rRNA 2'-O-methyltransferase fibrillarin

Overview
NamerRNA 2'-O-methyltransferase fibrillarin
Smed IDSMED30025294
Length (bp)1043
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of rRNA 2'-O-methyltransferase fibrillarin (SMED30025294) t-SNE clustered cells

Violin plots show distribution of expression levels for rRNA 2'-O-methyltransferase fibrillarin (SMED30025294) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of rRNA 2'-O-methyltransferase fibrillarin (SMED30025294) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for rRNA 2'-O-methyltransferase fibrillarin (SMED30025294) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025294

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025294SMESG000051648.1 SmedASXL_007921SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025294SMESG000051648.1 SmedASXL_007921SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30025294SMESG000051648.1 dd_Smed_v4_2811_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025294SMESG000051648.1 dd_Smed_v4_2811_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025294SMESG000051648.1 dd_Smed_v4_2811_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025294SMESG000051648.1 dd_Smed_v4_2811_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025294SMESG000051648.1 dd_Smed_v4_2811_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025294SMESG000051648.1 dd_Smed_v4_2811_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30025294SMESG000051648.1 dd_Smed_v4_2811_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30025294SMESG000051648.1 dd_Smed_v4_2811_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025294SMESG000051648.1 Contig35288newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025294SMESG000051648.1 Contig35288uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025294SMESG000051648.1 Contig21851uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025294SMESG000051648.1 Contig21851newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025294SMESG000051648.1 Contig22874newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025294SMESG000051648.1 Contig22874uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
oocyteSMED30025294SMESG000051648.1 Contig26040newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30025294SMESG000051648.1 Contig26040uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30025294SMESG000051648.1 Contig26040newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30025294SMESG000051648.1 Contig26040uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
zeta neoblastSMED30025294SMESG000051648.1 dd_Smed_v4_2811_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Human
Match: FBL (fibrillarin [Source:HGNC Symbol;Acc:HGNC:3599])

HSP 1 Score: 319.701 bits (818), Expect = 2.761e-109
Identity = 146/223 (65.47%), Postives = 183/223 (82.06%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQY 970
            HRH GVF  +GK++ L+TKN VPG SVYGEKR++I  GDDK+EYR WNPFRSKLAA+IL G+D IH+  G+KVLYLGA++GT+VSHVSDIVGP G+VYAVEF+ R GR+++N+AKKRTNI+P++EDARHP+KYRM+I  VD IFADVAQPDQ+RIVA+NA  FL+ GG+ VIS+KA+CIDSTA  E  F SE   + +   KP+  L++EPYERDH V+V  Y
Sbjct:    6 HRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVY 228          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Human
Match: FBL (fibrillarin [Source:HGNC Symbol;Acc:HGNC:3599])

HSP 1 Score: 319.701 bits (818), Expect = 2.761e-109
Identity = 146/223 (65.47%), Postives = 183/223 (82.06%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQY 970
            HRH GVF  +GK++ L+TKN VPG SVYGEKR++I  GDDK+EYR WNPFRSKLAA+IL G+D IH+  G+KVLYLGA++GT+VSHVSDIVGP G+VYAVEF+ R GR+++N+AKKRTNI+P++EDARHP+KYRM+I  VD IFADVAQPDQ+RIVA+NA  FL+ GG+ VIS+KA+CIDSTA  E  F SE   + +   KP+  L++EPYERDH V+V  Y
Sbjct:    6 HRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVY 228          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Human
Match: FBL (fibrillarin [Source:HGNC Symbol;Acc:HGNC:3599])

HSP 1 Score: 320.472 bits (820), Expect = 3.211e-108
Identity = 147/225 (65.33%), Postives = 184/225 (81.78%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            HRH GVF  +GK++ L+TKN VPG SVYGEKR++I  GDDK+EYR WNPFRSKLAA+IL G+D IH+  G+KVLYLGA++GT+VSHVSDIVGP G+VYAVEF+ R GR+++N+AKKRTNI+P++EDARHP+KYRM+I  VD IFADVAQPDQ+RIVA+NA  FL+ GG+ VIS+KA+CIDSTA  E  F SE   + +   KP+  L++EPYERDH V+V  Y P
Sbjct:   91 HRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRP 315          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Human
Match: FBL (fibrillarin [Source:HGNC Symbol;Acc:HGNC:3599])

HSP 1 Score: 320.472 bits (820), Expect = 3.211e-108
Identity = 147/225 (65.33%), Postives = 184/225 (81.78%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            HRH GVF  +GK++ L+TKN VPG SVYGEKR++I  GDDK+EYR WNPFRSKLAA+IL G+D IH+  G+KVLYLGA++GT+VSHVSDIVGP G+VYAVEF+ R GR+++N+AKKRTNI+P++EDARHP+KYRM+I  VD IFADVAQPDQ+RIVA+NA  FL+ GG+ VIS+KA+CIDSTA  E  F SE   + +   KP+  L++EPYERDH V+V  Y P
Sbjct:   91 HRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRP 315          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Human
Match: FBL (fibrillarin [Source:HGNC Symbol;Acc:HGNC:3599])

HSP 1 Score: 315.079 bits (806), Expect = 3.378e-107
Identity = 143/216 (66.20%), Postives = 179/216 (82.87%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDH 949
            HRH GVF  +GK++ L+TKN VPG SVYGEKR++I  GDDK+EYR WNPFRSKLAA+IL G+D IH+  G+KVLYLGA++GT+VSHVSDIVGP G+VYAVEF+ R GR+++N+AKKRTNI+P++EDARHP+KYRM+I  VD IFADVAQPDQ+RIVA+NA  FL+ GG+ VIS+KA+CIDSTA  E  F SE   + +   KP+  L++EPYERDH
Sbjct:   29 HRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDH 244          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Celegans
Match: fib-1 (rRNA 2'-O-methyltransferase fibrillarin [Source:UniProtKB/Swiss-Prot;Acc:Q22053])

HSP 1 Score: 305.064 bits (780), Expect = 3.629e-102
Identity = 141/225 (62.67%), Postives = 181/225 (80.44%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            HR  GVF V+GK++ L TKN V G SVYGEKR+++  G   +EYR WNPFRSKLAASI+ G+++ H+  G+K+LYLGA++GT+VSH SD+VGP G+VYAVEF+ R GR++L VAKKR N+VPIVEDARHP+KYRM++  VD IF+DVAQPDQ+RIVA+NA  FL+ GG+AVIS+KA+CIDSTAEPE  F  E + + + KFKP   +++EPYERDH V+VA Y P
Sbjct:  122 HRLGGVFIVKGKEDALATKNMVVGESVYGEKRVSVDDGAGSIEYRVWNPFRSKLAASIMGGLENTHIKPGTKLLYLGAASGTTVSHCSDVVGPEGIVYAVEFSHRSGRDLLGVAKKRPNVVPIVEDARHPHKYRMLVGMVDVIFSDVAQPDQARIVALNAQNFLRNGGHAVISIKANCIDSTAEPEAVFAGEVNKLKEEKFKPLEQVTLEPYERDHAVVVAVYRP 346          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Celegans
Match: fib-1 (rRNA 2'-O-methyltransferase fibrillarin [Source:UniProtKB/Swiss-Prot;Acc:Q22053])

HSP 1 Score: 305.064 bits (780), Expect = 3.629e-102
Identity = 141/225 (62.67%), Postives = 181/225 (80.44%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            HR  GVF V+GK++ L TKN V G SVYGEKR+++  G   +EYR WNPFRSKLAASI+ G+++ H+  G+K+LYLGA++GT+VSH SD+VGP G+VYAVEF+ R GR++L VAKKR N+VPIVEDARHP+KYRM++  VD IF+DVAQPDQ+RIVA+NA  FL+ GG+AVIS+KA+CIDSTAEPE  F  E + + + KFKP   +++EPYERDH V+VA Y P
Sbjct:  122 HRLGGVFIVKGKEDALATKNMVVGESVYGEKRVSVDDGAGSIEYRVWNPFRSKLAASIMGGLENTHIKPGTKLLYLGAASGTTVSHCSDVVGPEGIVYAVEFSHRSGRDLLGVAKKRPNVVPIVEDARHPHKYRMLVGMVDVIFSDVAQPDQARIVALNAQNFLRNGGHAVISIKANCIDSTAEPEAVFAGEVNKLKEEKFKPLEQVTLEPYERDHAVVVAVYRP 346          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Fly
Match: Fib (gene:FBgn0003062 transcript:FBtr0071982)

HSP 1 Score: 325.865 bits (834), Expect = 2.104e-110
Identity = 149/228 (65.35%), Postives = 186/228 (81.58%), Query Frame = 2
Query:  293 IVEHRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            I  HRH GVF  +GK++ L+T+NFVPG  VYGEKRI++    +K+EYR WNPFRSKLAA++L G++ IHMP GSKVLYLGA++GT+VSHVSD+VGP G+VYAVEF+ R GR+++NVAKKRTNI+PI+EDARHP+KYRM++  VDTIFADVAQPDQ RIVA+NA  FLK GG+ VIS+KASCIDSTA+PE  F +E   +   K KP+  L++EPYERDH V+V  Y P
Sbjct:  113 IEPHRHEGVFIARGKEDALVTRNFVPGSEVYGEKRISVETNGEKIEYRVWNPFRSKLAAAVLGGVEQIHMPPGSKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPIIEDARHPHKYRMLVGMVDTIFADVAQPDQGRIVALNAQHFLKNGGHFVISIKASCIDSTAQPEAVFAAEVKKMQADKLKPQEQLTLEPYERDHAVVVGVYRP 340          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Fly
Match: CG10909 (gene:FBgn0038090 transcript:FBtr0082685)

HSP 1 Score: 181.8 bits (460), Expect = 3.938e-54
Identity = 95/231 (41.13%), Postives = 145/231 (62.77%), Query Frame = 2
Query:  290 QIVEHRHPGVFYVQGKDET--LLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQ-VDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYL 973
            +I  HRH GV+ ++ + +   LLT+N       YGE+R+     + + E+R W+PF+SKLAA I+ G+ D+H+ IGSKVLYLGA  G SVSH+SDIVG +G+VYAVE     GR++  +A +R+NIVPIVEDA  PYKYR  +   +D IFAD+      R + +NA  FL PGG+ V  L +         +++F +E+ ++ + + +PK  + +EP++  +  +V  Y+
Sbjct:  113 RIEPHRHYGVYLLRNRFDAIQLLTRNTSSSADDYGERRVISEYREMRCEFRVWSPFQSKLAAGIMGGVSDLHLQIGSKVLYLGAGFGRSVSHISDIVGDSGMVYAVEQIPWAGRQLTIMANRRSNIVPIVEDATMPYKYRYEVPACIDIIFADLPPSVLIRALMLNARHFLNPGGHFVAYLHSPTSQGVVFNKDSFAAERRLLKEKQLEPKEMVLLEPFKAGYAFVVGVYI 343          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Zebrafish
Match: fbl (fibrillarin [Source:ZFIN;Acc:ZDB-GENE-040426-1936])

HSP 1 Score: 315.464 bits (807), Expect = 1.812e-106
Identity = 149/225 (66.22%), Postives = 181/225 (80.44%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            HRH GVF  +GK++ L+TKN V G SVYGEKRI +  G+ K+EYR WNPFRSKLAA+IL GID IH+  G KV+YLGA++GT+VSHVSDIVGP G+VYAVEF+ R GR++LNVAKKRTNI+PI+EDARHP+KYRM++  VD IFADVAQPDQ+RIVA+NA  FLK GG+ VIS+KA+CIDSTA PE  F SE   +S    KP+  L++EPYERDH V+V  Y P
Sbjct:   87 HRHEGVFICRGKEDALVTKNMVIGESVYGEKRINVEEGETKIEYRAWNPFRSKLAAAILGGIDQIHIKPGVKVMYLGAASGTTVSHVSDIVGPEGLVYAVEFSHRSGRDLLNVAKKRTNIIPIIEDARHPHKYRMLVGMVDVIFADVAQPDQTRIVALNAHNFLKNGGHFVISIKANCIDSTAAPEAVFASEVKKMSAENMKPQEQLTLEPYERDHAVVVGIYRP 311          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Xenopus
Match: slc38a11 (solute carrier family 38 member 11 [Source:Xenbase;Acc:XB-GENE-6045807])

HSP 1 Score: 314.694 bits (805), Expect = 7.212e-106
Identity = 146/231 (63.20%), Postives = 187/231 (80.95%), Query Frame = 2
Query:  287 KQIVE-HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            K IVE HRH G+F  +GK++ L+TKN VPG SVYGEKRI++  G+ K EYR WNPFRSK+AA+IL G+D IH+  G+KVLYLGA++GT+VSHVSD+VGP G+VYAVEF+ R GR+++NVAKKRTNI+P++EDARHP+KYRM++  VD +FADVAQPDQ+RIVA+NA  FLK GG+ VIS+KA+CIDSTA PE  F +E   + +   KP+  L++EPYERDH V+V  Y P
Sbjct:   89 KVIVEPHRHEGIFICRGKEDALVTKNLVPGESVYGEKRISVEDGEVKTEYRAWNPFRSKIAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPVIEDARHPHKYRMLVGMVDVVFADVAQPDQTRIVALNAHNFLKNGGHFVISIKANCIDSTAAPEAVFAAEVKKMQQENMKPQEQLTLEPYERDHAVVVGIYRP 319          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Xenopus
Match: slc38a11 (solute carrier family 38 member 11 [Source:Xenbase;Acc:XB-GENE-6045807])

HSP 1 Score: 314.309 bits (804), Expect = 7.783e-106
Identity = 146/231 (63.20%), Postives = 187/231 (80.95%), Query Frame = 2
Query:  287 KQIVE-HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            K IVE HRH G+F  +GK++ L+TKN VPG SVYGEKRI++  G+ K EYR WNPFRSK+AA+IL G+D IH+  G+KVLYLGA++GT+VSHVSD+VGP G+VYAVEF+ R GR+++NVAKKRTNI+P++EDARHP+KYRM++  VD +FADVAQPDQ+RIVA+NA  FLK GG+ VIS+KA+CIDSTA PE  F +E   + +   KP+  L++EPYERDH V+V  Y P
Sbjct:   89 KVIVEPHRHEGIFICRGKEDALVTKNLVPGESVYGEKRISVEDGEVKTEYRAWNPFRSKIAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPVIEDARHPHKYRMLVGMVDVVFADVAQPDQTRIVALNAHNFLKNGGHFVISIKANCIDSTAAPEAVFAAEVKKMQQENMKPQEQLTLEPYERDHAVVVGIYRP 319          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Xenopus
Match: slc38a11 (solute carrier family 38 member 11 [Source:Xenbase;Acc:XB-GENE-6045807])

HSP 1 Score: 310.457 bits (794), Expect = 2.402e-104
Identity = 144/231 (62.34%), Postives = 185/231 (80.09%), Query Frame = 2
Query:  287 KQIVE-HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            K IVE HRH G+F  +GK++ L+TKN VPG SVYGEKRI++  G+ K EYR WNPFRSK+AA+IL G+D IH+  G+KVLYLGA++GT+VSHVSD+VGP G+VYAVEF+ R GR+++NVAKKRTNI+P++EDARHP+KYRM++  VD +  DVAQPDQ+RIVA+NA  FLK GG+ VIS+KA+CIDSTA PE  F +E   + +   KP+  L++EPYERDH V+V  Y P
Sbjct:   89 KVIVEPHRHEGIFICRGKEDALVTKNLVPGESVYGEKRISVEDGEVKTEYRAWNPFRSKIAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPVIEDARHPHKYRMLVGMVDVVLRDVAQPDQTRIVALNAHTFLKNGGHFVISIKANCIDSTAAPEAVFAAEVKKMQQENMKPQEQLTLEPYERDHAVVVGIYRP 319          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Xenopus
Match: slc38a11 (solute carrier family 38 member 11 [Source:Xenbase;Acc:XB-GENE-6045807])

HSP 1 Score: 305.449 bits (781), Expect = 1.201e-102
Identity = 139/221 (62.90%), Postives = 180/221 (81.45%), Query Frame = 2
Query:  314 GVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            G+F  +GK++ L+TKN VPG SVYGEKRI++  G+ K EYR WNPFRSK+AA+IL G+D IH+  G+KVLYLGA++GT+VSHVSD+VGP G+VYAVEF+ R GR+++NVAKKRTNI+P++EDARHP+KYRM++  VD +FADVAQPDQ+RIVA+NA  FLK GG+ VIS+KA+CIDSTA PE  F +E   + +   KP+  L++EPYERDH V+V  Y P
Sbjct:   80 GIFICRGKEDALVTKNLVPGESVYGEKRISVEDGEVKTEYRAWNPFRSKIAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPVIEDARHPHKYRMLVGMVDVVFADVAQPDQTRIVALNAHNFLKNGGHFVISIKANCIDSTAAPEAVFAAEVKKMQQENMKPQEQLTLEPYERDHAVVVGIYRP 300          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Mouse
Match: Fbl (fibrillarin [Source:MGI Symbol;Acc:MGI:95486])

HSP 1 Score: 320.472 bits (820), Expect = 2.310e-108
Identity = 147/225 (65.33%), Postives = 184/225 (81.78%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            HRH GVF  +GK++ L+TKN VPG SVYGEKR++I  GDDK+EYR WNPFRSKLAA+IL G+D IH+  G+KVLYLGA++GT+VSHVSDIVGP G+VYAVEF+ R GR+++N+AKKRTNI+P++EDARHP+KYRM+I  VD IFADVAQPDQ+RIVA+NA  FL+ GG+ VIS+KA+CIDSTA  E  F SE   + +   KP+  L++EPYERDH V+V  Y P
Sbjct:   97 HRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRP 321          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Mouse
Match: Fbll1 (fibrillarin-like 1 [Source:MGI Symbol;Acc:MGI:3034689])

HSP 1 Score: 306.99 bits (785), Expect = 3.947e-103
Identity = 143/225 (63.56%), Postives = 178/225 (79.11%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            HRH GVF  +G ++ L+T N VPGVSVYGEKR+ +    +K EYRTWNPFRSKLAA+IL G+D IH+   SKVLYLGA++GT+VSHVSDI+GP G+VYAVEF+ R GR+++NVAKKRTNI+P++EDARHP KYRM+I  VD IFADVAQPDQSRIVA+NA  FL+ GG+ +IS+KA+CIDSTA  E  F SE   + +   KP+  L++EPYERDH V+V  Y P
Sbjct:   85 HRHEGVFIYRGAEDALVTLNMVPGVSVYGEKRVTVMENGEKQEYRTWNPFRSKLAAAILGGVDQIHIKPKSKVLYLGAASGTTVSHVSDIIGPDGLVYAVEFSHRAGRDLVNVAKKRTNIIPVLEDARHPLKYRMLIGMVDVIFADVAQPDQSRIVALNAHTFLRNGGHFLISIKANCIDSTASAEAVFASEVRKLQQENLKPQEQLTLEPYERDHAVVVGVYRP 309          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Mouse
Match: Fbl (fibrillarin [Source:MGI Symbol;Acc:MGI:95486])

HSP 1 Score: 60.077 bits (144), Expect = 3.259e-11
Identity = 26/40 (65.00%), Postives = 33/40 (82.50%), Query Frame = 2
Query:  317 VFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYR 436
            VF  +GK++ L+TKN VPG SVYGEKR++I  GDDK+EYR
Sbjct:   46 VFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYR 85          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. UniProt/SwissProt
Match: sp|Q8I1F4|FBRL_DROER (rRNA 2'-O-methyltransferase fibrillarin OS=Drosophila erecta OX=7220 GN=Fib PE=3 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 1.473e-109
Identity = 150/228 (65.79%), Postives = 186/228 (81.58%), Query Frame = 2
Query:  293 IVEHRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            I  HRH GVF  +GK++ L+T+NFVPG  VYGEKRI++    +K+EYR WNPFRSKLAA++L G++ IHMP GSKVLYLGA++GT+VSHVSD+VGP G+VYAVEF+ R GR+++NVAKKRTNI+PI+EDARHP+KYRM++  VDTIFADVAQPDQ RIVA+NA  FLK GG+ VIS+KASCIDSTA+PE  F SE   +   K KP+  L++EPYERDH V+V  Y P
Sbjct:  114 IEPHRHEGVFIARGKEDALVTRNFVPGSEVYGEKRISVENNGEKIEYRVWNPFRSKLAAAVLGGVEQIHMPPGSKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPIIEDARHPHKYRMLVGMVDTIFADVAQPDQGRIVALNAQHFLKNGGHFVISIKASCIDSTAQPEAVFASEVKKMQADKLKPQEQLTLEPYERDHAVVVGVYRP 341          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. UniProt/SwissProt
Match: sp|Q9W1V3|FBRL_DROME (rRNA 2'-O-methyltransferase fibrillarin OS=Drosophila melanogaster OX=7227 GN=Fib PE=2 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 2.109e-109
Identity = 149/228 (65.35%), Postives = 186/228 (81.58%), Query Frame = 2
Query:  293 IVEHRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            I  HRH GVF  +GK++ L+T+NFVPG  VYGEKRI++    +K+EYR WNPFRSKLAA++L G++ IHMP GSKVLYLGA++GT+VSHVSD+VGP G+VYAVEF+ R GR+++NVAKKRTNI+PI+EDARHP+KYRM++  VDTIFADVAQPDQ RIVA+NA  FLK GG+ VIS+KASCIDSTA+PE  F +E   +   K KP+  L++EPYERDH V+V  Y P
Sbjct:  113 IEPHRHEGVFIARGKEDALVTRNFVPGSEVYGEKRISVETNGEKIEYRVWNPFRSKLAAAVLGGVEQIHMPPGSKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPIIEDARHPHKYRMLVGMVDTIFADVAQPDQGRIVALNAQHFLKNGGHFVISIKASCIDSTAQPEAVFAAEVKKMQADKLKPQEQLTLEPYERDHAVVVGVYRP 340          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. UniProt/SwissProt
Match: sp|P22087|FBRL_HUMAN (rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2)

HSP 1 Score: 320.472 bits (820), Expect = 1.542e-107
Identity = 147/225 (65.33%), Postives = 184/225 (81.78%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            HRH GVF  +GK++ L+TKN VPG SVYGEKR++I  GDDK+EYR WNPFRSKLAA+IL G+D IH+  G+KVLYLGA++GT+VSHVSDIVGP G+VYAVEF+ R GR+++N+AKKRTNI+P++EDARHP+KYRM+I  VD IFADVAQPDQ+RIVA+NA  FL+ GG+ VIS+KA+CIDSTA  E  F SE   + +   KP+  L++EPYERDH V+V  Y P
Sbjct:   91 HRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRP 315          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. UniProt/SwissProt
Match: sp|P35550|FBRL_MOUSE (rRNA 2'-O-methyltransferase fibrillarin OS=Mus musculus OX=10090 GN=Fbl PE=1 SV=2)

HSP 1 Score: 320.472 bits (820), Expect = 1.616e-107
Identity = 147/225 (65.33%), Postives = 184/225 (81.78%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            HRH GVF  +GK++ L+TKN VPG SVYGEKR++I  GDDK+EYR WNPFRSKLAA+IL G+D IH+  G+KVLYLGA++GT+VSHVSDIVGP G+VYAVEF+ R GR+++N+AKKRTNI+P++EDARHP+KYRM+I  VD IFADVAQPDQ+RIVA+NA  FL+ GG+ VIS+KA+CIDSTA  E  F SE   + +   KP+  L++EPYERDH V+V  Y P
Sbjct:   97 HRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRP 321          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. UniProt/SwissProt
Match: sp|P22509|FBRL_RAT (rRNA 2'-O-methyltransferase fibrillarin OS=Rattus norvegicus OX=10116 GN=Fbl PE=1 SV=2)

HSP 1 Score: 320.087 bits (819), Expect = 2.265e-107
Identity = 147/225 (65.33%), Postives = 184/225 (81.78%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            HRH GVF  +GK++ L+TKN VPG SVYGEKR++I  GDDK+EYR WNPFRSKLAA+IL G+D IH+  G+KVLYLGA++GT+VSHVSDIVGP G+VYAVEF+ R GR+++N+AKKRTNI+P++EDARHP+KYRM+I  VD IFADVAQPDQ+RIVA+NA  FL+ GG+ VIS+KA+CIDSTA  E  F SE   + +   KP+  L++EPYERDH V+V  Y P
Sbjct:   97 HRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRP 321          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. TrEMBL
Match: A0A482XC31 (Uncharacterized protein OS=Laodelphax striatellus OX=195883 GN=LSTR_LSTR001206 PE=3 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 3.025e-110
Identity = 150/225 (66.67%), Postives = 187/225 (83.11%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            HRHPGVF  +GK++ L+T N VPG +VYGEKRI++  G++K+EYR WNPFRSKLAA+IL G+D IHMP GSKVLYLGA++GT+VSHVSDIVGP G+VYAVEF+ R GR+MLNVAKKRTNI+PI+EDARHP+KYRM++  VDT+FADVAQPDQ+RIVA+NA  +LK GG+ VIS+KA+CIDSTA+PE  F  E   +   + KP+  L++EPYERDH V+V  Y P
Sbjct:   12 HRHPGVFIARGKEDALVTLNMVPGEAVYGEKRISVEEGENKIEYRVWNPFRSKLAAAILGGVDQIHMPPGSKVLYLGAASGTTVSHVSDIVGPEGLVYAVEFSHRSGRDMLNVAKKRTNIIPIIEDARHPHKYRMLMGMVDTVFADVAQPDQARIVAINAQHYLKNGGHFVISIKANCIDSTAQPEAVFAGEVKKLQAERLKPQEQLTLEPYERDHAVVVGVYRP 236          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. TrEMBL
Match: A0A226ERX4 (rRNA 2'-O-methyltransferase fibrillarin OS=Folsomia candida OX=158441 GN=Fcan01_05380 PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 1.842e-108
Identity = 153/230 (66.52%), Postives = 190/230 (82.61%), Query Frame = 2
Query:  293 IVEHRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDD--KVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            I  HRHPGVF  +GK++ L+T+N VPG S+YGEKRI++  GDD  K+EYR WNPFRSKLAA+IL G+D IHMP GSKVLYLGA++GT+VSHVSD+VGP G+VYAVEF+ R GR++LNVAKKRTNI+PI+EDARHP+KYRM++  VD +FADVAQPDQ+RIVA+N+ +FLK GG+ VIS+KA+CIDSTAEPE  F  E   +   KFKP+  L++EPYERDH V+V  Y P
Sbjct:   82 IEPHRHPGVFIARGKEDALVTRNMVPGESIYGEKRISVD-GDDGTKIEYRVWNPFRSKLAAAILGGVDQIHMPPGSKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLLNVAKKRTNIIPIIEDARHPHKYRMLVGMVDCVFADVAQPDQARIVALNSQYFLKNGGHFVISIKANCIDSTAEPEAVFAGEVKKLQSEKFKPQEQLTLEPYERDHAVVVGVYRP 310          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. TrEMBL
Match: A0A1L8E7P7 (Putative fibrillarin (Fragment) OS=Haematobia irritans OX=7368 PE=3 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 2.152e-108
Identity = 148/225 (65.78%), Postives = 185/225 (82.22%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            HRH G+F  +GK++ L+T+NFVPG  VYGEKRI++    +KVEYR WNPFRSKLAA++L G+D IHMP GSKVLYLGA++GT+VSHVSD+VGP G+VYAVEF+ R GR+++NVAKKRTNI+PI+EDARHP+KYRM++  VDTIFADVAQPDQ RIVA+NA  FLK GG+ VIS+KASCIDSTA+PE  F +E   +   K KP+  +++EPYERDH V+V  Y P
Sbjct:   28 HRHEGIFIARGKEDALVTRNFVPGSEVYGEKRISVETNGEKVEYRVWNPFRSKLAAAVLGGVDKIHMPPGSKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPIIEDARHPHKYRMLVGMVDTIFADVAQPDQGRIVALNAQHFLKNGGHFVISIKASCIDSTAQPEAVFAAEVKKMQADKLKPQEQITLEPYERDHAVVVGVYRP 252          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. TrEMBL
Match: A0A1L8E7R8 (Putative fibrillarin (Fragment) OS=Haematobia irritans OX=7368 PE=3 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 2.227e-108
Identity = 148/225 (65.78%), Postives = 185/225 (82.22%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            HRH G+F  +GK++ L+T+NFVPG  VYGEKRI++    +KVEYR WNPFRSKLAA++L G+D IHMP GSKVLYLGA++GT+VSHVSD+VGP G+VYAVEF+ R GR+++NVAKKRTNI+PI+EDARHP+KYRM++  VDTIFADVAQPDQ RIVA+NA  FLK GG+ VIS+KASCIDSTA+PE  F +E   +   K KP+  +++EPYERDH V+V  Y P
Sbjct:   29 HRHEGIFIARGKEDALVTRNFVPGSEVYGEKRISVETNGEKVEYRVWNPFRSKLAAAVLGGVDKIHMPPGSKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPIIEDARHPHKYRMLVGMVDTIFADVAQPDQGRIVALNAQHFLKNGGHFVISIKASCIDSTAQPEAVFAAEVKKMQADKLKPQEQITLEPYERDHAVVVGVYRP 253          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. TrEMBL
Match: A0A1L8E7L2 (Putative fibrillarin (Fragment) OS=Haematobia irritans OX=7368 PE=3 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 2.772e-108
Identity = 148/225 (65.78%), Postives = 185/225 (82.22%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            HRH G+F  +GK++ L+T+NFVPG  VYGEKRI++    +KVEYR WNPFRSKLAA++L G+D IHMP GSKVLYLGA++GT+VSHVSD+VGP G+VYAVEF+ R GR+++NVAKKRTNI+PI+EDARHP+KYRM++  VDTIFADVAQPDQ RIVA+NA  FLK GG+ VIS+KASCIDSTA+PE  F +E   +   K KP+  +++EPYERDH V+V  Y P
Sbjct:   23 HRHEGIFIARGKEDALVTRNFVPGSEVYGEKRISVETNGEKVEYRVWNPFRSKLAAAVLGGVDKIHMPPGSKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPIIEDARHPHKYRMLVGMVDTIFADVAQPDQGRIVALNAQHFLKNGGHFVISIKASCIDSTAQPEAVFAAEVKKMQADKLKPQEQITLEPYERDHAVVVGVYRP 247          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Cavefish
Match: fbl (fibrillarin [Source:ZFIN;Acc:ZDB-GENE-040426-1936])

HSP 1 Score: 310.457 bits (794), Expect = 5.205e-104
Identity = 144/219 (65.75%), Postives = 179/219 (81.74%), Query Frame = 2
Query:  314 GVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQY 970
            GVF  +GK++ L+TKN V G SVYGEKRI++  G+ K+EYR WNPFRSKLAA+IL G+D IH+  G+KV+YLGA++GT+VSHVSDIVGP G+VYAVEF+ R GR++LNVAKKRTNI+PI+EDARHP+KYRM++  VD IFADVAQPDQ+RIVA+NA  FLK GG+ VIS+KA+CIDSTA PE  F SE   +S    KP+  L++EPYERDH V+V  Y
Sbjct:   91 GVFICRGKEDALVTKNMVTGESVYGEKRISVDEGESKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVMYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLLNVAKKRTNIIPIIEDARHPHKYRMLVGMVDVIFADVAQPDQTRIVALNAHNFLKNGGHFVISIKANCIDSTAAPEAVFASEVKKMSAENMKPQEQLTLEPYERDHAVVVGIY 309          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Sea Lamprey
Match: fbl (fibrillarin [Source:ZFIN;Acc:ZDB-GENE-040426-1936])

HSP 1 Score: 285.804 bits (730), Expect = 1.870e-95
Identity = 137/225 (60.89%), Postives = 172/225 (76.44%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            HRH GVF  +GK++ L+T+N VPG SVYGEKR+A+   + KVEYR WNPFRSKLAA+IL G+D IH+  G KVLYLGA++GT+VSHVSDIVGP G+VYAVEF+ R GR+++NVAKKRTNI+PI +    P     M   VD +FADVAQPDQ+RIVA+NA  FLK GG+ VIS+KA+CIDSTA+PE  F  E   +++   KP+  L++EPYERDH V+V  Y P
Sbjct:  101 HRHEGVFIARGKEDALVTRNMVPGESVYGEKRMAVEEQEQKVEYRAWNPFRSKLAAAILGGVDQIHIKPGVKVLYLGAASGTTVSHVSDIVGPEGLVYAVEFSHRSGRDLMNVAKKRTNIIPIYKLECSPISLAGM---VDVVFADVAQPDQTRIVAINAHNFLKNGGHFVISIKANCIDSTAQPEAVFAQEVKKMAQENMKPQEQLTLEPYERDHAVVVGTYRP 322          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Yeast
Match: NOP1 (Histone glutamine methyltransferase, modifies H2A at Q105 in nucleolus; component of the small subunit processome complex, which is required for processing of pre-18S rRNA; ortholog of mammalian fibrillarin; inviability of the null mutant is functionally complemented by human FBL [Source:SGD;Acc:S000002172])

HSP 1 Score: 288.5 bits (737), Expect = 9.507e-97
Identity = 135/231 (58.44%), Postives = 176/231 (76.19%), Query Frame = 2
Query:  302 HRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAI-------GMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYL 973
            HRH GV+  +GK++ L+TKN  PG SVYGEKRI++       G+   KVEYR WNPFRSKLAA I+ G+D++ +  G KVLYLGA++GTSVSHVSD+VGP GVVYAVEF+ R GRE++++AKKR NI+PI+EDARHP KYRM+I  VD +FADVAQPDQ+RI+A+N+  FLK  G  VIS+KA+CIDST + E  F  E   + + + KP   L++EPYERDH ++V +Y+
Sbjct:   91 HRHAGVYIARGKEDLLVTKNMAPGESVYGEKRISVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRPNIIPIIEDARHPQKYRMLIGMVDCVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETVFAREVQKLREERIKPLEQLTLEPYERDHCIVVGRYM 321          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Nematostella
Match: EDO39937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8G2])

HSP 1 Score: 314.309 bits (804), Expect = 7.188e-107
Identity = 149/228 (65.35%), Postives = 186/228 (81.58%), Query Frame = 2
Query:  293 IVEHRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAI-GMGD-DKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQY 970
            I  HRH GVF  +GK++ L+TKN VPG +VYGEK+I++ G+ + +K+EYR WNPFRSKLAA+IL G+D IHMP GSKVLYLGA++GT+VSHVSDIVGP G+VYAVEF+ R GR+++NVAKKRTNIVPI+EDARHP+KYRM++  VD IFADVAQPDQ+RIVA+NA  FLK GG+ VIS+KA+CIDSTA+P   F  E   +   K KP+  L++EPYERDH V+V  Y
Sbjct:   64 IEPHRHEGVFIARGKEDALVTKNLVPGETVYGEKKISVDGVAEGEKIEYRVWNPFRSKLAAAILGGVDKIHMPPGSKVLYLGAASGTTVSHVSDIVGPEGLVYAVEFSHRSGRDLINVAKKRTNIVPIIEDARHPHKYRMLVGMVDCIFADVAQPDQTRIVAINAHNFLKNGGHFVISIKANCIDSTAQPAAVFAGEVKKMVGEKMKPQEQLTLEPYERDHAVVVGTY 291          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Medaka
Match: fbl (fibrillarin [Source:NCBI gene;Acc:101169139])

HSP 1 Score: 317.775 bits (813), Expect = 4.259e-107
Identity = 149/228 (65.35%), Postives = 184/228 (80.70%), Query Frame = 2
Query:  293 IVEHRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            I  HRH GVF  +GK++ L+TKN V G SVYGEKR+++  GD K+EYR WNPFRSKLAA+IL G+D IH+  G+KV+YLGA++GT+VSHVSDIVGP G+VYAVEF+ R GR++LNVAKKRTNI+PI+EDARHP+KYRM++  VD IFADVAQPDQ+RIVA+NA  FLK GG+ VIS+KA+CIDSTA PE  F SE   +S    KP+  L++EPYERDH V+V  Y P
Sbjct:  115 IEPHRHEGVFICRGKEDALVTKNMVVGESVYGEKRMSVEEGDTKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVMYLGAASGTTVSHVSDIVGPEGLVYAVEFSHRSGRDLLNVAKKRTNIIPIIEDARHPHKYRMLVGMVDVIFADVAQPDQTRIVALNAHNFLKNGGHFVISIKANCIDSTAAPEAVFASEVKKMSSENMKPQEQLTLEPYERDHAVVVGIYRP 342          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Planmine SMEST
Match: SMESG000051648.1 (SMESG000051648.1)

HSP 1 Score: 481.1 bits (1237), Expect = 1.843e-172
Identity = 232/232 (100.00%), Postives = 232/232 (100.00%), Query Frame = 2
Query:  287 KQIVEHRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLPYE 982
            KQIVEHRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLPYE
Sbjct:   58 KQIVEHRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMGDDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLPYE 289          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Planmine SMEST
Match: SMESG000027841.1 (SMESG000027841.1)

HSP 1 Score: 255.373 bits (651), Expect = 3.210e-83
Identity = 120/213 (56.34%), Postives = 161/213 (75.59%), Query Frame = 2
Query:  347 LLTKNFVPGVSVYGEKRIAIGMGDD---KVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLP 976
            +LTKN   G +VYGEK++ +    +   KVEYR WNP+RSK+ A+I  GID++++  GSKVLYLGA+ GT+VSHVSD+VGP G+VYAVEF++R GR++ N++  R NI+PI+ DAR P  YR+++  VD IFADVAQPDQSRIVA+NA+ FLK GGY V+S+KA+C+DS+A PE+ +LSE D + KL  KP S L +  + R H V+  QYLP
Sbjct:   98 ILTKNLTNGETVYGEKKVQVPDETEPGKKVEYRVWNPYRSKIGAAITLGIDNVYINEGSKVLYLGAANGTTVSHVSDMVGPKGIVYAVEFSKRSGRDLENMSTNRPNIIPIIHDARVPAIYRLIVGSVDMIFADVAQPDQSRIVAMNAEMFLKKGGYVVLSIKAACVDSSANPESVYLSEIDTLKKLNIKPLSQLDLGDFSRGHAVVTGQYLP 310          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Planmine SMEST
Match: SMESG000074728.1 (SMESG000074728.1)

HSP 1 Score: 114.39 bits (285), Expect = 2.720e-30
Identity = 57/170 (33.53%), Postives = 100/170 (58.82%), Query Frame = 2
Query:  461 LAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQY 970
            +AA+IL+G DDI+  + SKVLY+GAS  +++ H+SD++GP G ++A+   + +  ++L  A +RTNI PI+ +  HP  Y + +  VDTI  D++      +++ NA  +L+  G  V+ + A  ID T   E+ +  + + +    F PKS + + PY  +  +L  +Y
Sbjct:    1 MAAAILSGADDIYFRLNSKVLYIGASNCSNLCHISDVIGPGGFLFAL--CKNMHNDILYAANQRTNIFPIIANPLHPGTYSIQMILVDTIICDISSFTTPEMISENAKRYLRDRGNLVLFVNAEKIDKTVAAESLYALQINNLKSFNFVPKSKIYLHPYFTNCAMLTFEY 168          
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Planmine SMEST
Match: SMESG000074728.1 (SMESG000074728.1)

HSP 1 Score: 114.005 bits (284), Expect = 2.898e-30
Identity = 57/170 (33.53%), Postives = 100/170 (58.82%), Query Frame = 2
Query:  461 LAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVSDIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMINQVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENAFLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQY 970
            +AA+IL+G DDI+  + SKVLY+GAS  +++ H+SD++GP G ++A+   + +  ++L  A +RTNI PI+ +  HP  Y + +  VDTI  D++      +++ NA  +L+  G  V+ + A  ID T   E+ +  + + +    F PKS + + PY  +  +L  +Y
Sbjct:    1 MAAAILSGADDIYFRLNSKVLYIGASNCSNLCHISDVIGPGGFLFAL--CKNMHNDILYAANQRTNIFPIIANPLHPGTYSIQMILVDTIICDISSFTTPEMISENAKRYLRDRGNLVLFVNAEKIDKTVAAESLYALQINNLKSFNFVPKSKIYLHPYFTNCAMLTFEY 168          
The following BLAST results are available for this feature:
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FBL2.761e-10965.47fibrillarin [Source:HGNC Symbol;Acc:HGNC:3599][more]
FBL2.761e-10965.47fibrillarin [Source:HGNC Symbol;Acc:HGNC:3599][more]
FBL3.211e-10865.33fibrillarin [Source:HGNC Symbol;Acc:HGNC:3599][more]
FBL3.211e-10865.33fibrillarin [Source:HGNC Symbol;Acc:HGNC:3599][more]
FBL3.378e-10766.20fibrillarin [Source:HGNC Symbol;Acc:HGNC:3599][more]
back to top
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fib-13.629e-10262.67rRNA 2'-O-methyltransferase fibrillarin [Source:U... [more]
fib-13.629e-10262.67rRNA 2'-O-methyltransferase fibrillarin [Source:U... [more]
back to top
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Fib2.104e-11065.35gene:FBgn0003062 transcript:FBtr0071982[more]
CG109093.938e-5441.13gene:FBgn0038090 transcript:FBtr0082685[more]
back to top
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fbl1.812e-10666.22fibrillarin [Source:ZFIN;Acc:ZDB-GENE-040426-1936][more]
back to top
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc38a117.212e-10663.20solute carrier family 38 member 11 [Source:Xenbase... [more]
slc38a117.783e-10663.20solute carrier family 38 member 11 [Source:Xenbase... [more]
slc38a112.402e-10462.34solute carrier family 38 member 11 [Source:Xenbase... [more]
slc38a111.201e-10262.90solute carrier family 38 member 11 [Source:Xenbase... [more]
back to top
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Fbl2.310e-10865.33fibrillarin [Source:MGI Symbol;Acc:MGI:95486][more]
Fbll13.947e-10363.56fibrillarin-like 1 [Source:MGI Symbol;Acc:MGI:3034... [more]
Fbl3.259e-1165.00fibrillarin [Source:MGI Symbol;Acc:MGI:95486][more]
back to top
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8I1F4|FBRL_DROER1.473e-10965.79rRNA 2'-O-methyltransferase fibrillarin OS=Drosoph... [more]
sp|Q9W1V3|FBRL_DROME2.109e-10965.35rRNA 2'-O-methyltransferase fibrillarin OS=Drosoph... [more]
sp|P22087|FBRL_HUMAN1.542e-10765.33rRNA 2'-O-methyltransferase fibrillarin OS=Homo sa... [more]
sp|P35550|FBRL_MOUSE1.616e-10765.33rRNA 2'-O-methyltransferase fibrillarin OS=Mus mus... [more]
sp|P22509|FBRL_RAT2.265e-10765.33rRNA 2'-O-methyltransferase fibrillarin OS=Rattus ... [more]
back to top
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A482XC313.025e-11066.67Uncharacterized protein OS=Laodelphax striatellus ... [more]
A0A226ERX41.842e-10866.52rRNA 2'-O-methyltransferase fibrillarin OS=Folsomi... [more]
A0A1L8E7P72.152e-10865.78Putative fibrillarin (Fragment) OS=Haematobia irri... [more]
A0A1L8E7R82.227e-10865.78Putative fibrillarin (Fragment) OS=Haematobia irri... [more]
A0A1L8E7L22.772e-10865.78Putative fibrillarin (Fragment) OS=Haematobia irri... [more]
back to top
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fbl5.205e-10465.75fibrillarin [Source:ZFIN;Acc:ZDB-GENE-040426-1936][more]
back to top
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fbl1.870e-9560.89fibrillarin [Source:ZFIN;Acc:ZDB-GENE-040426-1936][more]
back to top
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NOP19.507e-9758.44Histone glutamine methyltransferase, modifies H2A ... [more]
back to top
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO399377.188e-10765.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fbl4.259e-10765.35fibrillarin [Source:NCBI gene;Acc:101169139][more]
back to top
BLAST of rRNA 2'-O-methyltransferase fibrillarin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000051648.11.843e-172100.00SMESG000051648.1[more]
SMESG000027841.13.210e-8356.34SMESG000027841.1[more]
SMESG000074728.12.720e-3033.53SMESG000074728.1[more]
SMESG000074728.12.898e-3033.53SMESG000074728.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025294 ID=SMED30025294|Name=rRNA 2'-O-methyltransferase fibrillarin|organism=Schmidtea mediterranea sexual|type=transcript|length=1043bp
GTCTATATAAAATTAAAAAGTTAAATTTTATTTTAAAAAACATGAAGCAG
ATAAGTTTGTTTATATAATACCATTAAAATTTTTAGCGTGACTTTATTAA
TTAATTGATATTAAAATGGGATTTGGAGATTCAAGAGGTGGTAGTCGTGG
CCGTGGAGGTGGTGAAAGAGGAGGATTCAGAGGTGGAAGTCGTGGAGGGG
GAGATCGAGGAGGTTTTAGAGGTGGAAGTCGTGGAGGCGGATCATTCCGA
GGTGGTCGTGGTGGCCGAGGAGGTGCAAGAGGTGGTAAACAAATCGTCGA
ACATCGTCACCCTGGTGTTTTCTATGTTCAAGGAAAAGACGAAACTTTAC
TTACTAAAAATTTCGTACCCGGAGTGTCAGTATATGGTGAGAAACGCATA
GCCATAGGAATGGGGGATGATAAAGTTGAATACAGAACATGGAATCCTTT
CAGATCCAAGTTAGCTGCATCAATTCTCAACGGTATCGACGATATCCATA
TGCCAATCGGATCTAAAGTTCTCTATTTGGGAGCATCAACTGGAACCAGT
GTGTCTCATGTCAGTGACATTGTCGGACCCACCGGAGTCGTGTATGCAGT
TGAATTCGCTGAAAGAGTTGGTAGAGAAATGTTAAATGTTGCCAAGAAAA
GAACAAATATCGTTCCTATTGTTGAAGATGCCAGACATCCATATAAATAC
AGAATGATGATCAATCAAGTCGATACAATTTTTGCCGATGTCGCCCAGCC
AGATCAGTCGAGAATTGTCGCTGTCAATGCTGATTTCTTCTTGAAACCAG
GAGGATACGCCGTAATCTCATTGAAGGCCTCTTGTATCGATTCGACAGCA
GAACCGGAAAATGCATTTTTAAGTGAAAAAGATGTCATTTCAAAATTGAA
ATTCAAGCCGAAATCTTGGCTGTCAATGGAACCGTATGAAAGGGATCACA
AAGTTTTGGTTGCTCAGTATTTGCCATACGAATGATGATGAGACAGAGGA
ATTTGTAATTATTAATAAATATATCATTAACAGACTTCAAAAA
back to top

protein sequence of SMED30025294-orf-1

>SMED30025294-orf-1 ID=SMED30025294-orf-1|Name=SMED30025294-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=290bp
MGFGDSRGGSRGRGGGERGGFRGGSRGGGDRGGFRGGSRGGGSFRGGRGG
RGGARGGKQIVEHRHPGVFYVQGKDETLLTKNFVPGVSVYGEKRIAIGMG
DDKVEYRTWNPFRSKLAASILNGIDDIHMPIGSKVLYLGASTGTSVSHVS
DIVGPTGVVYAVEFAERVGREMLNVAKKRTNIVPIVEDARHPYKYRMMIN
QVDTIFADVAQPDQSRIVAVNADFFLKPGGYAVISLKASCIDSTAEPENA
FLSEKDVISKLKFKPKSWLSMEPYERDHKVLVAQYLPYE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000074oocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000231vitelline gland
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000692Fibrillarin
IPR029063SAM-dependent_MTases
IPR020813Fibrillarin_CS
Vocabulary: biological process
TermDefinition
GO:0006364rRNA processing
GO:0008033tRNA processing
GO:0006396RNA processing
GO:0009267cellular response to starvation
GO:0032259methylation
GO:0051297centrosome organization
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0003723RNA binding
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0001651dense fibrillar component
GO:0005634nucleus
GO:0005730nucleolus
GO:0015030Cajal body
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000692FibrillarinPRINTSPR00052FIBRILLARINcoord: 132..153
score: 75.97
coord: 264..285
score: 44.81
coord: 78..97
score: 63.21
coord: 212..241
score: 58.81
coord: 105..124
score: 71.79
coord: 182..211
score: 61.19
coord: 157..174
score: 58.73
IPR000692FibrillarinSMARTSM01206Fibrillarin_2coord: 60..287
e-value: 7.8E-141
score: 483.8
IPR000692FibrillarinPIRSFPIRSF006540Nop17pcoord: 12..288
e-value: 6.0E-105
score: 347.7
IPR000692FibrillarinPFAMPF01269Fibrillarincoord: 62..285
e-value: 9.1E-97
score: 322.6
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 56..109
e-value: 3.4E-21
score: 76.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.150coord: 110..286
e-value: 1.8E-74
score: 250.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..56
NoneNo IPR availablePANTHERPTHR10335RRNA 2-O-METHYLTRANSFERASE FIBRILLARINcoord: 7..287
NoneNo IPR availablePANTHERPTHR10335:SF4RRNA 2'-O-METHYLTRANSFERASE FIBRILLARINcoord: 7..287
NoneNo IPR availableCDDcd02440AdoMet_MTasescoord: 134..236
e-value: 2.18081E-5
score: 40.8763
IPR020813Fibrillarin, conserved sitePROSITEPS00566FIBRILLARINcoord: 157..171
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILYSSF53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 62..282