H KHE+  LN+ CK++KTELSQ LQSL+EKA+TGT FIQ L+S +E +N+   + E  +IS ++ ++  LE+KK+EL ++L+  +E K    K  I Q T  L R+ GL+QFCIEMLKESDP+AF++VS SLI +   AE  F QE++    TS              D ++ LS                            ++ +R AI  + L E Q  +  +  +  + +   E P  P+   E+C  E N+IT++WQP    +++ YTLE+DDGANG+FRKVYRG E+ICT+EGLHF+S+YR RVKAHN+ G+S+YS+ +CLQTS   WF +D   A  +++ +N NRT+T+   E++ ++ +T LSRGVHYWEF VD+ + GGQP+FG+A+ DCNKE+MLG D   W++Y D KRSWF++N +HFERTDGG+++GSVVG+R DC++G LSYY+NDEPHGPIAFT L  G  YPAVS  + +QLTL  G +AP
Sbjct:   47 KMDSELRCPACRRYFYCPLLLPCGHSLCTSCAAAGLLPATEPHVAAAIQTALTLPTTDHYNTAAGASFSSASSTTGSSSGCSSQPFGQNQNQPSHIPNNAIHHVSSAHSDSDQVSVLSETDSGVVVSSRPGSCIARTSVLVS-HSNGPSSSLSTITH-GLICPACNRIIALLDDKGIGHLPRNRALERVVFKFASPEILQQNLIETSVVNTETFPILSATDPLNRPGGPLCQLCEEPEKGESEQTGNV--ASVWCEQCEIFYCTSCREKCHPSRGPLMRHALHTAAKGVEIVRRKRQNQPPPCLVHSHSPVTFYCLNCQVAVCTECLENDGNLSNETHGKHEVQPLNSACKSKKTELSQALQSLSEKARTGTEFIQQLRSKTEGVNQKMLESERLVISQLNLLLEVLEKKKVELTNRLREARESKVCSMKGQISQITGLLTRSTGLIQFCIEMLKESDPSAFMVVSQSLIMRAREAEYHFTQELDQAVPTSDQEDSDVYQYPASPDHEMNLSKGVVRKVSNKNMRKYDRNVSGTSLHGNAVEAIRQAILELHLQEDQTVRTYACETEEAPNRKREVPAPPVFIVEECISERNVITLVWQPSSTTSIDRYTLELDDGANGNFRKVYRGPETICTVEGLHFRSVYRARVKAHNQVGESAYSERICLQTSDFTWFHLDSNVAAPEILLTNGNRTVTSQIAEDRVIIGSTGLSRGVHYWEFTVDRCDAGGQPAFGIARQDCNKEIMLGLDMRSWSVYFDHKRSWFLHNGEHFERTDGGVRTGSVVGVRFDCNRGTLSYYLNDEPHGPIAFTNLPPGVYYPAVSLTRAIQLTLHCGLDAP 877          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. TrEMBL
Match: G7Y6G5 (Tripartite motif-containing protein 9/67 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_101740 PE=4 SV=1)

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 352/835 (42.16%), Postives = 484/835 (57.96%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDD---------AVRLQQKQHADI-----------------------LSQNTN--------------DHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRI-TLLDDTGIECLLTNRALENVVNHFLTKVTPNQS-------------------PSKQISPILCNLCEE---------GNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQ-------ESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTS-------------TDFDLKLSN---------------------------IDILRSAISSVRLAEHQNPQYPS--SLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKL-KGSLYPAVSFNKFVQLTLVLGREAP 2320
            KM++EL+CP C  ++  PLLLPC HSLCT+CAAA L+   +         A+ L    H +                          QN N                 S  D++SV SE DSGVVV S+ GS +   S  +  H      + +  TH  ++C  C RI  LLDD GI  L  NRALE VV  F +     Q+                   P  +    LC LCEE         GNV  ASV CEQCE++YC +C E+CHP RGPL +H LH A+ G EI++ K+Q +   C +HS   ++ YC+ C+  VC  C++       E+H KHE+  LN+ CK++KTELSQ LQSL+EKA+TGT FIQ L+S +E +N+   + E  +IS ++ ++  LE+KK+EL ++L+  +E K    K  I Q T  L R+ GL+QFCIEMLKESDP+AF++VS SLI +   AE  F QE++    TS              D ++ LS                            ++ +R AI  + L E Q  +  +  +  + +   E P  P+   E+C  E N+IT++WQP    +++ YTLE+DDGANG+FRKVYRG E+ICT+EGLHF+S+YR RVKA N+ G+S+YS+ +CLQTS   WF +D   A  +++ +N NRT+T+   E++ ++ +T LSRGVHYWEF VD+ + GGQP+FG+A+ DCNKE+MLG D   W++Y D KRSWF++N +HFERTDGG+++GSVVG+R DC++G LSYY+NDEPHGPIAFT L  G  YPAVS  + +QLTL  G EAP
Sbjct:   47 KMDSELRCPACRRYFYCPLLLPCGHSLCTSCAAAGLLPATEPHVAAAIQTALTLPTTDHYNTAAGASFSSASSTTGSSSGCSSQPFGQNQNQPSHIPNNAIHHVSSAHSDSDQVSVLSETDSGVVVSSRPGSCIARTSVLVS-HSNGPSSSLSTITH-GLICPACNRIIALLDDKGIGHLPRNRALERVVFKFASPEILQQNLIETSVVNTETFPILSATDPLNRPGGPLCQLCEEPEKGESEQTGNV--ASVWCEQCEIFYCTSCREKCHPSRGPLMRHALHTAAKGVEIVRRKRQNQPPPCLVHSHSPVTFYCLNCQVAVCTECLENDGNLSNETHGKHEVQPLNSACKSKKTELSQALQSLSEKARTGTEFIQQLRSKTEGVNQKMLESERLVISQLNLLLEVLEKKKVELTNRLREARESKVCSMKGQISQITGLLTRSTGLIQFCIEMLKESDPSAFMVVSQSLIMRAREAEYHFTQELDQAVPTSDQEDSDVYQYPASPDHEMNLSKGVVRKVSNKNMRKYDRNVSGTSLHGNAVEAIRQAILELHLQEDQTVRTYACETEEAPNRKREVPAPPVFIVEECISERNVITLVWQPSSTTSIDRYTLELDDGANGNFRKVYRGPETICTVEGLHFRSVYRARVKAQNQVGESAYSERICLQTSDFTWFHLDSNVAAPEILLTNGNRTVTSQIAEDRVIIGSTGLSRGVHYWEFTVDRCDAGGQPAFGIARQDCNKEIMLGLDMRSWSVYFDHKRSWFLHNGEHFERTDGGVRTGSVVGVRFDCNRGTLSYYLNDEPHGPIAFTNLPPGIYYPAVSLTRAIQLTLHCGLEAP 877          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Cavefish
Match: trim9 (tripartite motif containing 9 [Source:ZFIN;Acc:ZDB-GENE-030131-8043])

HSP 1 Score: 446.817 bits (1148), Expect = 8.755e-145
Identity = 269/718 (37.47%), Postives = 400/718 (55.71%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXX----XXXXXXIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPT--VECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            +ME ELKCP C  +++ P++LPC H++C         SP         Q A       +D++  D D++S++SEADSG        S+       +  G+ +                +    C R   LDD G+     NR LE VV  +       QS   + + + C LCE+   E A+V+CEQC+V+YC  C  RCHP RGPLAKH L   + G  I +    +K + C  H  E LS+YCV C+  VC  C++E  H  HE+  L  + K  K +LSQ L  L+++A     F+  L+++ + I  N  + E  +++  D +I  L ++K +L++++  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S +LI +V   E  + +   L PR ++DFDL L +  +L++                  L  V M  + P API+  E+C  ++N  T+ W+  P  T  V+ Y LE+DDG  G FR+VY G E+ICT++GLHF S Y+ RVKA N  G   YS  + +QTS + WF  DP +A  D+I SNDN T+T +S +++ V+  T+ SRGVHYWE  +D+ +    P+FG+A+ D  K++MLGKD+  WAMY+D+ RSWF++NN H  RTDGGI  G+ VG+ +D  +G L + INDE  GP+AF  L+G  YPA+S N+ VQ+TL  G   P
Sbjct:    3 EMEEELKCPVCGSFFREPIILPCSHNICL------AYSP---------QSARASGSAASDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCPKSPNGVRVFPPAPPPPQQSQQQHLLPPPTCHRSLTLDDRGLRGFPKNRVLEAVVERY------QQS---KAAALRCQLCEKTPRE-ATVLCEQCDVFYCDACRVRCHPPRGPLAKHRLVPPAQG-RISRRASPRKTSTCTEHELENLSMYCVQCKMPVCYQCLEEGRHSAHEVKALGAMWKLHKGQLSQALNVLSDRATEAKEFLVQLRNMVQHIQENGVEFEACLVAQCDALIEALNRRKAQLLTRVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHMTEGQWGKGT-LTPRMTSDFDLTLDSGPLLQTI---------------QQLDFVQM--KVPAAPILQLEECCSQTNSATLSWKQPPLSTIAVDGYILELDDGNGGQFREVYVGIETICTVDGLHFNSTYKSRVKAFNSSGVGQYSKTLVMQTSEIAWFTFDPASAHPDIILSNDNLTVTCNSYDDRVVMGNTAFSRGVHYWEITIDRYDNHPDPAFGIARGDVLKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTDGGIGKGATVGVLLDFSRGILLFLINDEQQGPVAFDSLEGLYYPAISLNRNVQVTLHTGLPIP 676          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Cavefish
Match: TRIM67 (tripartite motif containing 67 [Source:NCBI gene;Acc:103027505])

HSP 1 Score: 441.039 bits (1133), Expect = 4.383e-142
Identity = 272/747 (36.41%), Postives = 413/747 (55.29%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCA-AASLMSPDDAVRLQQKQHADIL--SQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNL-----------------HEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSL----GSVSMDSEA-------PIAPIIWREQCRVESNIITVIW-----QPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            ME ELKCP C   +  P++LPC H++C  CA + ++ +PD             L  S    D++  D D++S  SE DSG    +    S  G          + L A     H ++ C +C R   LD+ G+     NR LE VV          Q  ++ +    C LC+  N   A+V CEQC+V YC  C +RCHP RGPLAKH L                   A+    +      +  + C  H  E  S YC +CRT VC VC+++  H KH++  L  + K  K +LSQ L  +++KAK    F+  LK+L ++I  N  + E  +++  D +I  L ++K +L++++  EKE K    +D I   T  L +  G++++C+E++KE+DP+ FLL+S +LI +V A++  +++   L+P+   +F L + N D L  +I  +   + ++ Q P+ +      V  + E+       P AP++  E+C + +N  T+ W     Q  P   VE Y LE+DDG  G +R+VY G E++CT++GLHF S Y  RVKA+N  G  +YS  V L+TS V WF  DP +A  D++ SN+N+T++ +S +++ VL T + S+GVHYWE  VD+ +    P+FGVA+ +  K+MMLGKD+  WAMY+D+ RSWF++NN H  R +GGI  GS VG+ +D  K  L+++IN E HGP+AF  L+G   PAVS N+ VQ+TL+ G E P
Sbjct:    1 MEEELKCPVCGSLFTDPIILPCSHNVCAGCARSIAVQTPDGETPPHAAATHGRLAASAGAPDYDYLDVDKMSTHSETDSGYGSYTPCAKSPNGVRV---FPPPVLLAAR----HCSVTCPLCHRSVSLDERGLRAFPRNRLLEAVVARH------RQGRARAVK---CQLCDR-NPPDATVTCEQCDVSYCNACQQRCHPARGPLAKHRLVPPAALAQQQQPAASSAGAANCTVNVAVATTARVPSTCVEHEAENYSAYCASCRTPVCYVCVEDGKHGKHDVKPLAVMWKQHKCQLSQALNGVSDKAKDAKEFLVQLKNLLQQIQENGVEFEACLVAQCDALIEALTRQKAKLLTKVTKEKESKLKTVRDQITHCTMKLRQTTGMMEYCLEVIKENDPSGFLLISDALIKRVQASQDQWVKGA-LEPKVCPEFALSI-NTDPLMQSILQLDFTQGKDGQKPALMKQMHAGVQTEMESTGDTPAVPPAPLLQLEKCCMRNNSATLAWRITAVQALP---VEGYILELDDGNGGQYREVYVGKETVCTVDGLHFNSSYNARVKAYNSIGVGAYSKTVVLKTSDVAWFTFDPTSAHRDIVLSNENQTVSCNSYDDRVVLGTAAFSKGVHYWELSVDRYDNHPDPAFGVARINTMKDMMLGKDDKAWAMYVDNNRSWFMHNNSHTNRAEGGITKGSTVGVLLDLTKHTLTFFINKEQHGPVAFENLEGVFMPAVSLNRNVQVTLITGLEVP 725          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Cavefish
Match: TRIM67 (tripartite motif containing 67 [Source:NCBI gene;Acc:103027505])

HSP 1 Score: 437.187 bits (1123), Expect = 7.816e-141
Identity = 271/736 (36.82%), Postives = 407/736 (55.30%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCA-AASLMSPDDAVRLQQKQHADIL--SQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNL-----------------HEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIW-----QPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            ME ELKCP C   +  P++LPC H++C  CA + ++ +PD             L  S    D++  D D++S  SE DSG    +    S  G          + L A     H ++ C +C R   LD+ G+     NR LE VV          Q  ++ +    C LC+  N   A+V CEQC+V YC  C +RCHP RGPLAKH L                   A+    +      +  + C  H  E  S YC +CRT VC VC+++  H KH++  L  + K  K +LSQ L  +++KAK    F+  LK+L ++I  N  + E  +++  D +I  L ++K +L++++  EKE K    +D I   T  L +  G++++C+E++KE+DP+ FLL+S +LI +V A++  +++   L+P+   +F L + N D L  +I  ++L   Q    P+           P AP++  E+C + +N  T+ W     Q  P   VE Y LE+DDG  G +R+VY G E++CT++GLHF S Y  RVKA+N  G  +YS  V L+TS V WF  DP +A  D++ SN+N+T++ +S +++ VL T + S+GVHYWE  VD+ +    P+FGVA+ +  K+MMLGKD+  WAMY+D+ RSWF++NN H  R +GGI  GS VG+ +D  K  L+++IN E HGP+AF  L+G   PAVS N+ VQ+TL+ G E P
Sbjct:    1 MEEELKCPVCGSLFTDPIILPCSHNVCAGCARSIAVQTPDGETPPHAAATHGRLAASAGAPDYDYLDVDKMSTHSETDSGYGSYTPCAKSPNGVRV---FPPPVLLAAR----HCSVTCPLCHRSVSLDERGLRAFPRNRLLEAVVARH------RQGRARAVK---CQLCDR-NPPDATVTCEQCDVSYCNACQQRCHPARGPLAKHRLVPPAALAQQQQPAASSAGAANCTVNVAVATTARVPSTCVEHEAENYSAYCASCRTPVCYVCVEDGKHGKHDVKPLAVMWKQHKCQLSQALNGVSDKAKDAKEFLVQLKNLLQQIQENGVEFEACLVAQCDALIEALTRQKAKLLTKVTKEKESKLKTVRDQITHCTMKLRQTTGMMEYCLEVIKENDPSGFLLISDALIKRVQASQDQWVKGA-LEPKVCPEFALSI-NTDPLMQSI--LQLDFTQGKDTPA----------VPPAPLLQLEKCCMRNNSATLAWRITAVQALP---VEGYILELDDGNGGQYREVYVGKETVCTVDGLHFNSSYNARVKAYNSIGVGAYSKTVVLKTSDVAWFTFDPTSAHRDIVLSNENQTVSCNSYDDRVVLGTAAFSKGVHYWELSVDRYDNHPDPAFGVARINTMKDMMLGKDDKAWAMYVDNNRSWFMHNNSHTNRAEGGITKGSTVGVLLDLTKHTLTFFINKEQHGPVAFENLEGVFMPAVSLNRNVQVTLITGLEVP 702          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Cavefish
Match: mid2 (midline 2 [Source:ZFIN;Acc:ZDB-GENE-090220-1])

HSP 1 Score: 110.153 bits (274), Expect = 2.469e-24
Identity = 139/601 (23.13%), Postives = 231/601 (38.44%), Query Frame = 2
Query:  527 AILCGVCLRITLLDDTGIECLLTNRALENVVNHFL-TKVTPNQSPSKQISP-----------ILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIY-XXXXXXXXXXXXMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKV---TAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLE--IDDGANGSFRKVYRGCESIC----------TIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKT--------------VLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYY 2203
            A  C  C  +  L+  G+E L  N  L+N+++ F    V+   SPS+   P           + C  CE+     A   C  CEV YC  C    HP + P   H L E      +       +   C  H  E++++Y  V  + +     +   H +H++  L+      K  L   L +L ++       +  L  + +++  N    E +++   D ++  + Q+K  +  ++K  K  K  K    I      L R++ L+    + LKE+D   FL  + ++  +V   TA+ Q  + +V L      +F L  S    +   +  +                      AP  P I  E C    + ITV W      +V  Y L+  I  G   +F  +Y   +S            T+ GL   + Y   VKA N+ G S  S+P  L+T+S   F +DPKTA   +  SND  TM  D    K                     +  G HYWE ++         + GVA     K    GK++  W ++     ++ + +N      +  ++    +G+ +D D   LS+Y
Sbjct:   53 AFQCPTCRYVITLNQRGLEGLKRNVTLQNIIDRFQKASVSGPNSPSESRRPRVGGIMSAEQRVACQFCEQEPPREAVKTCVTCEVSYCDRCLRATHPNKKPFTSHRLLEPVADAHL-------RGLACLEHENEKVNMYCVVDDQLICALCKLVGRHREHQVTSLSDRFDKLKQTLENNLTNLVKRNSELENQMAKLIQICQQVEVNTAMHEAKLVEECDELVEIIRQRKQVIAVKIKESKVMKLRKLAQQIANCRQCLERSSALITQAEQSLKENDHARFLQTARNVAERVAMATASSQVLIPDVNLND-AFDNFALDFSREKKILEGLDYL---------------------TAPNPPSIRDELCTASHDTITVHWTSEDEFSVTSYELQYTIYTGQT-NFISLYNSVDSWMIVPNIKQNHYTVHGLQSGTRYIFFVKAINQAG-SRNSEPARLKTNSQP-FKLDPKTAHKKLRLSNDCLTMEKDESSLKKSHTPERFSGTGSYGAAGNVFIDSGCHYWEVLLGAC---TWYAVGVAYKSAPKNEWNGKNSSSW-VFSRCNNNFLVRHNGKEMLVEASLQLRR-LGVLLDYDNNALSFY 616          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Cavefish
Match: MID1 (midline 1 [Source:NCBI gene;Acc:103030906])

HSP 1 Score: 103.219 bits (256), Expect = 4.135e-22
Identity = 142/626 (22.68%), Postives = 241/626 (38.50%), Query Frame = 2
Query:  527 AILCGVC-LRITLLDDTGIECLLTNRALENVVNH----------FLTKVTPNQSPSKQISP----------------ILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIY-XXXXXXXXXXXXMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSL---ITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLE--IDDGANG---------SFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKT--------------VLATTSLSRGVHYWEFIVDKIEPGGQPSF--GVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNND---------HFERTDGGIKSGSVVGIRIDCDKGNLSYY 2203
            A  C  C   I L    G++ L  N  L+N+++            L    PN SPS +  P                + C  CE+   + A   C  CEV YC+ C    HP + P   H L E    + +       +  +C  H +E++++Y     + +     +   H  H++  L+   +  K  L   L SL ++       +  L    + +  N  ++E +++   D +I  +++++  + +++K  K  +  K    I      + R++ L+    + LKESD   FL  + S+   ++  TA+ Q  + E+ L     T F L  +    +  ++  +                      AP  P I  E C    + ITV W      +V  Y L+  I  G +          S+  V    ++  T+ GL   + Y   VKA N+ G  S S+P  L+T+S   F +DPK+A   +  S+DN T+  D    K               V     +  G HYWE ++     GG   +  G+A     K   +GK+   W +      SW + +N          H  R          VG+ +D D G+L++Y
Sbjct:   53 AFQCPTCRYVIALSPQRGLDGLKRNVTLQNIIDRVQRASSATTLLLPTSGPN-SPSDEGRPPPSSLAAMTTTPSPELVQCQFCEQDPPQDAVKTCVTCEVSYCEECLRATHPNKKPFTGHRLIEPLPDSHL-------RGLQCLEHEEEKVNMYCVTDEQLICSLCKLVGRHRDHQVAALSERYEKLKQTLDCNLSSLIKRNNELESLMGKLIQTCQHVEMNASRQEGKLMDECDLLINIIQERRQIIGAKIKEGKTVRLRKLAQQIANCKQCIERSSALITQADQTLKESDHARFLQTAKSISERVSMATASSQVLIPEINLTDTFDT-FALDFTREKKMLESLDYL---------------------TAPSPPGIREELCTASYDTITVHWTSDDEFSVVSYELQYAIFTGQSNIVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFIVKAINQAGSRS-SEPGTLKTNSQP-FKLDPKSAHRKLKVSHDNLTVERDETSSKKSHGQERFSSQSSYGVTGNVYIDSGRHYWEALI-----GGSTWYAVGIACKTAPKHEWIGKNPSSWVL-CRCNNSWVVRHNSKEMAIEPSPHLRR----------VGVLLDYDAGSLAFY 630          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Nematostella
Match: EDO41245 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S501])

HSP 1 Score: 396.741 bits (1018), Expect = 1.617e-126
Identity = 255/711 (35.86%), Postives = 355/711 (49.93%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAIL-CGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            ME EL+CP CN  Y  P++LPC HS+C +C  A   +     ++   +   +    ++D       +SV+                                H      +F  L C +C +I  LD  G+     N+ LEN+VN    K   N         + C LCE     PA+V+CEQCEV YC+ CC+ CHP RGPLAKHNL   ++         +    +C+ H +E  S+YCV CR  VC VC++   H  HE+  L  + K QK+EL   L  L E       +I  L+     I  N    E  +++  DG+I+ +E +K+ELI+ +  E + K    K  I +    L    GLL +  E LKE+DP +FLLV   +  ++         E       S + DL L          S+   A H+       L  V +  +AP AP I  +QC V +N IT+ W P     +E Y +EIDDG  GSF +VYRG    CT++GL F S YR RVK  N+ G+   SD V L TS + WF +D +TA  D+I SNDN T T  S +++ VL     S+G HYWE  +D+ +    P+ GVA  D  K+ +LGKD+  W MYIDS RSWF +NN+H  R DGGI+ GS +GI +D     +S+Y+ND+  G I    + G+LYPA S N+ VQ+TL  G E P
Sbjct:    1 MEEELQCPVCNKPYNCPVVLPCSHSICMSCTKAITTTSGADYQVSSGEKEPVADPFSDD----SGYVSVYEVN-----------------------------HLYQAIGNFPCLKCPICRKIFPLDGRGVNGFPRNKLLENIVNRHYAKSNGN---------VYCQLCEGSQPAPATVMCEQCEVSYCEECCKTCHPSRGPLAKHNLIHPASSK---ASSVKSSLVKCKDHLEEHNSMYCVVCRIPVCYVCIERGQHKGHEVKALGAMFKEQKSELGNNLNLLEENRNHLQNYINQLQESCSVIQENGLDFEASVVAQCDGLIQFIENRKMELINAINKEMQTKVENVKQQITEYEHTLKDTVGLLGYSREALKETDPASFLLVRTIISHEICGTGTGIPSE-----PPSVELDLTLDT--------SATAQALHE-------LHFVEL--KAPDAPDIIPDQCSVTNNTITLCWMPRKQSCIESYLVEIDDGNGGSFVEVYRGNSLECTVQGLQFDSTYRARVKGINKSGEGGPSDEVYLTTSDIAWFSLDLETAHPDIILSNDNNTATCTSFDDRVVLGGAGFSKGCHYWEVTIDRYDGNPDPAMGVAFIDTIKDSILGKDDKAWCMYIDSSRSWFRHNNEHSNRRDGGIEVGSCIGILLDISNLKVSFYLNDQRRGAIRLPSISGALYPAFSLNRNVQITLHTGLEPP 644          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Nematostella
Match: EDO40277 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7Q5])

HSP 1 Score: 202.216 bits (513), Expect = 4.919e-55
Identity = 190/726 (26.17%), Postives = 315/726 (43.39%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFA--ILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQIS-PILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQE-SHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFL--LVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEID----DG---ANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSF---GVAKSDCNKEMMLGKDNIGWAMYIDS-KRSWFINNNDHFE-RTDGGIKSGSVVGIRIDCDKGNLSYYINDE--PHGPIAFTKLKGSLYPAVS-FNKFVQLTLVLG 2308
            ME EL CP C + ++ P++LPC H+LCT CA   ++ P    R   K  AD +++N                                                 N  +H    + C  C R   +D  G++ L  N  LENV+  F  +      P +Q   P+LC  CE+   + A+  C+QC   YC  C + CHP +GPLA H L       +     K      C  H  E +++YC  CR+ VC +C +  SH  H +  L  + +  K  +++ L +L  +       +  L+ +     ++    E  +    D ++  +E+KK EL+  +  E   K  +  + I +    L ++ GL++F  E LKE +P  FL  +++  L  K        LQ  + +P   +   +  +    L    +S ++      Q PS+          P  P+I  E C +++  I+  W P     V+CY +E+D    +G      +F KVY+G  +  T+ GL +      RVKA N  G+   S+ + L T   L+F +DP TA  ++  S D+ T+   S     +L    LS G HYW   VD+     Q S    G+A+   + + +LG+D+  +A+ I+    +  IN  +  + +      + S VG+ ++ D   L+ Y N +  P+GP  F  +  + YPA+S +   V+LT+  G
Sbjct:    1 MEGELTCPICLELFQRPVVLPCSHNLCTRCAR-RILEP----RGSSKAWADWVTEN----------------------------------------------KGPNYKSHLEPDVKCPSCRRKIPVDPRGVDALPRNLILENVIERFKEE---RAVPGRQAQQPVLCQFCEDVAPQTATCTCKQCGFSYCGTCFDACHPMKGPLASHTLGPPD---DKAPKPKNTSNMMCPDHPHERMALYCYGCRSAVCYLCKEAGSHRAHHVELLEKVFRKTKVRVTRSLGTLMRRNTATQKLVDTLEGMCAVAKKSGNDVESHVKKECDALLAIVEKKKAELLDNVNSEYNEKLAELHETILECDKTLQQSLGLVEFSQEALKEDNPVTFLQQMMNVYLNGK--------LQTPDTRPGGPSFAGVSGTFSPALSVYGTSAQMTLIPGLQSPST---------PPGIPVINLEDCSIDNTKISFAWVPPEQCNVDCYIMEVDILDREGDIHQERTFTKVYQGPRNKFTLRGLEYNVTVVARVKAVNTAGEGEPSEEISLSTEKGLYFQLDPSTANHELEMSPDDCTVALKSPMYTFILGNVKLSSGRHYWRVHVDEFSSPNQLSIIGVGIARGIID-DPILGEDSHSYAVQINEHPTTTCINTKNRIQIKRSSAEMTNSNVGVLLNLDDHLLNIYFNGKSVPNGP-TFHGITQAFYPALSLYGMNVKLTVHTG 650          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Nematostella
Match: EDO41244 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S500])

HSP 1 Score: 90.5077 bits (223), Expect = 7.702e-22
Identity = 46/92 (50.00%), Postives = 56/92 (60.87%), Query Frame = 2
Query: 1544 APIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTS 1819
            AP AP I  +QC V +N IT+ W P     +E Y +EIDDG  GSF +VYRG    CT++GL F S YR RVK  N+ G+   SD V L TS
Sbjct:    2 APDAPDIIPDQCSVTNNTITLCWMPRKQSCIESYLVEIDDGNGGSFVEVYRGNSLECTVQGLQFDSTYRARVKGINKSGEGGPSDEVYLTTS 93          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Nematostella
Match: EDO26154 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCR1])

HSP 1 Score: 80.8777 bits (198), Expect = 1.017e-17
Identity = 51/158 (32.28%), Postives = 76/158 (48.10%), Query Frame = 2
Query: 1556 PIIWREQCRVESNIITVIWQPYPGPTVECYTLEID----DG---ANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSF 2008
            P+I  E C +++  I+  W P     V+CY +E+D    +G      +F KVY+G  +  T+ GL +      RVKA N  G+   S+ + L T   L+F +DP TA  ++  S D+ T+   S     +L    LS G HYW   VD+     Q S 
Sbjct:    2 PVINLEDCSIDNTKISFAWVPPEQCNVDCYIMEVDILDREGDIHQERTFTKVYQGPRNKFTLRGLEYNVTVVARVKAVNTAGEGEPSEEISLSTEKGLYFQLDPSTANHELEMSPDDCTVALKSPMYTFILGNVKLSSGRHYWRVHVDEFSSPNQLSI 159          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Nematostella
Match: EDO39347 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC4])

HSP 1 Score: 51.6026 bits (122), Expect = 1.641e-6
Identity = 33/99 (33.33%), Postives = 51/99 (51.52%), Query Frame = 2
Query: 1541 EAPIAPIIWREQCRVESNIITVIWQPYPGPT----VECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSV 1825
            E P  P     Q + +++   V W P PG T    +  + LE+DDG  G F++VY G E+  + +GL     YR+R+  ++  G S +S  V L+T  V
Sbjct:  558 ERPARPFPPALQGKAKTSSFAVTWDP-PGDTGGTPISKFVLEMDDGKGGPFKEVYGGMETERSFDGLLPGHHYRMRLACYSEGGISEWSRVVKLRTIPV 655          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Medaka
Match: trim9 (tripartite motif containing 9 [Source:NCBI gene;Acc:101167580])

HSP 1 Score: 461.07 bits (1185), Expect = 6.468e-150
Identity = 279/731 (38.17%), Postives = 410/731 (56.09%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRST-----------------HFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPT--VECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            +ME ELKCP C  +Y+ P++LPC H++C  CA   L+   +A   Q  +     +  + D++  D D++S++SEADSG        S+            ++   A  +                   +  I C  C R  +LD+ G+     NR LE VV+ +       QS +  +    C LCE+   E A+V+CEQC+V+YC  C  RCHP RGPLAKH L   + G  I +    +K + C  H  E LS+YCV C+T VC  C++E  H  HE+  L  + K  K +LSQ L  L+++A     F+  L+++ + I  N  + E  +++  D +I  L ++K +L+SQ+  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S  LI +V   E  + +   L PR ++DFDL L +  +L++         HQ       L  V M  + P API+  E+C  ++N  T+ W+  P  T  VE Y LE+DDG  G FR+VY G E+ICT++GLHF S YR RVKA N  G   YS  + +QTS + WF  DP +A  D++FSNDN T+T +S +++ V+   + SRGVHYWE  +D+ +    P+FG+A+ D  K++MLGKD+  WAMY+D+ RSWF++NN H  RTDGGI  GS VG+ +D  +  L + INDE  GP+AF  L+G+ YPAVS N+ VQ+TL  G   P
Sbjct:    3 EMEEELKCPVCGSFYREPIILPCSHNICLACARNILVQTPEAESPQSSR-----ASGSADYDYLDLDKMSLYSEADSGYGSYGGFVSAPTTPCQKSPNGVRVFPPAVPQPPPQQHLLQPPGSFPPIPRNSCITCPQCHRSLILDERGLRGFPKNRVLEGVVDRY------QQSKAAALK---CQLCEKSPRE-ATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RISRRASPRKISTCTEHELENLSMYCVQCKTPVCYQCLEEGKHGPHEVKALGAMWKLHKGQLSQALNVLSDRATEAKEFLVQLRNMVQHIQENGVEFEACLVAQCDALIDALNRRKAQLLSQVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDPLIRRVHMTEGQWGKGT-LTPRMTSDFDLTLDSGPLLQTI--------HQ-------LDFVQM--KVPAAPILQLEECCTQNNSATLSWKQPPLSTIAVEGYILELDDGNGGPFREVYVGTETICTVDGLHFNSTYRSRVKAFNASGVGQYSKTLIMQTSEMAWFTFDPSSAHPDILFSNDNLTVTCNSYDDRVVMGNAAFSRGVHYWEITIDRYDNHPDPAFGIARGDVVKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTDGGIAKGSTVGMLLDFSRRILIFLINDEQQGPVAFEGLEGAFYPAVSLNRNVQVTLHTGLPIP 699          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Medaka
Match: trim9 (tripartite motif containing 9 [Source:NCBI gene;Acc:101167580])

HSP 1 Score: 454.136 bits (1167), Expect = 5.360e-147
Identity = 280/744 (37.63%), Postives = 411/744 (55.24%), Query Frame = 2
Query:  191 KMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRST-----------------HFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPT--VECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTS-------------SVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            +ME ELKCP C  +Y+ P++LPC H++C  CA   L+   +A   Q  +     +  + D++  D D++S++SEADSG        S+            ++   A  +                   +  I C  C R  +LD+ G+     NR LE VV+ +       QS +  +    C LCE+   E A+V+CEQC+V+YC  C  RCHP RGPLAKH L   + G  I +    +K + C  H  E LS+YCV C+T VC  C++E  H  HE+  L  + K  K +LSQ L  L+++A     F+  L+++ + I  N  + E  +++  D +I  L ++K +L+SQ+  E E K    +D I   T  L +  GL+++C+E++KE+DP+ FL +S  LI +V   E  + +   L PR ++DFDL L +  +L++         HQ       L  V M  + P API+  E+C  ++N  T+ W+  P  T  VE Y LE+DDG  G FR+VY G E+ICT++GLHF S YR RVKA N  G   YS  + +QTS             +V WF  DP +A  D++FSNDN T+T +S +++ V+   + SRGVHYWE  +D+ +    P+FG+A+ D  K++MLGKD+  WAMY+D+ RSWF++NN H  RTDGGI  GS VG+ +D  +  L + INDE  GP+AF  L+G+ YPAVS N+ VQ+TL  G   P
Sbjct:    3 EMEEELKCPVCGSFYREPIILPCSHNICLACARNILVQTPEAESPQSSR-----ASGSADYDYLDLDKMSLYSEADSGYGSYGGFVSAPTTPCQKSPNGVRVFPPAVPQPPPQQHLLQPPGSFPPIPRNSCITCPQCHRSLILDERGLRGFPKNRVLEGVVDRY------QQSKAAALK---CQLCEKSPRE-ATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RISRRASPRKISTCTEHELENLSMYCVQCKTPVCYQCLEEGKHGPHEVKALGAMWKLHKGQLSQALNVLSDRATEAKEFLVQLRNMVQHIQENGVEFEACLVAQCDALIDALNRRKAQLLSQVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDPLIRRVHMTEGQWGKGT-LTPRMTSDFDLTLDSGPLLQTI--------HQ-------LDFVQM--KVPAAPILQLEECCTQNNSATLSWKQPPLSTIAVEGYILELDDGNGGPFREVYVGTETICTVDGLHFNSTYRSRVKAFNASGVGQYSKTLIMQTSETGLPPCDIQSIGAVAWFTFDPSSAHPDILFSNDNLTVTCNSYDDRVVMGNAAFSRGVHYWEITIDRYDNHPDPAFGIARGDVVKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTDGGIAKGSTVGMLLDFSRRILIFLINDEQQGPVAFEGLEGAFYPAVSLNRNVQVTLHTGLPIP 712          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Medaka
Match: TRIM67 (tripartite motif containing 67 [Source:NCBI gene;Acc:105357218])

HSP 1 Score: 444.121 bits (1141), Expect = 3.237e-143
Identity = 269/742 (36.25%), Postives = 415/742 (55.93%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCAA-ASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNL-----HEASTGTEILKHKKQQ------KKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAIS----------------SVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQ---PYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAP 2320
            M+ ELKCP C   +K P+LLPC H++C  CA   ++ +PD     Q +      +  ++D++  D D++S++SE DSG    +               +G           H ++ C +C R   LD+ G+     NR LE++V         + S S   +P  C LC+   V+ A+V+CEQC+VYYC  C +RCHP RGPLAKH L       A+ G  +     QQ      K   C  H  E  S+YC +CR  VC  C++E  H KH++  L  + K  K +LSQ L  +++KAK    F+  LK++ ++I  N  + E   ++  D +I  L ++K +L++++  EKE K    +D I   T  L +  G++++C+E+LKE+DP+ +L +S +LI +VT+++  +++   L+P+ S+DFDL L+   +L++ +                  ++ A+    +  +    V      P AP++  E+C   +N  T+ W+   P   P ++ Y LE+DDG  G +R+VY G E++CT++GLHF S Y  RVKA+N  G   YS  V L+TS V WF  DP +A  D++ SN+N T++ +S +++ VL T + S+GVHYWE  +D+ +    P+FGVA+ +  K+MMLGKD+  WAMY+D+ RSWF++N+ H  R +GGI  GS VGI +D  K  L++YIN + HGP AF  L G   PAVS N+ VQ+TLV G E P
Sbjct:    1 MDEELKCPVCGSLFKEPILLPCSHNVCLMCARNITVQTPDGETPAQSR------ASGSSDYDYLDMDKMSLYSETDSGYGSFTPCQLKSP--------NGVRVFPPVLPQRHCSLTCPLCHRSVSLDERGLRGFPRNRLLESIVARCQQNRASSSSSSSSGAP-KCQLCDRNPVD-ATVMCEQCDVYYCGACQQRCHPSRGPLAKHRLVPPPRQAAAGGAAMAPGGGQQPPVAARKPATCVDHEAENFSMYCCSCRAPVCTKCLEEGKHGKHDVRPLAVMWKQHKCQLSQALNGVSDKAKDAKEFLVQLKNMLQQIQENGVEFEACFVAQCDSLIEALTRQKAKLLTKVTKEKEYKLKVVRDQITHCTMKLRQTTGMMEYCLEVLKENDPSGYLQISDALIKRVTSSQDQWVKGA-LEPKVSSDFDLVLNTDSLLQTILQLDFCHGKDVQEKPLLKQMQAADSYEAEMETESPGVEPGPSVPAAPLLQLEKCCTRNNSATLAWRVTVPTSNP-IDGYILELDDGNGGQYREVYVGRETVCTVDGLHFNSSYNARVKAYNTIGVGPYSKTVVLKTSDVAWFTFDPSSAHRDIVLSNENLTVSCNSYDDRVVLGTAAFSKGVHYWEVRIDRYDNHPDPAFGVARINTMKDMMLGKDDKAWAMYVDNNRSWFMHNS-HTNRAEGGINKGSTVGILLDLVKRTLTFYINQKQHGPTAFDSLDGVFVPAVSLNRNVQVTLVTGLEVP 723          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Medaka
Match: TRIM67 (tripartite motif containing 67 [Source:NCBI gene;Acc:105357218])

HSP 1 Score: 436.417 bits (1121), Expect = 1.083e-140
Identity = 265/721 (36.75%), Postives = 406/721 (56.31%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCAA-ASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNL-----HEASTGTEILKHKKQQ------KKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQ---PYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVL 2305
            M+ ELKCP C   +K P+LLPC H++C  CA   ++ +PD     Q +      +  ++D++  D D++S++SE DSG    +               +G           H ++ C +C R   LD+ G+     NR LE++V         + S S   +P  C LC+   V+ A+V+CEQC+VYYC  C +RCHP RGPLAKH L       A+ G  +     QQ      K   C  H  E  S+YC +CR  VC  C++E  H KH++  L  + K  K +LSQ L  +++KAK    F+  LK++ ++I  N  + E   ++  D +I  L ++K +L++++  EKE K    +D I   T  L +  G++++C+E+LKE+DP+ +L +S +LI +VT+++  +++   L+P+ S+DFDL L+   +L++ +           Q     G V      P AP++  E+C   +N  T+ W+   P   P ++ Y LE+DDG  G +R+VY G E++CT++GLHF S Y  RVKA+N  G   YS  V L+TS V WF  DP +A  D++ SN+N T++ +S +++ VL T + S+GVHYWE  +D+ +    P+FGVA+ +  K+MMLGKD+  WAMY+D+ RSWF++N+ H  R +GGI  GS VGI +D  K  L++YIN + HGP AF  L G   PAVS N+ VQ  L +
Sbjct:    1 MDEELKCPVCGSLFKEPILLPCSHNVCLMCARNITVQTPDGETPAQSR------ASGSSDYDYLDMDKMSLYSETDSGYGSFTPCQLKSP--------NGVRVFPPVLPQRHCSLTCPLCHRSVSLDERGLRGFPRNRLLESIVARCQQNRASSSSSSSSGAP-KCQLCDRNPVD-ATVMCEQCDVYYCGACQQRCHPSRGPLAKHRLVPPPRQAAAGGAAMAPGGGQQPPVAARKPATCVDHEAENFSMYCCSCRAPVCTKCLEEGKHGKHDVRPLAVMWKQHKCQLSQALNGVSDKAKDAKEFLVQLKNMLQQIQENGVEFEACFVAQCDSLIEALTRQKAKLLTKVTKEKEYKLKVVRDQITHCTMKLRQTTGMMEYCLEVLKENDPSGYLQISDALIKRVTSSQDQWVKGA-LEPKVSSDFDLVLNTDSLLQTIL-----------QLDFCHGKVEPGPSVPAAPLLQLEKCCTRNNSATLAWRVTVPTSNP-IDGYILELDDGNGGQYREVYVGRETVCTVDGLHFNSSYNARVKAYNTIGVGPYSKTVVLKTSDVAWFTFDPSSAHRDIVLSNENLTVSCNSYDDRVVLGTAAFSKGVHYWEVRIDRYDNHPDPAFGVARINTMKDMMLGKDDKAWAMYVDNNRSWFMHNS-HTNRAEGGINKGSTVGILLDLVKRTLTFYINQKQHGPTAFDSLDGVFVPAVSLNRNVQFRLRM 691          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Medaka
Match: TRIM67 (tripartite motif containing 67 [Source:NCBI gene;Acc:105357218])

HSP 1 Score: 433.335 bits (1113), Expect = 3.702e-139
Identity = 264/737 (35.82%), Postives = 410/737 (55.63%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCAA-ASLMSPDDAVRLQQKQHADILSQNTNDHESYD-DRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNL-----HEASTGTEILKHKKQQ------KKTRCRLHSQEELSIYXXXXXXXXXXXXMQES-HLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAIS----------------SVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQ---PYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVL 2305
            M+ ELKCP C   +K P+LLPC H++C  CA   ++ +PD     Q +      +  ++D++  D D++S++SE DSG    +               +G           H ++ C +C R   LD+ G+     NR LE++V         + S S   +P  C LC+   V+ A+V+CEQC+VYYC  C +RCHP RGPLAKH L       A+ G  +     QQ      K   C  H  E  S+YC +CR  VC  C++E  H KH++  L  + K  K +LSQ L  +++KAK    F+  LK++ ++I  N  + E   ++  D +I  L ++K +L++++  EKE K    +D I   T  L +  G++++C+E+LKE+DP+ +L +S +LI +VT+++  +++   L+P+ S+DFDL L+   +L++ +                  ++ A+    +  +    V      P AP++  E+C   +N  T+ W+   P   P ++ Y LE+DDG  G +R+VY G E++CT++GLHF S Y  RVKA+N  G   YS  V L+TS V WF  DP +A  D++ SN+N T++ +S +++ VL T + S+GVHYWE  +D+ +    P+FGVA+ +  K+MMLGKD+  WAMY+D+ RSWF++N+ H  R +GGI  GS VGI +D  K  L++YIN + HGP AF  L G   PAVS N+ VQ  L +
Sbjct:    1 MDEELKCPVCGSLFKEPILLPCSHNVCLMCARNITVQTPDGETPAQSR------ASGSSDYDYLDMDKMSLYSETDSGYGSFTPCQLKSP--------NGVRVFPPVLPQRHCSLTCPLCHRSVSLDERGLRGFPRNRLLESIVARCQQNRASSSSSSSSGAP-KCQLCDRNPVD-ATVMCEQCDVYYCGACQQRCHPSRGPLAKHRLVPPPRQAAAGGAAMAPGGGQQPPVAARKPATCVDHEAENFSMYCCSCRAPVCTKCLEEGKHGKHDVRPLAVMWKQHKCQLSQALNGVSDKAKDAKEFLVQLKNMLQQIQENGVEFEACFVAQCDSLIEALTRQKAKLLTKVTKEKEYKLKVVRDQITHCTMKLRQTTGMMEYCLEVLKENDPSGYLQISDALIKRVTSSQDQWVKGA-LEPKVSSDFDLVLNTDSLLQTILQLDFCHGKDVQEKPLLKQMQAADSYEAEMETESPGVEPGPSVPAAPLLQLEKCCTRNNSATLAWRVTVPTSNP-IDGYILELDDGNGGQYREVYVGRETVCTVDGLHFNSSYNARVKAYNTIGVGPYSKTVVLKTSDVAWFTFDPSSAHRDIVLSNENLTVSCNSYDDRVVLGTAAFSKGVHYWEVRIDRYDNHPDPAFGVARINTMKDMMLGKDDKAWAMYVDNNRSWFMHNS-HTNRAEGGINKGSTVGILLDLVKRTLTFYINQKQHGPTAFDSLDGVFVPAVSLNRNVQFRLRM 718          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Planmine SMEST
Match: SMESG000048786.1 (SMESG000048786.1)

HSP 1 Score: 1400.96 bits (3625), Expect = 0.000e+0
Identity = 735/736 (99.86%), Postives = 736/736 (100.00%), Query Frame = 2
Query:  179 MSRSKMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAPXXXXXXXXXXXNLGTKPSSGQK 2386
            MSRSKMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYDDRISVFSEADSGVVVGSKTGSSVGGASGGIVIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLH+ASTGTEILKHKKQQKKTRCRLHSQEELSIYCVTCRTVVCCVCMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPKKEEEIISSIDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAPSESEESEEDDENLGTKPSSGQK
Sbjct:    1 MSRSKMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYDDRISVFSEADSGVVVGSKTGSSVGGASGGIVIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHDASTGTEILKHKKQQKKTRCRLHSQEELSIYCVTCRTVVCCVCMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPKKEEEIISSIDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAPSESEESEEDDENLGTKPSSGQK 736          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Planmine SMEST
Match: SMESG000048786.1 (SMESG000048786.1)

HSP 1 Score: 1390.94 bits (3599), Expect = 0.000e+0
Identity = 730/731 (99.86%), Postives = 731/731 (100.00%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAPXXXXXXXXXXXNLGTKPSSGQK 2386
            MEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYDDRISVFSEADSGVVVGSKTGSSVGGASGGIVIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLH+ASTGTEILKHKKQQKKTRCRLHSQEELSIYCVTCRTVVCCVCMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPKKEEEIISSIDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAPSESEESEEDDENLGTKPSSGQK
Sbjct:    1 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHADILSQNTNDHESYDDRISVFSEADSGVVVGSKTGSSVGGASGGIVIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHDASTGTEILKHKKQQKKTRCRLHSQEELSIYCVTCRTVVCCVCMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPKKEEEIISSIDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFNKFVQLTLVLGREAPSESEESEEDDENLGTKPSSGQK 731          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Planmine SMEST
Match: SMESG000016119.1 (SMESG000016119.1)

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 379/741 (51.15%), Postives = 510/741 (68.83%), Query Frame = 2
Query:  194 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHAD--------ILSQNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKG------------------------SLYPAVSFNKFVQLTLVLGREAP 2320
            MEAELKCP CN W+K  LLLPC HS+C+ CA   + + ++  +   +Q+ D        IL+  +   E   D +S  SE DSGVVV ++  S+         I+        NR   +++ C  C R+ LLD +GI+C++ N+AL+ VV +F  KV   +S         C +C E    PA  +CEQCE+YYC +C +RCHP RGPL +H LH A +GT+IL++K++QKK+ C  H+ EEL+++C  CR ++C  C+Q+ HL+HE+H ++TICK QKTELS LLQSL+EKAK+G  FI NLKSLSEKIN+   +KE EIIS+ID +I  L +KK ELIS ++ EK +K  +FK++IHQ+TAALGRANG +QFCIEML+ESD T+FLL+S SL+TKV   EQAF+QE+E K   S DF++++S+++ L+  I+++RL E Q   Y +++ +  + ++AP API W EQC   +NI TV WQPYPGP V  YTLEIDDGA G FRKVYRGCE +CT+EGLHF+S Y +RVKAHN+HG+S YSD +CL+T  +  F M   +   DV  SN+  T++T+S ++  +L +T LSRGVHYWEF +DK++PG QP+FGVA+SDC ++ MLG D+ GW+MYI+ KRSWF++ ++HFERTDGGIK GS VG+R+DCDKG LSYYINDEPHGPIAFTKL                          + YPAVSFNK VQ TL++GRE P
Sbjct:    1 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTS---EQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIY------VNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKS--------YCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 724          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Planmine SMEST
Match: SMESG000032020.1 (SMESG000032020.1)

HSP 1 Score: 350.903 bits (899), Expect = 3.222e-107
Identity = 250/774 (32.30%), Postives = 388/774 (50.13%), Query Frame = 2
Query:  179 MSRSKMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQK---------------QHADILSQNTNDHESYDDRISVFSEADXXXXXXXXXXXXXXXXXXXXXIHGQ--ICLHATNRSTHFAILCGVCLRITLL--DDTGIECLLTNRALENVVNHFLTKVTPNQSP--SKQISPILCNLCEEGN---VEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYXXXXXXXXXXXXMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPXXXXXXXXXXDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEV-ELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDP--KTAKTDVIFSNDNRTMTTDSV--EEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTK-LKGS------------------------------LYPAVSFNKFVQLTLVLGREAP 2320
            M   K+E+ELKC  C  ++  P +L C HS+C  C   ++      + L Q                Q     +   + HES  D     SE+DSG+ +   + +S+G  +       Q    +  +NR     ++C  C   ++L  +++ I+C   N +L ++ N +  +   N SP  S + S  LC LC++ +   ++PAS++CEQC+V+YC  C E+CHP RGP  KHNL   +     LK K+  K   C  HS+E L  +C  C  ++C  C+   H +H    ++   K  K  LS+ LQ ++ + KT T FIQ+LKS  +++        E + S ID +I  LE K+  L  Q K E E K    KD I++    + +   ++   +E++KE +   F +++  +I +    E  F+QE  ++KP+    F+  L    +++  IS+++  E +                 P +P    E+C V  N+I V+W P     V+ Y LEIDDG  G F+  Y G ES+CTIE L+F S YR+R+++ N  G S   D + L TSS+  F M P    +KT +  S D   + +  +  E   ++A+T   +G+HYWEF VD  +   + SFGVA  +C K   LG D   W+M++DS+RSWFI+N+ H ER D  +  G  +GIR+D +   LSY+IN++PHGPIAFTK L GS                              LYPA+SFN  ++++L+ G   P
Sbjct:    1 MLSKKLESELKCGFCQQFFNTPHILDCGHSVCDECGKLNIQ----KINLPQPKFYQTSNSNSSLSTFQRQKDQTSFASSHESEQD---AASESDSGIFLSHTSHTSLGYENTFAASMNQPGSTVKLSNRH-QCQLICPSCGYSSILSQNNSTIDCFPLNLSLASICNRYQVE---NSSPINSLKSSSHLCQLCDDSDKDRIQPASLICEQCDVFYCYQCREKCHPMRGPFEKHNLLPVAEAD--LKFKR--KIHNCSQHSEENLEYFCDQCNRLICRQCITTEHSRHLTTPISAHTKKAKVSLSKCLQRISGQVKTTTEFIQSLKSTIDQLKAKHDGFVENVDSKIDYLIEVLESKRKSLHEQAKQELENKEKIIKDQINEGGIFISQTMSMMNLAVELIKEPNGAQFSMIADKMINRTERLETKFIQEYGDMKPKCRKRFEWCLETDSVMKE-ISNLQFKEFK----------------CPDSPKFIFERCTVWDNLINVVWHPQGSIEVDKYLLEIDDGIGGQFKNAYCGPESMCTIENLNFSSNYRLRIRSINEAGVSRKGDVIKLSTSSIAKFRMLPLFGASKTGINMSGDGTIIESVELGSEHSVLMASTGFIKGIHYWEFRVDHFDGKAEFSFGVAMENCVKNKKLGSDMFSWSMFVDSRRSWFIHNSVHSERIDVKLSIGDRIGIRLDLNNQRLSYFINNQPHGPIAFTKFLVGSSRSYNQLLNNSQTGSGSNHSLNECTSRTKMLYPALSFNHNIKVSLITGIPPP 742          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIM99.556e-15538.29tripartite motif containing 9 [Source:HGNC Symbol;... [more]
TRIM671.121e-14136.07tripartite motif containing 67 [Source:HGNC Symbol... [more]
TRIM671.405e-13037.18tripartite motif containing 67 [Source:HGNC Symbol... [more]
TRIM677.155e-12937.18tripartite motif containing 67 [Source:HGNC Symbol... [more]
TRIM95.337e-8435.24tripartite motif containing 9 [Source:HGNC Symbol;... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
madd-21.953e-12734.93pep chromosome:WBcel235:V:1223908:1235445:-1 gene:... [more]
madd-25.638e-12634.59pep chromosome:WBcel235:V:1223901:1235445:-1 gene:... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Trim96.767e-13536.35gene:FBgn0051721 transcript:FBtr0304114[more]
Trim97.121e-13536.56gene:FBgn0051721 transcript:FBtr0080096[more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIM671.036e-14637.50tripartite motif containing 67 [Source:NCBI gene;A... [more]
trim93.459e-13436.07tripartite motif containing 9 [Source:ZFIN;Acc:ZDB... [more]
mid11.793e-2823.86midline 1 [Source:ZFIN;Acc:ZDB-GENE-110411-205][more]
mid21.007e-2322.64midline 2 [Source:ZFIN;Acc:ZDB-GENE-090220-1][more]
trim46a2.021e-1720.92tripartite motif containing 46a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk351.653e-14736.56serine/threonine kinase 35 [Source:Xenbase;Acc:XB-... [more]
stk352.724e-14636.78serine/threonine kinase 35 [Source:Xenbase;Acc:XB-... [more]
stk355.317e-14034.81serine/threonine kinase 35 [Source:Xenbase;Acc:XB-... [more]
stk356.039e-14034.81serine/threonine kinase 35 [Source:Xenbase;Acc:XB-... [more]
stk354.033e-13834.67serine/threonine kinase 35 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trim95.833e-15538.05tripartite motif-containing 9 [Source:MGI Symbol;A... [more]
Trim94.414e-13535.47tripartite motif-containing 9 [Source:MGI Symbol;A... [more]
Trim671.337e-12833.94tripartite motif-containing 67 [Source:MGI Symbol;... [more]
Trim671.337e-12833.94tripartite motif-containing 67 [Source:MGI Symbol;... [more]
Trim671.337e-12833.94tripartite motif-containing 67 [Source:MGI Symbol;... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q29RQ5|TRIM9_BOVIN1.872e-15438.22E3 ubiquitin-protein ligase TRIM9 OS=Bos taurus OX... [more]
sp|Q91ZY8|TRIM9_RAT4.080e-15438.05E3 ubiquitin-protein ligase TRIM9 OS=Rattus norveg... [more]
sp|Q9C026|TRIM9_HUMAN4.589e-15438.29E3 ubiquitin-protein ligase TRIM9 OS=Homo sapiens ... [more]
sp|M9MRI4|TRIM9_DROME6.783e-13436.35E3 ubiquitin-protein ligase TRIM9 OS=Drosophila me... [more]
sp|Q6ZTA4|TRI67_HUMAN6.748e-13037.18Tripartite motif-containing protein 67 OS=Homo sap... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2L9W50.000e+042.40Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LFT70.000e+042.40Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A075A1V10.000e+042.28Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A419QB130.000e+042.16Tripartite motif-containing protein 67 (Fragment) ... [more]
G7Y6G50.000e+042.16Tripartite motif-containing protein 9/67 (Fragment... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trim98.755e-14537.47tripartite motif containing 9 [Source:ZFIN;Acc:ZDB... [more]
TRIM674.383e-14236.41tripartite motif containing 67 [Source:NCBI gene;A... [more]
TRIM677.816e-14136.82tripartite motif containing 67 [Source:NCBI gene;A... [more]
mid22.469e-2423.13midline 2 [Source:ZFIN;Acc:ZDB-GENE-090220-1][more]
MID14.135e-2222.68midline 1 [Source:NCBI gene;Acc:103030906][more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412451.617e-12635.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402774.919e-5526.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412447.702e-2250.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO261541.017e-1732.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393471.641e-633.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trim96.468e-15038.17tripartite motif containing 9 [Source:NCBI gene;Ac... [more]
trim95.360e-14737.63tripartite motif containing 9 [Source:NCBI gene;Ac... [more]
TRIM673.237e-14336.25tripartite motif containing 67 [Source:NCBI gene;A... [more]
TRIM671.083e-14036.75tripartite motif containing 67 [Source:NCBI gene;A... [more]
TRIM673.702e-13935.82tripartite motif containing 67 [Source:NCBI gene;A... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000048786.10.000e+099.86SMESG000048786.1[more]
SMESG000048786.10.000e+099.86SMESG000048786.1[more]
SMESG000016119.10.000e+051.15SMESG000016119.1[more]
SMESG000032020.13.222e-10732.30SMESG000032020.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025299 ID=SMED30025299|Name=E3 ubiquitin-protein ligase TRIM9|organism=Schmidtea mediterranea sexual|type=transcript|length=2822bp
CATTAGGAAAATTAAAAAAGGATAGACATATGGAGTTATGTATTGTTAAT
AGGGGTTTAGGAAAAGAAATACTATTTTTTTTGTATAGGATTTTCAATTC
TAAGACATGTTGATTTGAGATTCATAAACTGTATTATTTGATTTTGGATT
TAACATTGTTTTGGGTTTTTATAATCGAATGAGTCGTTCAAAGATGGAGG
CTGAATTAAAATGTCCGAAATGTAATGATTGGTACAAAGTTCCATTGTTA
CTTCCATGTTGTCATTCTCTTTGTACAAATTGTGCAGCAGCTTCATTGAT
GTCACCCGATGATGCTGTACGATTACAACAGAAACAACATGCTGACATTC
TTTCACAAAATACCAATGACCATGAGTCGTATGATGATAGAATCAGTGTT
TTCAGTGAAGCTGATTCTGGAGTTGTAGTTGGAAGCAAGACTGGAAGTTC
TGTCGGTGGTGCAAGCGGAGGAATCGTGATACACGGACAAATCTGTTTGC
ATGCGACAAATCGTTCGACTCATTTTGCTATTCTTTGTGGAGTTTGTTTA
AGAATTACGCTGTTAGACGATACAGGAATCGAATGTCTACTGACTAATAG
AGCTCTTGAAAATGTTGTCAATCATTTCCTAACCAAAGTTACTCCGAACC
AGTCTCCTTCTAAACAGATATCTCCGATTCTTTGTAATCTATGCGAAGAA
GGAAACGTAGAACCAGCGTCAGTCGTTTGTGAACAATGCGAAGTATATTA
TTGTAAAAATTGCTGCGAAAGATGTCATCCACAAAGAGGACCACTGGCCA
AGCACAATTTGCATGAAGCAAGTACCGGTACTGAGATTTTGAAGCATAAA
AAACAACAAAAGAAAACCAGATGCCGGTTGCACTCCCAAGAAGAATTAAG
CATCTATTGTGTTACATGTCGAACAGTAGTTTGTTGCGTTTGTATGCAAG
AGTCACACTTGAAACATGAACTCCATCAATTAAATACCATATGTAAAGCG
CAAAAGACTGAACTTTCACAGTTGTTACAATCTCTGACGGAAAAAGCAAA
GACTGGAACATATTTTATTCAGAACCTGAAATCTTTATCGGAAAAAATTA
ACAGGAATTTCCCTAAAAAAGAAGAAGAAATAATATCGTCAATTGATGGA
ATTATTCGATGTCTAGAACAGAAAAAACTAGAACTCATTTCTCAATTAAA
AGTCGAAAAAGAAAGAAAGAACGTAAAATTCAAAGATCACATTCACCAAG
CAACCGCAGCTCTTGGTCGAGCCAACGGACTTCTTCAATTCTGCATTGAA
ATGCTGAAAGAGAGTGATCCGACAGCTTTTCTTTTAGTTTCGTATTCCCT
AATCACTAAAGTGACAGCTGCTGAACAAGCATTCCTTCAAGAAGTGGAGC
TGAAGCCACGAACATCGACAGATTTCGACTTGAAATTATCAAACATAGAT
ATTCTCCGTTCAGCCATCTCCTCTGTTCGACTAGCCGAACACCAAAACCC
TCAATATCCGAGCTCCTTAGGATCTGTCTCAATGGACTCCGAGGCTCCAA
TCGCACCAATAATTTGGAGAGAGCAATGCAGAGTGGAAAGCAATATTATA
ACAGTAATTTGGCAACCTTATCCCGGCCCAACTGTTGAATGTTACACCTT
GGAAATCGATGATGGTGCGAATGGATCATTCAGAAAAGTTTATCGTGGCT
GTGAATCTATATGCACAATTGAAGGCCTACATTTCAAATCCATTTATAGG
ATTCGCGTCAAGGCCCACAATCGTCACGGAGACAGTTCATACAGTGATCC
GGTTTGCCTGCAAACCTCAAGCGTACTTTGGTTCTGTATGGACCCCAAAA
CTGCAAAGACCGATGTGATTTTTTCCAACGACAACAGAACAATGACGACG
GATTCTGTTGAAGAAAAAACTGTACTTGCGACGACCAGTTTATCACGCGG
CGTTCATTACTGGGAATTCATTGTTGATAAAATCGAGCCCGGCGGGCAGC
CATCATTTGGTGTGGCAAAATCTGACTGCAATAAAGAAATGATGCTAGGT
AAAGATAATATTGGATGGGCGATGTATATAGATTCAAAGCGGAGCTGGTT
CATTAACAACAACGACCATTTTGAGAGAACAGATGGAGGAATTAAATCCG
GTTCAGTTGTCGGGATCCGAATAGATTGTGACAAAGGAAATCTCAGTTAT
TACATCAACGATGAACCTCATGGGCCTATTGCATTCACAAAATTGAAAGG
CTCTCTTTACCCTGCTGTCAGCTTTAACAAATTCGTCCAGTTGACTCTCG
TTCTTGGCAGAGAAGCTCCCAGTGAAAGTGAAGAAAGTGAAGAAGATGAC
GAAAACCTCGGAACAAAACCTTCATCCGGACAAAAGTAAATCCCGAAAAT
GTTTTTGGTAGCTCAAAATGGGAAATATTTCACTGATTTGTTTTTTTGTA
TCAGGTTGAACAAAATTTGATTTGATTTTTATATGTAATCATTGTAATTA
TTTCATTCTTTTTAAATGTTTCAAAGGTTCTGACGTATTGCAAGCTTGGA
ATCAAGCATCTAATGTCAAATTCTTAACATAAATCTTGATTTTAATTGTT
AACTAGATTTTGAAAACATTTGATATACTACTGATTAATGATAGCTGTTG
CAGGGAAATGTGATGCATGTAGATTTATGTACTTTATCTAGCACAATAAT
TATCGTTTTGTTTTTCCATTGTTTTAGGTTTTATCCTCTTTCCATTCATT
ACGCTAGTGATCCGCAATCAGAAGAACATTAAACTCCCATGCGACCAAGT
GAATAATGCTCTCCAGATTCGT
back to top

protein sequence of SMED30025299-orf-1

>SMED30025299-orf-1 ID=SMED30025299-orf-1|Name=SMED30025299-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=737bp
MSRSKMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQ
QKQHADILSQNTNDHESYDDRISVFSEADSGVVVGSKTGSSVGGASGGIV
IHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHF
LTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCH
PQRGPLAKHNLHEASTGTEILKHKKQQKKTRCRLHSQEELSIYCVTCRTV
VCCVCMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNL
KSLSEKINRNFPKKEEEIISSIDGIIRCLEQKKLELISQLKVEKERKNVK
FKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQ
AFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSV
SMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGS
FRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVL
WFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVD
KIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFER
TDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKGSLYPAVSFN
KFVQLTLVLGREAPSESEESEEDDENLGTKPSSGQK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR043136B30.2/SPRY_sf
IPR036116FN3_sf
IPR000421FA58C
IPR003877SPRY_dom
IPR003649Bbox_C
IPR000315Znf_B-box
IPR003961FN3_dom
IPR013083Znf_RING/FYVE/PHD
IPR013783Ig-like_fold
IPR001870B30.2/SPRY
IPR013320ConA-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0016874ligase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 326..346
NoneNo IPR availableGENE3DG3DSA:3.30.40.200coord: 214..293
e-value: 8.6E-11
score: 43.4
NoneNo IPR availableGENE3DG3DSA:3.30.40.90coord: 144..213
e-value: 1.2E-12
score: 49.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 712..736
NoneNo IPR availablePANTHERPTHR24099:SF15E3 UBIQUITIN-PROTEIN LIGASE TRIM9coord: 6..723
NoneNo IPR availablePANTHERPTHR24099FAMILY NOT NAMEDcoord: 6..723
NoneNo IPR availableCDDcd12889SPRY_PRY_TRIM67_9coord: 543..714
e-value: 8.92386E-92
score: 281.822
NoneNo IPR availableSUPERFAMILYSSF57845B-box zinc-binding domaincoord: 224..286
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 5..42
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 457..536
e-value: 0.0089
score: 25.2
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 456..549
score: 12.245
IPR003961Fibronectin type IIICDDcd00063FN3coord: 469..546
e-value: 2.37093E-7
score: 47.1059
IPR003877SPRY domainSMARTSM00449SPRY_3coord: 590..713
e-value: 1.6E-14
score: 64.3
IPR003877SPRY domainPFAMPF00622SPRYcoord: 593..710
e-value: 2.1E-13
score: 50.4
IPR003649B-box, C-terminalSMARTSM00502RAD_5coord: 275..401
e-value: 1.5E-11
score: 54.4
IPR000315B-box-type zinc fingerSMARTSM00336bboxneu5coord: 227..268
e-value: 0.0063
score: 25.7
coord: 164..214
e-value: 0.071
score: 19.3
IPR000315B-box-type zinc fingerPFAMPF00643zf-B_boxcoord: 228..267
e-value: 7.9E-7
score: 29.1
IPR000315B-box-type zinc fingerPROSITEPS50119ZF_BBOXcoord: 227..268
score: 11.647
IPR000315B-box-type zinc fingerPROSITEPS50119ZF_BBOXcoord: 171..214
score: 8.589
IPR000315B-box-type zinc fingerCDDcd00021BBOXcoord: 230..263
e-value: 4.81675E-5
score: 39.1928
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 1..57
e-value: 4.4E-7
score: 31.3
IPR043136B30.2/SPRY domain superfamilyGENE3DG3DSA:2.60.120.920coord: 556..707
e-value: 1.4E-27
score: 98.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 449..549
e-value: 2.7E-15
score: 58.5
IPR001870B30.2/SPRY domainPROSITEPS50188B302_SPRYcoord: 531..714
score: 19.032
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 456..546
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 518..711