Vacuolar protein sorting-associated protein 72

Overview
NameVacuolar protein sorting-associated protein 72
Smed IDSMED30025292
Length (bp)1178
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Vacuolar protein sorting-associated protein 72 (SMED30025292) t-SNE clustered cells

Violin plots show distribution of expression levels for Vacuolar protein sorting-associated protein 72 (SMED30025292) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vacuolar protein sorting-associated protein 72 (SMED30025292) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vacuolar protein sorting-associated protein 72 (SMED30025292) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025292

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025292h1SMcG0013425 SmedASXL_006738SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Human
Match: VPS72 (vacuolar protein sorting 72 homolog [Source:HGNC Symbol;Acc:HGNC:11644])

HSP 1 Score: 139.043 bits (349), Expect = 6.617e-37
Identity = 134/336 (39.88%), Postives = 182/336 (54.17%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVKIRKVKTDSTLNDPS------TPIE--------KKSLRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRR-LTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDENG-----VDFE--------DSLTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            M LA  R  R  AGN+++ LL  EEEDEFY  TYGGF EE  D  Y  + S ++         +    DE   + E  + ++ RR++TKAY+EP K      ++ RKV T +  +  +       P+E        +KS+RQST   T +T   R QE + +     ++R+  P   R LTQEELL EAKITEE+N+RSL  Y+RLE +KKK   +K K   P+I YHSVTVPL+ E G     VD E         +LT    +  +    +CSRTFITF DDA+F + F     PK P  + CP+T   A Y DP+T  PYA   AF+++R+ Y
Sbjct:    1 MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDE--GDEPSSDGEAEEPRRKRRVVTKAYKEPLKS-----LRPRKVNTPAGSSQKAREEKALLPLELQDDGSDSRKSMRQSTAEHTRQTF-LRVQERQGQ-----SRRRKGPHCERPLTQEELLREAKITEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEPGPKEENVDIEGLDPAPSVSALTPHAGTGPVNPPARCSRTFITFSDDATFEEWFPQGRPPKVPVREVCPVTHRPALYRDPVTDIPYATARAFKIIREAY 323          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Human
Match: VPS72 (vacuolar protein sorting 72 homolog [Source:HGNC Symbol;Acc:HGNC:11644])

HSP 1 Score: 135.576 bits (340), Expect = 1.336e-35
Identity = 135/347 (38.90%), Postives = 182/347 (52.45%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVKIRKVKTDSTLNDPS------TPIE--------KKSLRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRR-LTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDENG-----VDFEDS-------------------LTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            M LA  R  R  AGN+++ LL  EEEDEFY  TYGGF EE  D  Y  + S ++         +    DE   + E  + ++ RR++TKAY+EP K      ++ RKV T +  +  +       P+E        +KS+RQST   T +T   R QE + +     ++R+  P   R LTQEELL EAKITEE+N+RSL  Y+RLE +KKK   +K K   P+I YHSVTVPL+ E G     VD E S                   LT    +  +    +CSRTFITF DDA+F + F     PK P  + CP+T   A Y DP+T  PYA   AF+++R+ Y
Sbjct:    1 MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEG--DEPSSDGEAEEPRRKRRVVTKAYKEPLKS-----LRPRKVNTPAGSSQKAREEKALLPLELQDDGSDSRKSMRQSTAEHTRQTF-LRVQERQGQ-----SRRRKGPHCERPLTQEELLREAKITEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEPGPKEENVDIEGSLCFSLSFVLRLDPAPSVSALTPHAGTGPVNPPARCSRTFITFSDDATFEEWFPQGRPPKVPVREVCPVTHRPALYRDPVTDIPYATARAFKIIREAY 334          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Human
Match: VPS72 (vacuolar protein sorting 72 homolog [Source:HGNC Symbol;Acc:HGNC:11644])

HSP 1 Score: 52.7582 bits (125), Expect = 1.599e-7
Identity = 75/203 (36.95%), Postives = 108/203 (53.20%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVKIRKVKTDSTLNDPS------TPIE--------KKSLRQSTQTKTAET---IKQREQEFKEKMLKEIAQRKNVPEVRR-LTQXXXXXXXXXXXXXNIRSL 696
            M LA  R  R  AGN+++ LL  EEEDEFY  TYGGF EE  D  Y  + S ++         +    DE   + E  + ++ RR++TKAY+EP K      ++ RKV T +  +  +       P+E        +KS+RQST   T +T   +++R+ +         ++R+  P   R LTQEELL EAKITEE+N+RSL
Sbjct:    1 MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEG--DEPSSDGEAEEPRRKRRVVTKAYKEPLK-----SLRPRKVNTPAGSSQKAREEKALLPLELQDDGSDSRKSMRQSTAEHTRQTFLRVQERQGQ---------SRRRKGPHCERPLTQEELLREAKITEELNLRSL 187          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Fly
Match: YL-1 (gene:FBgn0032321 transcript:FBtr0340549)

HSP 1 Score: 122.094 bits (305), Expect = 3.688e-31
Identity = 137/334 (41.02%), Postives = 191/334 (57.19%), Query Frame = 1
Query:  148 LAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPK----KETST----------NEVKIRKVKTDSTLNDPSTPIEKKSLRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDE--NGVDFEDSLTNEIKSLGIPGETKCSRTFITFEDDAS---FHQTFLTSAKPKPKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY--SIHKQTGA 1086
            +A  R +RNNAGNK+A LLNEEEED+FY  +YGGF E+++D  Y  +    DVVDSDF +DE + +  SD+E+   K++K   + TKAY+E K    KET              V  R+ +   T+ D      +KS+R ST  KT  T K R +E  +   ++  + +   E    TQEELLEEAKITEE N +SL ++Q++ELEKKKSR  K     P IRYHS+T+P + +   G +        + S  + G  KC RTF+T E+D +   F   F   A PK  +  CPIT   ARYFDP+T+ PY ++ AF++LR+ Y   + +Q G 
Sbjct:    1 MAASRSRRNNAGNKIAHLLNEEEEDDFYKTSYGGFQEDEEDKEYEQKDEEEDVVDSDFSIDE-NDEPVSDQEEAPEKKRKRGVVNTKAYKETKPAVKKETKATPALHKKRPGGGVTKRRPRPRFTVLDSG----RKSIRTSTAIKTQAT-KIRLKELDDARKRKKKKVRV--EDYMPTQEELLEEAKITEEENTKSLEKFQKMELEKKKSRPTKRTFSGPTIRYHSLTMPAMRKPTRGAN------PAVDSKDLAG--KCERTFVTIENDFNDKVFQSLFRHKAPPKASNGICPITRLPARYFDPITQQPYYSIQAFKILREAYYMQLEQQGGG 318          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Fly
Match: YL-1 (gene:FBgn0032321 transcript:FBtr0080146)

HSP 1 Score: 122.094 bits (305), Expect = 3.688e-31
Identity = 137/334 (41.02%), Postives = 191/334 (57.19%), Query Frame = 1
Query:  148 LAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPK----KETST----------NEVKIRKVKTDSTLNDPSTPIEKKSLRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDE--NGVDFEDSLTNEIKSLGIPGETKCSRTFITFEDDAS---FHQTFLTSAKPKPKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY--SIHKQTGA 1086
            +A  R +RNNAGNK+A LLNEEEED+FY  +YGGF E+++D  Y  +    DVVDSDF +DE + +  SD+E+   K++K   + TKAY+E K    KET              V  R+ +   T+ D      +KS+R ST  KT  T K R +E  +   ++  + +   E    TQEELLEEAKITEE N +SL ++Q++ELEKKKSR  K     P IRYHS+T+P + +   G +        + S  + G  KC RTF+T E+D +   F   F   A PK  +  CPIT   ARYFDP+T+ PY ++ AF++LR+ Y   + +Q G 
Sbjct:    1 MAASRSRRNNAGNKIAHLLNEEEEDDFYKTSYGGFQEDEEDKEYEQKDEEEDVVDSDFSIDE-NDEPVSDQEEAPEKKRKRGVVNTKAYKETKPAVKKETKATPALHKKRPGGGVTKRRPRPRFTVLDSG----RKSIRTSTAIKTQAT-KIRLKELDDARKRKKKKVRV--EDYMPTQEELLEEAKITEEENTKSLEKFQKMELEKKKSRPTKRTFSGPTIRYHSLTMPAMRKPTRGAN------PAVDSKDLAG--KCERTFVTIENDFNDKVFQSLFRHKAPPKASNGICPITRLPARYFDPITQQPYYSIQAFKILREAYYMQLEQQGGG 318          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Zebrafish
Match: vps72b (vacuolar protein sorting 72 homolog b [Source:ZFIN;Acc:ZDB-GENE-100922-13])

HSP 1 Score: 149.828 bits (377), Expect = 2.839e-41
Identity = 133/333 (39.94%), Postives = 183/333 (54.95%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVKIRKV-----KTDSTLNDPSTPIE--------KKSLRQSTQTKTAET-IKQREQEFKEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLID-----ENGVDFEDSLTNEIKSLGIP------GETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            M LA  R  R  AGN+M+RLL+ EEEDEFY  TYGGF++E  D  Y  + + ++         +    DE D E EE   ++  R++TKAY+EP K     + K RK+     +TD T  D   P E        +KS+RQST   T  T ++ +E++   +      +RK     R LTQ ELL EAK+T EIN+RSL  Y+RLE +KK+    K +    +IRYHSV +PL+      E  VD E    +  +  G+P        TKCSRT+ITF DD SF + F  S  P+ P  + CP+T + A Y DP+T  PYAN+ AFR++R+ Y
Sbjct:    1 MSLAFSRAPRKTAGNRMSRLLDAEEEDEFYKTTYGGFHDESGDEEYKGDLTETEDEVDSDFDIDE--GDEPDSEQEEDGPRRKSRVVTKAYKEPVK-VVRQKPKQRKLAELPRRTDKTKIDKYNPPELQDDISKYRKSVRQSTTEHTRLTYLRLQERQVAPR------RRKGTRHERPLTQAELLAEAKVTAEINLRSLENYERLEADKKRQVHMKRQCVGSVIRYHSVLMPLVSDVTLKEENVDVEGLFPSPNQPPGVPFTNTAAVNTKCSRTYITFSDDESFQRVFPQSPAPRVPVQEVCPVTHKPALYRDPITDIPYANVQAFRIIREAY 324          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Zebrafish
Match: vps72b (vacuolar protein sorting 72 homolog b [Source:ZFIN;Acc:ZDB-GENE-100922-13])

HSP 1 Score: 149.828 bits (377), Expect = 3.899e-41
Identity = 135/340 (39.71%), Postives = 185/340 (54.41%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVKIRKV-----KTDSTLNDPSTPIE--------KKSLRQSTQTKTAET-IKQREQEFKEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLID-----ENGVDFEDSLTNEI-------KSLGIP------GETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            M LA  R  R  AGN+M+RLL+ EEEDEFY  TYGGF++E  D  Y  + + ++         +    DE D E EE   ++  R++TKAY+EP K     + K RK+     +TD T  D   P E        +KS+RQST   T  T ++ +E++   +      +RK     R LTQ ELL EAK+T EIN+RSL  Y+RLE +KK+    K +    +IRYHSV +PL+      E  VD E  L+  +        S G+P        TKCSRT+ITF DD SF + F  S  P+ P  + CP+T + A Y DP+T  PYAN+ AFR++R+ Y
Sbjct:    1 MSLAFSRAPRKTAGNRMSRLLDAEEEDEFYKTTYGGFHDESGDEEYKGDLTETEDEVDSDFDIDE--GDEPDSEQEEDGPRRKSRVVTKAYKEPVK-VVRQKPKQRKLAELPRRTDKTKIDKYNPPELQDDISKYRKSVRQSTTEHTRLTYLRLQERQVAPR------RRKGTRHERPLTQAELLAEAKVTAEINLRSLENYERLEADKKRQVHMKRQCVGSVIRYHSVLMPLVSDVTLKEENVDVEGYLSGSLPLSECSNASPGVPFTNTAAVNTKCSRTYITFSDDESFQRVFPQSPAPRVPVQEVCPVTHKPALYRDPITDIPYANVQAFRIIREAY 331          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Zebrafish
Match: vps72b (vacuolar protein sorting 72 homolog b [Source:ZFIN;Acc:ZDB-GENE-100922-13])

HSP 1 Score: 149.443 bits (376), Expect = 4.014e-41
Identity = 132/326 (40.49%), Postives = 181/326 (55.52%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVKIRKV-----KTDSTLNDPSTP------IEKKSLRQSTQTKTAET-IKQREQEFKEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLID-----ENGVDFEDSLTNEIKS-LGIPGETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            M LA  R  R  AGN+M+RLL+ EEEDEFY  TYGGF++E  D  Y  + + ++         +    DE D E EE   ++  R++TKAY+EP K     + K RK+     +TD T  D   P      I +KS+RQST   T  T ++ +E++   +      +RK     R LTQ ELL EAK+T EIN+RSL  Y+RLE +KK+    K +    +IRYHSV +PL+      E  VD E  L+  +         TKCSRT+ITF DD SF + F  S  P+ P  + CP+T + A Y DP+T  PYAN+ AFR++R+ Y
Sbjct:    1 MSLAFSRAPRKTAGNRMSRLLDAEEEDEFYKTTYGGFHDESGDEEYKGDLTETEDEVDSDFDIDE--GDEPDSEQEEDGPRRKSRVVTKAYKEPVK-VVRQKPKQRKLAELPRRTDKTKIDKYNPPELQDDINRKSVRQSTTEHTRLTYLRLQERQVAPR------RRKGTRHERPLTQAELLAEAKVTAEINLRSLENYERLEADKKRQVHMKRQCVGSVIRYHSVLMPLVSDVTLKEENVDVEGYLSGLLTDHTHTAVNTKCSRTYITFSDDESFQRVFPQSPAPRVPVQEVCPVTHKPALYRDPITDIPYANVQAFRIIREAY 317          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Zebrafish
Match: vps72a (vacuolar protein sorting 72 homolog a [Source:ZFIN;Acc:ZDB-GENE-060503-88])

HSP 1 Score: 145.976 bits (367), Expect = 1.055e-39
Identity = 127/332 (38.25%), Postives = 183/332 (55.12%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVKIRKVKTDSTLNDPSTP-IEKKS----------LRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPL----------IDENGVDFEDSLTNEIKSLGIPGE-TKCSRTFITFEDDASFHQTFLTSAK---PKPKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            M LA  R +R+ AGN+M++LL+ EEEDEFY  TYGGFN+E  D  YH + S ++         +    DE D   EE   K+  R++TKAY+EP K      V   KVK  S    P  P +E+++          +R+S +  T+E  ++  +  +E+  +   +RK     R LTQ+ELL+EAK+T E N+RSL  Y+RLE +KKK   +K + + PMIRYHSV +PL          +D  G+D +        S    G  + CSRT+ITF DD +F   F ++A+     P  + CP+T + A Y DP+T  PYAN  AFR++R+ Y
Sbjct:    1 MSLANSREQRSTAGNRMSKLLDAEEEDEFYKTTYGGFNDESGDDEYHGDHSDTEDEVDSDFDIDE--GDEPDSGQEEDAPKRKSRVVTKAYKEPLK------VSKPKVKRVSEELKPERPRVERRTVRDELQDLGDIRKSVRKSTSEHTRKTNERLQERQQEAPRKRKGAQSERVLTQDELLDEAKLTAESNLRSLENYERLEADKKKQVHKKRRFEGPMIRYHSVLMPLLPDTHLKEENVDVEGLDQDTPQATPTSSSSTQGAGSLCSRTYITFSDDEAFSSAFPSAARCTPTHPVQEVCPVTHKPALYRDPVTDIPYANARAFRIIREAY 324          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Zebrafish
Match: vps72b (vacuolar protein sorting 72 homolog b [Source:ZFIN;Acc:ZDB-GENE-100922-13])

HSP 1 Score: 111.694 bits (278), Expect = 2.244e-27
Identity = 101/263 (38.40%), Postives = 140/263 (53.23%), Query Frame = 1
Query:  397 IITKAYREPKKETSTNEVKIRKV-----KTDSTLNDPSTP------IEKKSLRQSTQTKTAET-IKQREQEFKEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLID-----ENGVDFE-------------DSLTNEIKSL----GIP------GETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            ++TKAY+EP K     + K RK+     +TD T  D   P      I +KS+RQST   T  T ++ +E++   +      +RK     R LTQ ELL EAK+T EIN+RSL  Y+RLE +KK+    K +    +IRYHSV +PL+      E  VD E              +L+    +L    G+P        TKCSRT+ITF DD SF + F  S  P+ P  + CP+T + A Y DP+T  PYAN+ AFR++R+ Y
Sbjct:   45 VVTKAYKEPVK-VVRQKPKQRKLAELPRRTDKTKIDKYNPPELQDDINRKSVRQSTTEHTRLTYLRLQERQVAPR------RRKGTRHERPLTQAELLAEAKVTAEINLRSLENYERLEADKKRQVHMKRQCVGSVIRYHSVLMPLVSDVTLKEENVDVEGLDQDAQQNPHLPQALSQSESTLSAAPGVPFTNTAAVNTKCSRTYITFSDDESFQRVFPQSPAPRVPVQEVCPVTHKPALYRDPITDIPYANVQAFRIIREAY 300          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Xenopus
Match: gna15 (guanine nucleotide binding protein (G protein), alpha 15 (Gq class) [Source:Xenbase;Acc:XB-GENE-1011753])

HSP 1 Score: 128.642 bits (322), Expect = 3.490e-33
Identity = 133/338 (39.35%), Postives = 178/338 (52.66%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVKIRKVKTDSTLNDPSTP----------IEKKSLRQSTQTKTAET---IKQREQEFKEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLI-----DENGVDFEDSLTNEIKSLG--IPGETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLYSIHKQTGAKP 1092
            M LA  R  R  AGN+M+ LL  EEED+FY  TYGGFNEE  D  Y+ + S S+         +    DE   + EE + KK RR++TKAY+EP +       K     + +  + P  P            +K +RQST   T +T   +K+R+ + K+K        K   + R LTQ ELLEEAKITEEINIRSL  Y+RLE ++KK   +K +   P IR+HS+ +PLI      E  VD E  L  E    G  +    KCSRTFITF DD SF + F  + + K      CP+T + A+Y DP+T  PY N  AF+++R  Y  +  T   P
Sbjct:    1 MNLAEGRAPRKTAGNRMSGLLKAEEEDDFYKTTYGGFNEESGDEEYNEDRSESEDEVDSDFDIDE--GDEPTSDHEEDEPKKKRRVVTKAYKEPIQLLKPKPKKADAPPSSAAKSRPEKPHPQETPEDAVDSRKQMRQSTTEHTRQTFLRVKERQIQSKKK--------KGPHQDRPLTQVELLEEAKITEEINIRSLENYERLEADRKKQVHKKRRCVGPTIRHHSLVMPLITELNVKEENVDVE-GLDQEQTGDGAQVSSAGKCSRTFITFSDDESFERFFPRTKQGKFSVRDICPVTHKPAQYRDPITDIPYYNAKAFKIIRDAYKKYITTHGLP 327          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Mouse
Match: Vps72 (vacuolar protein sorting 72 [Source:MGI Symbol;Acc:MGI:1202305])

HSP 1 Score: 134.806 bits (338), Expect = 1.383e-35
Identity = 135/339 (39.82%), Postives = 178/339 (52.51%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKK-----ETSTNEVKIRKVKTDSTLNDPSTPIE--------KKSLRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRR-LTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDENG-----VDFEDSLTNEIKSLGIP------------GETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            M LA  R  R  AGN+++ LL  EEEDEFY  TYGGF EE  D  Y  + S ++         +    DE   + E  + ++ RR++TKAY+EP K     + ST     +K + + TL     P+E        +KS+RQST   T +T   R QE + +     ++R+  P   R LTQEELL EAKITEE+N+RSL  Y+RLE +KKK   +K K   P+I YHSVTVPL+ E G     VD E        S   P                CSRTFITF DDA+F + F     PK P  + CP+T   A Y DP+T  PYA   AF+++R+ Y
Sbjct:    1 MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDE--GDEPSSDGEAEEPRRKRRVVTKAYKEPLKSLRPRKVSTPASSSQKAREEKTL----LPLELQDDGSDSRKSMRQSTAEHTRQTF-LRVQERQGQ-----SRRRKGPHCERPLTQEELLREAKITEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEPGPKEENVDVEGLDPAPTASALAPHAGTGTGAAAATPPAHCSRTFITFSDDATFEEWFPQGRPPKVPVREVCPVTHRPALYRDPVTDIPYATARAFKIIREAY 327          
BLAST of Vacuolar protein sorting-associated protein 72 vs. UniProt/SwissProt
Match: sp|Q5R5V9|VPS72_PONAB (Vacuolar protein sorting-associated protein 72 homolog OS=Pongo abelii OX=9601 GN=VPS72 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.837e-36
Identity = 134/336 (39.88%), Postives = 182/336 (54.17%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVKIRKVKTDSTLNDPS------TPIE--------KKSLRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRR-LTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDENG-----VDFE--------DSLTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            M LA  R  R  AGN+++ LL  EEEDEFY  TYGGF EE  D  Y  + S ++         +    DE   + E  + ++ RR++TKAY+EP K      ++ RKV T +  +  +       P+E        +KS+RQST   T +T   R QE + +     ++R+  P   R LTQEELL EAKITEE+N+RSL  Y+RLE +KKK   +K K   P+I YHSVTVPL+ E G     VD E         +LT    +  +    +CSRTFITF DDA+F + F     PK P  + CP+T   A Y DP+T  PYA   AF+++R+ Y
Sbjct:    1 MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDE--GDEPSSDGEAEEPRRKRRVVTKAYKEPLKS-----LRPRKVSTPAGSSQKAREEKALLPLELQDDGSDSRKSMRQSTAEHTRQTF-LRVQERQGQ-----SRRRKGPHCERPLTQEELLREAKITEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEPGPKEENVDIEGLDPAPSASALTPHAGTGPVNPPARCSRTFITFSDDATFEEWFPQGRPPKVPVREVCPVTHRPALYRDPVTDIPYATARAFKIIREAY 323          
BLAST of Vacuolar protein sorting-associated protein 72 vs. UniProt/SwissProt
Match: sp|Q15906|VPS72_HUMAN (Vacuolar protein sorting-associated protein 72 homolog OS=Homo sapiens OX=9606 GN=VPS72 PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 3.178e-36
Identity = 134/336 (39.88%), Postives = 182/336 (54.17%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVKIRKVKTDSTLNDPS------TPIE--------KKSLRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRR-LTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDENG-----VDFE--------DSLTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            M LA  R  R  AGN+++ LL  EEEDEFY  TYGGF EE  D  Y  + S ++         +    DE   + E  + ++ RR++TKAY+EP K      ++ RKV T +  +  +       P+E        +KS+RQST   T +T   R QE + +     ++R+  P   R LTQEELL EAKITEE+N+RSL  Y+RLE +KKK   +K K   P+I YHSVTVPL+ E G     VD E         +LT    +  +    +CSRTFITF DDA+F + F     PK P  + CP+T   A Y DP+T  PYA   AF+++R+ Y
Sbjct:    1 MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDE--GDEPSSDGEAEEPRRKRRVVTKAYKEPLKS-----LRPRKVNTPAGSSQKAREEKALLPLELQDDGSDSRKSMRQSTAEHTRQTF-LRVQERQGQ-----SRRRKGPHCERPLTQEELLREAKITEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEPGPKEENVDIEGLDPAPSVSALTPHAGTGPVNPPARCSRTFITFSDDATFEEWFPQGRPPKVPVREVCPVTHRPALYRDPVTDIPYATARAFKIIREAY 323          
BLAST of Vacuolar protein sorting-associated protein 72 vs. UniProt/SwissProt
Match: sp|Q5E9F6|VPS72_BOVIN (Vacuolar protein sorting-associated protein 72 homolog OS=Bos taurus OX=9913 GN=VPS72 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.059e-35
Identity = 131/331 (39.58%), Postives = 179/331 (54.08%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVKIRKVKTDSTLNDPST-PIE--------KKSLRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRR-LTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDENG-----VDFE--------DSLTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            M LA  R  R  AGN+++ LL +EEEDEFY  TYGGF EE  D  Y  + S ++         +    DE   + E  + ++ RR++TKAY+EP K     +V      +  T  + +  P+E        +KS+RQST   T +T   R QE + +     ++R+  P   R LTQEELL EAKITEE+N+RSL  Y+RLE +KKK   +K K   P+I YHSVTVPL+ E G     VD E         +L     +  +    +CSRTFITF DDA+F + F     PK P  + CP+T   A Y DP+T  PYA   AF+++R+ Y
Sbjct:    1 MSLAGGRAPRKTAGNRLSGLLEKEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEG--DEPSSDGEAEEPRRKRRVVTKAYKEPLKSLRPRKVSTPAGSSQKTREEKALLPLELQDDGTDSRKSMRQSTAEHTRQTF-LRVQERQGQ-----SRRRKGPHCERPLTQEELLREAKITEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEPGPKEENVDVEGLDPAPMASALAARAGTGPVIPPARCSRTFITFSDDATFEEWFPQGRTPKIPVREVCPVTHRPALYRDPVTDIPYATARAFKIIREAY 323          
BLAST of Vacuolar protein sorting-associated protein 72 vs. UniProt/SwissProt
Match: sp|Q62481|VPS72_MOUSE (Vacuolar protein sorting-associated protein 72 homolog OS=Mus musculus OX=10090 GN=Vps72 PE=2 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 9.675e-35
Identity = 135/339 (39.82%), Postives = 178/339 (52.51%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKK-----ETSTNEVKIRKVKTDSTLNDPSTPIE--------KKSLRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRR-LTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDENG-----VDFEDSLTNEIKSLGIP------------GETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            M LA  R  R  AGN+++ LL  EEEDEFY  TYGGF EE  D  Y  + S ++         +    DE   + E  + ++ RR++TKAY+EP K     + ST     +K + + TL     P+E        +KS+RQST   T +T   R QE + +     ++R+  P   R LTQEELL EAKITEE+N+RSL  Y+RLE +KKK   +K K   P+I YHSVTVPL+ E G     VD E        S   P                CSRTFITF DDA+F + F     PK P  + CP+T   A Y DP+T  PYA   AF+++R+ Y
Sbjct:    1 MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDE--GDEPSSDGEAEEPRRKRRVVTKAYKEPLKSLRPRKVSTPASSSQKAREEKTL----LPLELQDDGSDSRKSMRQSTAEHTRQTF-LRVQERQGQ-----SRRRKGPHCERPLTQEELLREAKITEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEPGPKEENVDVEGLDPAPTASALAPHAGTGTGAAAATPPAHCSRTFITFSDDATFEEWFPQGRPPKVPVREVCPVTHRPALYRDPVTDIPYATARAFKIIREAY 327          
BLAST of Vacuolar protein sorting-associated protein 72 vs. UniProt/SwissProt
Match: sp|Q6GNJ8|VPS72_XENLA (Vacuolar protein sorting-associated protein 72 homolog OS=Xenopus laevis OX=8355 GN=vps72 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 5.747e-33
Identity = 134/332 (40.36%), Postives = 179/332 (53.92%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVKIRKVKTDSTLNDPSTPIE--------KKSLRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRR-LTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLI-----DENGVDFEDSLTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLYSIHKQTGAKP 1092
            M LA  R  R  AGN+M+ LL  EEED+FY  TYGGFNEE  D  Y+ + S S+         +    DE   + EE + KK RR++TKAY+EP +       K       +  + P  P E        +K +RQST   T +T  +     KE+ ++  +++K  P + R LTQEELLEEAKITEEINIRSL  Y+RLE ++KK   +K +   P IRYHS+ +PLI      E  VD E  L +E       G  KCSR+FITF DD +F + F  S + K      CP+T + A Y DP+T  PY N  AF+++R  Y  +  T   P
Sbjct:    1 MNLADGRAPRKTAGNRMSGLLQAEEEDDFYKTTYGGFNEESGDEEYNEDRSASEDEVDSDFDIDE--GDEPTSDHEEDEPKKKRRVVTKAYKEPIQLLKPKPKKPEAPPNTAAKSRPEKPQEPPDDTVDSRKQMRQSTTEHTRQTFLR----VKERQIQ--SKKKKGPHLDRPLTQEELLEEAKITEEINIRSLENYERLEADRKKQVHKKRRCAGPTIRYHSMVMPLITELRMKEENVDVE-GLDHEQTDRTHAG--KCSRSFITFSDDETFERFFPRSKRGKFSVRDVCPVTHKPALYRDPITDIPYYNSKAFKIIRDAYKKYITTHGLP 321          
BLAST of Vacuolar protein sorting-associated protein 72 vs. TrEMBL
Match: G4VNZ6 (YL1_C domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_018030 PE=4 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 1.148e-63
Identity = 166/391 (42.46%), Postives = 221/391 (56.52%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEE------QXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETST----NEVKIRKVKTDSTLNDPST----------------------------PIEKKSLRQSTQTKTAETIKQREQEF------KEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDEN----GV--DFEDSLTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSAKPKPKD--------------KFCPITGEKARYFDPLTKTPYANLAAFRVLRKLYSIHKQTGAKPIELVRRFRRG 1122
            MP++++R +R NAG +MARLLNEEEEDEFY+N YGGF EE      Q ++S           +S    ++      SD ++ + ++++S R++TK Y+EPK+   T    N++  +K  +D +L DP +                            P  + S  Q+T  + AET ++R          ++ +L EIAQRKN+PEVRRLTQEELL EAKITEEIN RSLA+YQRLE+EKKK+R QK     PMIRYHS TVP+I+E     GV  + +D  T     +      KCSR  ITF +D  F  +   +  P P+               + CPITG  ARY DPLT TPYANLAAFRVLR+LYSIH +T   PIEL+R +R G
Sbjct:    1 MPISVDRERRANAGARMARLLNEEEEDEFYSNIYGGFTEEEEDADYQSESSVEDVIDSDFADESSGSDEDDATAIASDDDENKRQKRQSNRVVTKGYKEPKRAKITHPQENKLSDKKANSDKSLTDPQSKSAVQIKDKQQQITVTKKTSGQISTYERPELRASTLQATADQEAETTRRRIATAENTAVRRKALLAEIAQRKNLPEVRRLTQEELLAEAKITEEINRRSLARYQRLEIEKKKARIQKTVNSTPMIRYHSFTVPIIEEQHNIYGVLANNDDESTIRAGPIITDPSAKCSRNLITFANDVCFRDSMPETITPLPEPGYPAPTPIRPERRLRICPITGLPARYLDPLTLTPYANLAAFRVLRRLYSIHLETKKPPIELLREYRHG 391          
BLAST of Vacuolar protein sorting-associated protein 72 vs. TrEMBL
Match: A0A4Z2D4H4 (Vacuolar protein sorting-associated protein 72 OS=Schistosoma japonicum OX=6182 GN=EWB00_004632 PE=4 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.273e-62
Identity = 178/387 (45.99%), Postives = 233/387 (60.21%), Query Frame = 1
Query:  139 TMPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEA----HFXXXXXXXXXXXXXXXXXXIITKAYREPK--KETSTNEVKIRKVKTDSTLNDPST---------------------------PIEKKSLRQSTQTKTAETIKQR------EQEFKEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDENGVDFEDSLTNE---IKSLGI---PGETKCSRTFITFEDDASFHQTFLTSAKPKPKD--------------KFCPITGEKARYFDPLTKTPYANLAAFRVLRKLYSIHKQTGAKPIELVRRFRRG 1122
            TMP++++R +R NAG +MARLLNEEEEDEFY+N YGGF EE +D  Y SESSV DV+DSDF  + +         SD ++++ ++++S R++TK Y+EPK  K T T E K  K  +D +  D                              P  + S  Q+T  + AET ++R          ++ +L EIAQRKN+PEVRRLTQEELL EAKITEEIN RSLA+YQRLE+EKKK+R QK     PMIRYHS TVP+I+E    +  S +N+   I++  I   P   KCSR  ITF +D  F  +   +  P P+               + CPITG+ ARY DPLT TPYANLAAFRVLR+LYSIH +T   P+EL+R +R+G
Sbjct:    6 TMPISVDRERRTNAGARMARLLNEEEEDEFYSNIYGGFTEEAEDVDYQSESSVEDVIDSDFADESSGSGDDDNVRSDDDEDKRQKRQSNRVVTKGYKEPKRTKVTRTQEAKSDKKASDKSSTDSHNKSTVPAKDKQQTTGSKKTSGHIPAYERPTLRASTLQATADQEAETTRRRVLTNENTAIRRKALLAEIAQRKNLPEVRRLTQEELLAEAKITEEINRRSLARYQRLEIEKKKARIQKTVNSTPMIRYHSFTVPIIEEQHNIYGVSASNDEPIIRAGPIITNPS-AKCSRNLITFANDVCFRDSMPETITPLPEPGCPAPTPIRPERRLRICPITGQPARYLDPLTLTPYANLAAFRVLRRLYSIHLETRKPPMELLREYRQG 391          
BLAST of Vacuolar protein sorting-associated protein 72 vs. TrEMBL
Match: A0A0R3W3E4 (YL1_C domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4436 PE=4 SV=2)

HSP 1 Score: 210.305 bits (534), Expect = 1.534e-58
Identity = 170/408 (41.67%), Postives = 238/408 (58.33%), Query Frame = 1
Query:   94 NLNTD*NSYINCNFFTM--------PLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXX----XXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVKIR-----KVKT-----------DSTLNDPSTPIEKKSLRQSTQTKTAETIKQREQEF----------KEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDENGVDFEDSLTN----EIKSLGIPGETKCSRTFITFEDDASFHQTF-----------LTSAKPKPKDK----FCPITGEKARYFDPLTKTPYANLAAFRVLRKLYSIHKQTGAKPIELVRRFRRGEIPIGGTD 1146
            N + D  +  +CNF            + + R +R NAG++MARLLNEEEED+FYT+ YGGF EE++D  Y SESS  D +        + ++       +  D+E ++++ RR++TK+Y+EPK +   NE KI+     ++KT            + L  PS   E + LR ST  +  ET  QR Q            ++ ++ EIAQRKN+PEVRRLTQEELL EAKITEEIN RSLA+YQR+E+E+KK R QK   + PMIR HS TVP + +    ++ S+      E++ + +  + +C+RT ++F D+ASF   F            TS+   P  K     CP+TG  ARY DPLT+TPYA+LAAFR LR LY +H +TGA  ++L+RRFR GEI +G  D
Sbjct:  184 NFSWDKRTRRSCNFLPFIEVLSMLNSVTMTRSRRPNAGSRMARLLNEEEEDDFYTSAYGGFAEEENDNDYESESSGHDSIDTDFADTEEEEDEDDGSGGEALDDERRKRRVRRVVTKSYKEPKVKKEANE-KIKSESRSRIKTIVAGEESLTEATAVLMLPSVFAESRKLRAST-VRATETAIQRRQASNVNAEVTAVKRKALMAEIAQRKNLPEVRRLTQEELLAEAKITEEINKRSLARYQRMEVERKKIRVQKTVSQQPMIRTHSFTVPSLADQPEVYDVSVNADKEVEMRRMLVERDARCARTLVSFTDEASFASAFPSYTAATTSEKQTSSTSSPSRKRPMRHCPLTGRIARYLDPLTRTPYADLAAFRALRHLYRLHLETGASAVDLLRRFRSGEIKLGSDD 589          
BLAST of Vacuolar protein sorting-associated protein 72 vs. TrEMBL
Match: A0A5K3FB23 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 1.698e-58
Identity = 165/357 (46.22%), Postives = 227/357 (63.59%), Query Frame = 1
Query:  148 LAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXX----XXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPK-KETSTNEVKIRKVKTDSTLNDPSTPI--EKKSLRQSTQTKTAETIKQREQEF--------KEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDEN----GVDF-EDSLTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSA-------KPKPKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLYSIHKQTGAKPIELVRRFRRGEIPIG 1137
            + + R +R NAG++MARLLNEEEEDEFYT+ YGGF EE+DD  Y SESS  D +D+      + DE    +     D+E KR+++RR++TK+Y+EPK K+ S+++VK         L +PS  +  E + LR ST     E    ++Q          ++ +L EIAQRKN+PEVRRLTQEELL EAKITEEIN RSLA+YQ+LE+E+KK R QK   + PMIR HS  VP + +     GV    +S   E++ + +    +C+RT ++F D ASF  TF ++A        P+ K +FCP+TG  A Y DPLT+TPYA+LAAFR LR LY +H +TG   I+L+R++R GE+ I 
Sbjct:    5 VTVTRSRRPNAGSRMARLLNEEEEDEFYTSAYGGFAEEEDDNDYESESSGHDSIDTDFVDTEEEDEGSANETGAGSDDEKKRRRTRRVVTKSYKEPKAKKDSSDKVKPEPKPRSRPLEEPSAELASEGRKLRASTVRAHVEAATDKKQSGNSEATALKRKALLAEIAQRKNLPEVRRLTQEELLAEAKITEEINKRSLARYQKLEIERKKIRVQKTVSQQPMIRTHSFAVPSVADQPEVYGVAVNSESGDVEMRQMLVNRNLRCARTLVSFTDPASFTATFPSTAPGKRSGQAPRKKTRFCPLTGRVAAYLDPLTRTPYADLAAFRALRYLYRLHLETGTPAIDLLRQYRSGELRIA 361          
BLAST of Vacuolar protein sorting-associated protein 72 vs. TrEMBL
Match: A0A074ZQT7 (YL1_C domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_14158 PE=4 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 2.209e-58
Identity = 175/406 (43.10%), Postives = 230/406 (56.65%), Query Frame = 1
Query:   67 RIFCCHIVRNLNTD*NSYINCNFFT------MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXX-----XXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVK-----------------IRKVKTDSTLNDPSTPIEKKSLRQSTQTKTAETI----KQREQEF----KEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDEN------GVDFEDSLTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSAKPKPKD--------------KFCPITGEKARYFDPLTKTPYANLAAFRVLRKLYSIHKQTGAKPIELVRRFR 1116
            R+F   IV +++ D    + C F        MP+ ++R +R NAG KMA+LLN+E+EDEFYT+ YGGF EE DD  Y SESSV D+     VDS     E    DE +   +  K+++ R ++TKAY+EPK+   T   K                 I++  T ST  + +T  E + LRQ T   T+E+     K R  +     ++ ML EIAQRKNVPEVRRLTQEELL EAK+TEEIN RSLA+YQR+E+EKKK   QK+K  VPMIRYHS TVPL+++        VD + S       +  P   +CSR  ITF D+     +   +  P P                + CPITG  ARY DP+T TPYANLAAFRVLR+LY +H +T    I+L+R +R
Sbjct:   19 RLFDSSIVLDIDID----LECVFGVVDNSKNMPICVDRERRPNAGAKMAQLLNDEQEDEFYTSVYGGFTEEADDVDYQSESSVEDIIDSDFVDSSAAESETVSSDEDEDGPKNKKKRRHRGVVTKAYKEPKRSKPTESSKSTAQQIDEQTEPKPKSTIKEKATGSTEGEVAT-FESRVLRQRTVPSTSESTGTESKSRRNDSTALRRQAMLAEIAQRKNVPEVRRLTQEELLAEAKLTEEINRRSLARYQRMEIEKKKVHFQKSKSTVPMIRYHSFTVPLVEDQPHLYGVSVDPQSSTVRAGPIITDPS-ARCSRNLITFADEQCLRASMPKTITPLPDPNNPAPVAPRPRRIMRICPITGLPARYLDPVTLTPYANLAAFRVLRRLYQLHLETNTPAIDLLREYR 418          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Cavefish
Match: vps72b (vacuolar protein sorting 72 homolog [Source:NCBI gene;Acc:103047377])

HSP 1 Score: 134.806 bits (338), Expect = 1.668e-35
Identity = 126/360 (35.00%), Postives = 186/360 (51.67%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKK-------------------ETSTNEVKIRKVKTDSTLNDPSTPIEKKSLRQSTQTKTAET-IKQREQEFKEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLI----------DENGVDFEDSLTNEIKSLGI----------------------PGETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            M LA  R  R NAG++M++LL+ EEEDEFY  TYGGFN+E  D  Y  + S ++         +    +E D E EE   ++  R++TKAY+EP K                   +T T++ K  +++ D + N       +KS+RQST   T  T ++ +E++   +      +RK     R LTQ ELL EAK+T EIN+RSL  Y+RLE +KKK   +K +   P+IRYHSV +PL+          D  G+D +   ++   + G                       PG  +CSRT+ITF D+ +F   F  +  P+ P  + CP+T + A Y DP+T  PYANL AF+++R+ Y
Sbjct:    1 MSLAFSRAPRKNAGSRMSKLLDAEEEDEFYKTTYGGFNDESGDDEYKGDLSDTEDEVDSDFDIDE--GEEPDSEQEEDGPRRKTRVVTKAYKEPIKAVKPKPKPKKLSELPRRADKTKTDKHKTFELQEDISKN-------RKSVRQSTTEHTRLTYLRLQERQVAPR------RRKGTRHERPLTQAELLAEAKVTAEINLRSLENYERLEADKKKQVHKKRQCVGPVIRYHSVLMPLVSNPSLKEENVDVEGLDQDPQQSHPGPAAGAAMSSQSETPLSGQQPSTSASLPPGGARCSRTYITFSDEDTFQSFFPKTPAPRVPAREVCPVTHKPALYRDPITDIPYANLRAFKIIREAY 345          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Cavefish
Match: vps72b (vacuolar protein sorting 72 homolog [Source:NCBI gene;Acc:103047377])

HSP 1 Score: 134.806 bits (338), Expect = 2.616e-35
Identity = 126/360 (35.00%), Postives = 186/360 (51.67%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKK-------------------ETSTNEVKIRKVKTDSTLNDPSTPIEKKSLRQSTQTKTAET-IKQREQEFKEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLI----------DENGVDFEDSLTNEIKSLGI----------------------PGETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            M LA  R  R NAG++M++LL+ EEEDEFY  TYGGFN+E  D  Y  + S ++         +    +E D E EE   ++  R++TKAY+EP K                   +T T++ K  +++ D + N       +KS+RQST   T  T ++ +E++   +      +RK     R LTQ ELL EAK+T EIN+RSL  Y+RLE +KKK   +K +   P+IRYHSV +PL+          D  G+D +   ++   + G                       PG  +CSRT+ITF D+ +F   F  +  P+ P  + CP+T + A Y DP+T  PYANL AF+++R+ Y
Sbjct:    1 MSLAFSRAPRKNAGSRMSKLLDAEEEDEFYKTTYGGFNDESGDDEYKGDLSDTEDEVDSDFDIDE--GEEPDSEQEEDGPRRKTRVVTKAYKEPIKAVKPKPKPKKLSELPRRADKTKTDKHKTFELQEDISKN-------RKSVRQSTTEHTRLTYLRLQERQVAPR------RRKGTRHERPLTQAELLAEAKVTAEINLRSLENYERLEADKKKQVHKKRQCVGPVIRYHSVLMPLVSNPSLKEENVDVEGLDQDPQQSHPGPAAGAAMSSQSETPLSGQQPSTSASLPPGGARCSRTYITFSDEDTFQSFFPKTPAPRVPAREVCPVTHKPALYRDPITDIPYANLRAFKIIREAY 345          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Cavefish
Match: ENSAMXT00000020065.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000876.1:125692:137859:1 gene:ENSAMXG00000019484.2 transcript:ENSAMXT00000020065.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.709 bits (304), Expect = 6.613e-31
Identity = 112/319 (35.11%), Postives = 177/319 (55.49%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVKIRKVKTDSTLNDPSTPIEKKS---------LRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDENGVDFEDSLTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSAKPKPK---DKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            M LA  R +R  AGN+M +LL+ EEED+FY  TYGGFN+E  D  Y  + S ++         +    DE D  +E+   ++  R++TKAY+EP K     + K+++   +    +   P EK+S         LR+S +  T+E  ++  +  +E+  +E  +R+       L+QEELL+EA+IT + N++SL  Y+RLE +KKK   +K + + P +RYHS     +D  G+D +D+  +   S  +   + CSRTFITF DD +F   F   + P P     + CP+T + A Y DP+T  PY++  AFR++R+ Y
Sbjct:    1 MSLAQGREQRCTAGNRMGKLLDAEEEDDFYKTTYGGFNDESGDDEYRGDHSDTEDEVDSDFDIDE--GDEPDSNEEDDAPRRKSRVVTKAYKEPVKAV---KPKVKRPSEEPKRTERLKP-EKRSHQDLQEYGELRKSVRKSTSEHTRKTFERLQERQ-QEAPRRRKANTEPVLSQEELLKEAQITAQSNLQSLENYERLEADKKKHVHKKRRFEGPTVRYHSEEN--VDVEGLD-QDTPQSSSSSGAVGTRSLCSRTFITFSDDEAFRTAFPQVSSPDPALPVQEVCPVTHKPALYRDPVTDIPYSDSRAFRIIREAY 309          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Cavefish
Match: ENSAMXT00000033569.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000876.1:125692:135053:1 gene:ENSAMXG00000019484.2 transcript:ENSAMXT00000033569.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 7.532e-9
Identity = 24/40 (60.00%), Postives = 30/40 (75.00%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEE 261
            M LA  R +R  AGN+M +LL+ EEED+FY  TYGGFN+E
Sbjct:    1 MSLAQGREQRCTAGNRMGKLLDAEEEDDFYKTTYGGFNDE 40          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Sea Lamprey
Match: vps72a (vacuolar protein sorting 72 homolog a [Source:ZFIN;Acc:ZDB-GENE-060503-88])

HSP 1 Score: 147.517 bits (371), Expect = 6.572e-41
Identity = 132/343 (38.48%), Postives = 191/343 (55.69%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKK-ETSTNEVKIRKVKTDST---------LNDPSTPIEKKSLRQSTQTKTAETIKQREQEFKEKM-LKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLI----------DENGVDFEDSLTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSAKPK-----PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLYSIHKQTGAKP 1092
            M L++ R  R NAGNKM++LL+ EE+D+FY  TYGGFN+E  D  + S+ S S+         +    + +   +E+   KK RR++TKAY+EP K    T++ K RK   D           +N  S  + K + R++ +  TAE  +Q     KE+  L +  +++   E  R++Q++LL EAKITEE+N+RSL  Y+RLE +KKK   +K     P+IRYHS+T+PLI          D  G+D E   T E  S  +    KCSR FITF D+ +F+Q F   AKPK     P  + CP+T + A Y DP+T  PYAN  AF+++R+ Y  +  T   P
Sbjct:    1 MALSLTREPRKNAGNKMSKLLDAEEDDDFYKTTYGGFNDESGDDEFKSDVSASEDEVDSDFDID-EGDEPASDHEEDDAPKKKRRVVTKAYKEPVKVNKPTSKSKTRKSSDDRGRMRRKNARLVNQGSMDL-KHTARKAMRHSTAECTRQTYLRVKEREELPKRQRKRQYEESGRVSQQQLLAEAKITEELNLRSLENYERLEADKKKQVLKKHHYTGPVIRYHSLTMPLITELPIKEENVDVEGLDQESQPTAE--SAQVTSSGKCSRNFITFTDEETFNQIF---AKPKVPLRVPVREICPVTHKPALYRDPITDIPYANPRAFKIIREAYRTYVATHGMP 336          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Nematostella
Match: EDO40380 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7D7])

HSP 1 Score: 90.8929 bits (224), Expect = 5.136e-22
Identity = 69/151 (45.70%), Postives = 92/151 (60.93%), Query Frame = 1
Query:  625 VRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDEN----GVDFEDSLTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSAKPK-PKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            +RRLTQEELL EA+ITEE N  SL  YQR E +KKK++ QK   K P+IR+ S+++P+ID N     VD  D          I    +C R F+ F D  +F   +  + KPK P+  +CP+TG  ARY DP+T+ PYAN  AFR +R+ Y
Sbjct:    1 MRRLTQEELLAEARITEEENTASLLAYQRHEADKKKTKIQKVTHKGPIIRFCSLSMPVIDMNEPIVHVDEIDKEEETQTKQNIDPTKRCCRNFMIFTDAKNFPDAYFPTKKPKYPQRTYCPVTGLPARYLDPITQLPYANAQAFRYIREKY 151          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Medaka
Match: vps72a (vacuolar protein sorting 72 homolog [Source:NCBI gene;Acc:101169620])

HSP 1 Score: 132.494 bits (332), Expect = 8.368e-35
Identity = 126/331 (38.07%), Postives = 181/331 (54.68%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREP--------------KKETSTNEVKIRKVKTDSTLNDPSTPIEKKSLRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLID-----ENGVDFED--SLTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSAKPKPK---DKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            M LA  R  R  AGN+M++LL+ EEEDEFY  TYGGF++E  D  YH E S ++         +    DE D + EE   ++  R++TKAY+EP              +++T    V++R+ +    L D +    +KS+RQST   T +T   R QE ++   +     ++ P    LTQEELL EA++T E+NIRSL  Y+RLE +KKK   +K + + P IRYHS+ +P++      E  VD E   +  N       P    CSRT++TF DD +F   F  SA P P+    + CP+T + A Y DP+T  PYAN  AFR++R+ Y
Sbjct:    1 MSLAGSREPRKTAGNRMSKLLDAEEEDEFYKTTYGGFHDESGDDEYHGEHSDTEDEVDSDFDIDE--GDEPDSDQEEDAPRRKSRVVTKAYKEPIKVAKPKPKKPSEEQRKTEKTRVELRR-RIPQELQDFAE--TRKSVRQSTSEHTRKT-NLRLQERQDAPRRRRGAHRDRP----LTQEELLAEARVTAELNIRSLENYERLEADKKKQVHKKRRFEGPTIRYHSLLMPIVSHSVLKEENVDVEGYAAPQNPSTPSQQPTGGLCSRTYVTFSDDEAFEVAFPRSAHPGPQPPVQEICPVTHKAALYRDPVTDIPYANARAFRIIREAY 321          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Medaka
Match: vps72a (vacuolar protein sorting 72 homolog [Source:NCBI gene;Acc:101169620])

HSP 1 Score: 100.908 bits (250), Expect = 1.805e-23
Identity = 91/253 (35.97%), Postives = 135/253 (53.36%), Query Frame = 1
Query:  397 IITKAYREP--------------KKETSTNEVKIRKVKTDSTLNDPSTPIEKKSLRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLID-----ENGVDFEDSLTNEIKSLGI---------PGETKCSRTFITFEDDASFHQTFLTSAKPKPK---DKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLY 1062
            ++TKAY+EP              +++T    V++R+ +    L D +    +KS+RQST   T +T   R QE ++   +     ++ P    LTQEELL EA++T E+NIRSL  Y+RLE +KKK   +K + + P IRYHS+ +P++      E  VD E  L  ++              P    CSRT++TF DD +F   F  SA P P+    + CP+T + A Y DP+T  PYAN  AFR++R+ Y
Sbjct:   77 VVTKAYKEPIKVAKPKPKKPSEEQRKTEKTRVELRR-RIPQELQDFAE--TRKSVRQSTSEHTRKT-NLRLQERQDAPRRRRGAHRDRP----LTQEELLAEARVTAELNIRSLENYERLEADKKKQVHKKRRFEGPTIRYHSLLMPIVSHSVLKEENVDVE-GLDQDVPQAAPQNPSTPSQQPTGGLCSRTYVTFSDDEAFEVAFPRSAHPGPQPPVQEICPVTHKAALYRDPVTDIPYANARAFRIIREAY 320          
BLAST of Vacuolar protein sorting-associated protein 72 vs. Planmine SMEST
Match: SMESG000068670.1 (SMESG000068670.1)

HSP 1 Score: 529.635 bits (1363), Expect = 0.000e+0
Identity = 334/335 (99.70%), Postives = 335/335 (100.00%), Query Frame = 1
Query:  142 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQXXXXXXXXXXXXXXXXXXXXXXEAHFXXXXXXXXXXXXXXXXXXIITKAYREPKKETSTNEVKIRKVKTDSTLNDPSTPIEKKSLRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRRLTQXXXXXXXXXXXXXNIRSLAQYQRLELEXXXXXXXXXXXXXPMIRYHSVTVPLIDENGVDFEDSLTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSAKPKPKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLYSIHKQTGAKPIELVRRFRRGEIPIGGTD 1146
            MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQDDASYHSESSVSDVVDSDFDVDEAHFKDESDKEDEEPK+KKSRRIITKAYREPKKETSTNEVKIRKVKTDSTLNDPSTPIEKKSLRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRRLTQEELLEEAKITEEINIRSLAQYQRLELEKKKSRAQKAKVKVPMIRYHSVTVPLIDENGVDFEDSLTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSAKPKPKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLYSIHKQTGAKPIELVRRFRRGEIPIGGTD
Sbjct:    1 MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQDDASYHSESSVSDVVDSDFDVDEAHFKDESDKEDEEPKQKKSRRIITKAYREPKKETSTNEVKIRKVKTDSTLNDPSTPIEKKSLRQSTQTKTAETIKQREQEFKEKMLKEIAQRKNVPEVRRLTQEELLEEAKITEEINIRSLAQYQRLELEKKKSRAQKAKVKVPMIRYHSVTVPLIDENGVDFEDSLTNEIKSLGIPGETKCSRTFITFEDDASFHQTFLTSAKPKPKDKFCPITGEKARYFDPLTKTPYANLAAFRVLRKLYSIHKQTGAKPIELVRRFRRGEIPIGGTD 335          
The following BLAST results are available for this feature:
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
VPS726.617e-3739.88vacuolar protein sorting 72 homolog [Source:HGNC S... [more]
VPS721.336e-3538.90vacuolar protein sorting 72 homolog [Source:HGNC S... [more]
VPS721.599e-736.95vacuolar protein sorting 72 homolog [Source:HGNC S... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
YL-13.688e-3141.02gene:FBgn0032321 transcript:FBtr0340549[more]
YL-13.688e-3141.02gene:FBgn0032321 transcript:FBtr0080146[more]
back to top
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vps72b2.839e-4139.94vacuolar protein sorting 72 homolog b [Source:ZFIN... [more]
vps72b3.899e-4139.71vacuolar protein sorting 72 homolog b [Source:ZFIN... [more]
vps72b4.014e-4140.49vacuolar protein sorting 72 homolog b [Source:ZFIN... [more]
vps72a1.055e-3938.25vacuolar protein sorting 72 homolog a [Source:ZFIN... [more]
vps72b2.244e-2738.40vacuolar protein sorting 72 homolog b [Source:ZFIN... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gna153.490e-3339.35guanine nucleotide binding protein (G protein), al... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Vps721.383e-3539.82vacuolar protein sorting 72 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 72 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R5V9|VPS72_PONAB2.837e-3639.88Vacuolar protein sorting-associated protein 72 hom... [more]
sp|Q15906|VPS72_HUMAN3.178e-3639.88Vacuolar protein sorting-associated protein 72 hom... [more]
sp|Q5E9F6|VPS72_BOVIN1.059e-3539.58Vacuolar protein sorting-associated protein 72 hom... [more]
sp|Q62481|VPS72_MOUSE9.675e-3539.82Vacuolar protein sorting-associated protein 72 hom... [more]
sp|Q6GNJ8|VPS72_XENLA5.747e-3340.36Vacuolar protein sorting-associated protein 72 hom... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 72 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VNZ61.148e-6342.46YL1_C domain-containing protein OS=Schistosoma man... [more]
A0A4Z2D4H42.273e-6245.99Vacuolar protein sorting-associated protein 72 OS=... [more]
A0A0R3W3E41.534e-5841.67YL1_C domain-containing protein OS=Taenia asiatica... [more]
A0A5K3FB231.698e-5846.22Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A074ZQT72.209e-5843.10YL1_C domain-containing protein (Fragment) OS=Opis... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
vps72b1.668e-3535.00vacuolar protein sorting 72 homolog [Source:NCBI g... [more]
vps72b2.616e-3535.00vacuolar protein sorting 72 homolog [Source:NCBI g... [more]
ENSAMXT00000020065.26.613e-3135.11pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000033569.17.532e-960.00pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vps72a6.572e-4138.48vacuolar protein sorting 72 homolog a [Source:ZFIN... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO403805.136e-2245.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 72 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vps72a8.368e-3538.07vacuolar protein sorting 72 homolog [Source:NCBI g... [more]
vps72a1.805e-2335.97vacuolar protein sorting 72 homolog [Source:NCBI g... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 72 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000068670.10.000e+099.70SMESG000068670.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025292 ID=SMED30025292|Name=Vacuolar protein sorting-associated protein 72|organism=Schmidtea mediterranea sexual|type=transcript|length=1178bp
ATTTTACCTCAATCACATTTAATATTTTGTAATAATAAAATTTATAATAA
AATTCTGTTCTAATAAAGGATTTTTTGTTGTCATATTGTTAGAAATTTAA
ATACAGATTAAAATTCTTACATAAATTGTAATTTTTTTACCATGCCTCTT
GCAATTGAAAGACCAAAAAGAAATAATGCTGGTAATAAAATGGCCCGTCT
TCTTAACGAAGAAGAGGAAGACGAATTTTATACAAATACTTATGGTGGGT
TTAACGAAGAACAAGATGATGCTAGTTATCACTCTGAATCGAGTGTTTCT
GATGTTGTGGATTCGGATTTTGATGTTGATGAAGCTCATTTTAAAGATGA
ATCAGACAAGGAAGATGAAGAACCAAAACGAAAAAAATCAAGGCGAATTA
TTACCAAAGCGTATAGAGAACCGAAAAAAGAAACTTCGACAAATGAAGTA
AAGATTAGAAAAGTTAAAACCGATTCTACTTTAAATGATCCTTCAACGCC
AATAGAAAAAAAGTCATTGCGCCAATCCACTCAAACAAAAACCGCCGAAA
CAATTAAACAAAGAGAGCAAGAATTCAAAGAAAAAATGTTGAAAGAAATT
GCTCAAAGGAAAAATGTGCCAGAAGTTCGCAGATTGACTCAAGAGGAATT
ACTGGAAGAAGCAAAAATAACCGAAGAAATCAATATCAGATCTTTAGCTC
AATATCAACGATTGGAATTAGAAAAGAAAAAATCAAGAGCTCAAAAAGCT
AAAGTAAAAGTTCCAATGATCAGATATCATTCGGTTACTGTTCCGTTAAT
CGATGAAAATGGGGTGGATTTTGAAGATTCCTTAACCAATGAAATAAAAT
CCCTGGGAATTCCCGGAGAAACGAAATGTTCACGAACATTTATCACATTT
GAGGATGACGCGTCATTTCACCAGACGTTTCTAACGTCCGCCAAACCGAA
ACCAAAGGACAAGTTTTGTCCTATCACTGGAGAGAAAGCTCGATATTTCG
ACCCATTAACCAAAACTCCCTATGCAAATTTGGCAGCGTTTCGAGTATTA
AGAAAATTGTACAGCATTCACAAGCAAACAGGAGCAAAACCGATCGAATT
AGTCAGAAGATTCCGCCGAGGAGAGATTCCAATTGGTGGAACTGATTGAA
ATAAATAATATTTGTACATATTTTGTTT
back to top

protein sequence of SMED30025292-orf-1

>SMED30025292-orf-1 ID=SMED30025292-orf-1|Name=SMED30025292-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=336bp
MPLAIERPKRNNAGNKMARLLNEEEEDEFYTNTYGGFNEEQDDASYHSES
SVSDVVDSDFDVDEAHFKDESDKEDEEPKRKKSRRIITKAYREPKKETST
NEVKIRKVKTDSTLNDPSTPIEKKSLRQSTQTKTAETIKQREQEFKEKML
KEIAQRKNVPEVRRLTQEELLEEAKITEEINIRSLAQYQRLELEKKKSRA
QKAKVKVPMIRYHSVTVPLIDENGVDFEDSLTNEIKSLGIPGETKCSRTF
ITFEDDASFHQTFLTSAKPKPKDKFCPITGEKARYFDPLTKTPYANLAAF
RVLRKLYSIHKQTGAKPIELVRRFRRGEIPIGGTD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR008895Vps72/YL1
IPR013272Vps72/YL1_C
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006338chromatin remodeling
GO:0006355regulation of transcription, DNA-templated
GO:0043486histone exchange
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013272Vps72/YL1, C-terminalSMARTSM00993YL1_C_2coord: 274..303
e-value: 1.9E-10
score: 50.7
IPR013272Vps72/YL1, C-terminalPFAMPF08265YL1_Ccoord: 276..302
e-value: 1.6E-12
score: 47.0
IPR008895Vps72/YL1 familyPFAMPF05764YL1coord: 7..214
e-value: 6.7E-39
score: 134.5
IPR008895Vps72/YL1 familyPANTHERPTHR13275YL-1 PROTEIN TRANSCRIPTION FACTOR-LIKE 1coord: 4..308
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 112..135
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..135
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 59..84
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 90..111