Transient-receptor-potential-like protein

Overview
NameTransient-receptor-potential-like protein
Smed IDSMED30025288
Length (bp)1600
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025288

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30025288h1SMcG0007553 SmedASXL_003057SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30025288h1SMcG0007553 dd_Smed_v4_97628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025288h1SMcG0007553 dd_Smed_v4_97628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025288h1SMcG0007553 dd_Smed_v4_97628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC4 (transient receptor potential cation channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:12336])

HSP 1 Score: 429.869 bits (1104), Expect = 1.886e-141
Identity = 233/520 (44.81%), Postives = 335/520 (64.42%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN-KSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRL 1526
            ++ +PH   C+C  C  S   D+LRHS  R++ Y+ALASP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN + +     E+      RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       ++  C  I +L P+ +  YL+ P+  LG F+R P +KFI H+AS+  FL L+L+AS H +  D+      ++GP P++VE +I+ WV+GF+W E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL+I A       KY   + PR SW    PTL++EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+     +          NN F TL  T ++L+W++FG+     I++ V + + +    T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLP P N + S K ++ L
Sbjct:  167 SVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDLN-----RQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAF-----VKYSALN-PRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGIRCEKQNNAFSTLFETLQSLFWSIFGL-----INLYVTNVK-AQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYL 669          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC4 (transient receptor potential cation channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:12336])

HSP 1 Score: 430.639 bits (1106), Expect = 4.655e-141
Identity = 233/520 (44.81%), Postives = 335/520 (64.42%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN-KSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRL 1526
            ++ +PH   C+C  C  S   D+LRHS  R++ Y+ALASP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN + +     E+      RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       ++  C  I +L P+ +  YL+ P+  LG F+R P +KFI H+AS+  FL L+L+AS H +  D+      ++GP P++VE +I+ WV+GF+W E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL+I A       KY   + PR SW    PTL++EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+     +          NN F TL  T ++L+W++FG+     I++ V + + +    T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLP P N + S K ++ L
Sbjct:  167 SVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDLN-----RQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAF-----VKYSALN-PRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGIRCEKQNNAFSTLFETLQSLFWSIFGL-----INLYVTNVK-AQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYL 669          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC4 (transient receptor potential cation channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:12336])

HSP 1 Score: 430.639 bits (1106), Expect = 2.866e-140
Identity = 233/520 (44.81%), Postives = 335/520 (64.42%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN-KSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRL 1526
            ++ +PH   C+C  C  S   D+LRHS  R++ Y+ALASP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN + +     E+      RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       ++  C  I +L P+ +  YL+ P+  LG F+R P +KFI H+AS+  FL L+L+AS H +  D+      ++GP P++VE +I+ WV+GF+W E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL+I A       KY   + PR SW    PTL++EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+     +          NN F TL  T ++L+W++FG+     I++ V + + +    T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLP P N + S K ++ L
Sbjct:  167 SVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDLN-----RQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFV-----KYSALN-PRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGIRCEKQNNAFSTLFETLQSLFWSIFGL-----INLYVTNVK-AQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYL 669          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC4 (transient receptor potential cation channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:12336])

HSP 1 Score: 431.024 bits (1107), Expect = 2.992e-140
Identity = 233/520 (44.81%), Postives = 335/520 (64.42%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN-KSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRL 1526
            ++ +PH   C+C  C  S   D+LRHS  R++ Y+ALASP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN + +     E+      RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       ++  C  I +L P+ +  YL+ P+  LG F+R P +KFI H+AS+  FL L+L+AS H +  D+      ++GP P++VE +I+ WV+GF+W E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL+I A       KY   + PR SW    PTL++EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+     +          NN F TL  T ++L+W++FG+     I++ V + + +    T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLP P N + S K ++ L
Sbjct:  167 SVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDLN-----RQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFV-----KYSALN-PRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGIRCEKQNNAFSTLFETLQSLFWSIFGL-----INLYVTNVK-AQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYL 669          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Match: TRPC5 (transient receptor potential cation channel subfamily C member 5 [Source:HGNC Symbol;Acc:HGNC:12337])

HSP 1 Score: 425.631 bits (1093), Expect = 2.568e-138
Identity = 237/534 (44.38%), Postives = 337/534 (63.11%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEILSFK-----RLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSP--FTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYF----LGNPN--------IHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLKT 1547
            TI +PH   C+C  C  S + D+LRHS  R++ Y+ALASP+ I L+S+DPIL AF+L  EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN  ++   H +E+   K     +LK+AIK+ QK FVA P+CQ+LL  +WY+  P W       +L  C+ I  L P+L+  YL+ P+  LG F++ P +KFI H+AS+  FL ++L+AS H    D+ +     +GP P++VE +I+ WV+GF+W E+K++W+ G   Y   WWN +DF M  LYL T+SL+I A       KY +   PR  W    PTLI+EALF+I+ + S  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+    +  PN          NN F TL  T ++L+W++FG+ ++   ++K           T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YFDEG TLPPP N + S K    L  +F  T
Sbjct:  167 TIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHRDD---HSEELDPQKYHDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFICHTASYLTFLFMLLLASQHIVRTDLHV-----QGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAY-----VKY-NGSRPREEWEMWHPTLIAEALFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARH------EFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFLYLGNWFNNT 680          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Match: trp-1 (Transient-receptor-potential-like protein [Source:UniProtKB/Swiss-Prot;Acc:P34586])

HSP 1 Score: 485.723 bits (1249), Expect = 2.774e-161
Identity = 254/552 (46.01%), Postives = 368/552 (66.67%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEI----LSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMP--EWSSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKF----INHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSK-WIYRLCVYFLKTSQRFVNLLKITYRKFRG 1598
            +IE+PH  SC C  C      D+L++SL+RI+T+RALASPAW+ LTS DPIL AFKLS +L +L+  E+EFKETYLQLS+QCK  +CDLL +CRS++EVI ILNK         ++    LS  RLKLAIK+EQK FV+HPHCQ+LL +IWY  +P  + S  +   FL   ++ L PI   +Y++ P+ +LG  +RSP +KF    ++ +    +          + + E   + R   RGP  + VE L+  WVIG +WSE+KQ+WEEG K Y RQWWNWLDF+M+CLYLCT+S+R++A ++   ++  ++   RT W S++P L++EALF++  VFSFARII+LFQ N +LGPLQISLG ML+D+ KF FIF+L+I+SF+ GL QLY+Y+  N ++          +N F ++  +Y  L W++F ++   + D+      V + +IT  V + + ++YH  ++IVL+NM IAMMS+SFQ I++HAD+EWK+ R+KLW+ +FDEG +LPPP N +++ K  IY +   F   + R++ L K TY+K R 
Sbjct:  189 SIEKPHRHSCICETCDRERLNDSLQYSLKRINTFRALASPAWMSLTSPDPILSAFKLSWDLQRLAFEEHEFKETYLQLSEQCKQYSCDLLSQCRSSEEVIAILNKDGNVNDDNIDVWASKLSLSRLKLAIKYEQKAFVSHPHCQQLLTSIWYEGIPYRQRSGTWANFFLYAFLLFLWPIFCLMYILMPKSRLGRLVRSPFMKFFYYSVSFATFLGLLTWATFEDYRYEKGERGGMTRASDRGPPATWVESLVFTWVIGMLWSEIKQLWEEGFKRYMRQWWNWLDFLMICLYLCTISIRLSAYYIFTYREDPYRYTVRTYWTSEEPMLVAEALFAVGNVFSFARIIYLFQTNPYLGPLQISLGCMLVDVAKFCFIFVLIISSFSIGLAQLYWYYDPNTDVCLPGATCKHSSNVFSSIADSYLTLLWSLFSITKPEDTDV------VENHKITQWVGQGMFIMYHCTSIIVLLNMLIAMMSHSFQIINDHADLEWKFHRTKLWMAHFDEGSSLPPPFNIIVTPKSLIYVMNCLF--NTVRWL-LGKYTYQKNRN 731          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Match: trp-1 (Transient-receptor-potential-like protein [Source:UniProtKB/Swiss-Prot;Acc:P34586])

HSP 1 Score: 485.723 bits (1249), Expect = 4.556e-161
Identity = 254/552 (46.01%), Postives = 368/552 (66.67%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEI----LSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMP--EWSSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKF----INHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSK-WIYRLCVYFLKTSQRFVNLLKITYRKFRG 1598
            +IE+PH  SC C  C      D+L++SL+RI+T+RALASPAW+ LTS DPIL AFKLS +L +L+  E+EFKETYLQLS+QCK  +CDLL +CRS++EVI ILNK         ++    LS  RLKLAIK+EQK FV+HPHCQ+LL +IWY  +P  + S  +   FL   ++ L PI   +Y++ P+ +LG  +RSP +KF    ++ +    +          + + E   + R   RGP  + VE L+  WVIG +WSE+KQ+WEEG K Y RQWWNWLDF+M+CLYLCT+S+R++A ++   ++  ++   RT W S++P L++EALF++  VFSFARII+LFQ N +LGPLQISLG ML+D+ KF FIF+L+I+SF+ GL QLY+Y+  N ++          +N F ++  +Y  L W++F ++   + D+      V + +IT  V + + ++YH  ++IVL+NM IAMMS+SFQ I++HAD+EWK+ R+KLW+ +FDEG +LPPP N +++ K  IY +   F   + R++ L K TY+K R 
Sbjct:  209 SIEKPHRHSCICETCDRERLNDSLQYSLKRINTFRALASPAWMSLTSPDPILSAFKLSWDLQRLAFEEHEFKETYLQLSEQCKQYSCDLLSQCRSSEEVIAILNKDGNVNDDNIDVWASKLSLSRLKLAIKYEQKAFVSHPHCQQLLTSIWYEGIPYRQRSGTWANFFLYAFLLFLWPIFCLMYILMPKSRLGRLVRSPFMKFFYYSVSFATFLGLLTWATFEDYRYEKGERGGMTRASDRGPPATWVESLVFTWVIGMLWSEIKQLWEEGFKRYMRQWWNWLDFLMICLYLCTISIRLSAYYIFTYREDPYRYTVRTYWTSEEPMLVAEALFAVGNVFSFARIIYLFQTNPYLGPLQISLGCMLVDVAKFCFIFVLIISSFSIGLAQLYWYYDPNTDVCLPGATCKHSSNVFSSIADSYLTLLWSLFSITKPEDTDV------VENHKITQWVGQGMFIMYHCTSIIVLLNMLIAMMSHSFQIINDHADLEWKFHRTKLWMAHFDEGSSLPPPFNIIVTPKSLIYVMNCLF--NTVRWL-LGKYTYQKNRN 751          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Match: trp-2 (TRP (Transient receptor potential) channel family; TRP homlogous cation channel protein [Source:UniProtKB/TrEMBL;Acc:G5EE02])

HSP 1 Score: 360.918 bits (925), Expect = 1.529e-115
Identity = 209/572 (36.54%), Postives = 323/572 (56.47%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEILSF------KRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSP---FTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXX-----XXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAAL------WLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNIHNNQF---------------------------GTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLKTSQRFVNLLKI 1577
            T+  PH   C C  C  + + D+LR S  RI+ YRAL SP+ ICL+++DPIL AF+LS EL +LS  ENEF+  Y +LS +C+     +L++ R +KE+  +LN +   + H+    ++       RLKLAI+  QK FVAHP+CQ+LL +IWY  +         +  +F  LG+ +  P+ + +YL+ P   +G F + P +KF++HS S       + +A   +    N      + R   RGP P+++E  I  WV+G +W E+KQ+WE G   Y R  WN LDFI   LYLCT +LR+ A        LR +  +  + LPR  W + DPTL+SE  F+ A +FS  +++ +F ++ HLGPL+ISLG+M+IDI+KF  ++ LV+ +FACGL+QL +Y+        N +                            ++  T + L+W +FG+  + +  +K +        ++    + +   Y   ++IVL+NM IAMMSNS+Q I + ADIEWK+ARS+L++ YFD+  TLPPP N + S K IY  C+++L  +++  N  K+
Sbjct:  168 TVPHPHDVRCSCPECYVAREEDSLRLSRSRINAYRALTSPSLICLSARDPILYAFELSWELKRLSFIENEFRTDYEELSQKCQKFCVHMLDQVRGSKELEVVLNHTTNAW-HDVTSANYGNPEKLARLKLAIQLSQKRFVAHPNCQQLLLDIWYEGVESVRCTNFIYKLIFYILGM-LSFPLFSLVYLLAPHSSMGQFAKKPFIKFLSHSGSYIFFLILLIMASQRMNVIDNILRTDDVDRKETRGPPPTIIECAIFLWVLGLIWVEIKQLWECGLYNYCRNLWNILDFITNSLYLCTTALRVVAYVQVEQEALRANSVHIARHLPRRDWDAWDPTLLSECFFATANIFSSLKLVHIFTVSPHLGPLKISLGRMVIDIVKFFMVYALVLFAFACGLNQLLWYYASMRQNECNLYEQYKNEKSLSYKYEHLKESCDDKYKSCSSIYHTAETLFWALFGLVDLTHFRLKEDHF------LSEWTGKTIFGSYCCCSIIVLLNMLIAMMSNSYQYISDQADIEWKFARSRLFLEYFDDTATLPPPFNIVPSPKSIY-YCLHYL--TKKLCNCTKL 728          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Match: trp-2 (TRP (Transient receptor potential) channel family; TRP homlogous cation channel protein [Source:UniProtKB/TrEMBL;Acc:G5EE02])

HSP 1 Score: 360.147 bits (923), Expect = 1.330e-114
Identity = 209/572 (36.54%), Postives = 323/572 (56.47%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEILSF------KRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSP---FTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXX-----XXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAAL------WLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNIHNNQF---------------------------GTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLKTSQRFVNLLKI 1577
            T+  PH   C C  C  + + D+LR S  RI+ YRAL SP+ ICL+++DPIL AF+LS EL +LS  ENEF+  Y +LS +C+     +L++ R +KE+  +LN +   + H+    ++       RLKLAI+  QK FVAHP+CQ+LL +IWY  +         +  +F  LG+ +  P+ + +YL+ P   +G F + P +KF++HS S       + +A   +    N      + R   RGP P+++E  I  WV+G +W E+KQ+WE G   Y R  WN LDFI   LYLCT +LR+ A        LR +  +  + LPR  W + DPTL+SE  F+ A +FS  +++ +F ++ HLGPL+ISLG+M+IDI+KF  ++ LV+ +FACGL+QL +Y+        N +                            ++  T + L+W +FG+  + +  +K +        ++    + +   Y   ++IVL+NM IAMMSNS+Q I + ADIEWK+ARS+L++ YFD+  TLPPP N + S K IY  C+++L  +++  N  K+
Sbjct:  168 TVPHPHDVRCSCPECYVAREEDSLRLSRSRINAYRALTSPSLICLSARDPILYAFELSWELKRLSFIENEFRTDYEELSQKCQKFCVHMLDQVRGSKELEVVLNHTTNAW-HDVTSANYGNPEKLARLKLAIQLSQKRFVAHPNCQQLLLDIWYEGVESVRCTNFIYKLIFYILGM-LSFPLFSLVYLLAPHSSMGQFAKKPFIKFLSHSGSYIFFLILLIMASQRMNVIDNILRTDDVDRKETRGPPPTIIECAIFLWVLGLIWVEIKQLWECGLYNYCRNLWNILDFITNSLYLCTTALRVVAYVQVEQEALRANSVHIARHLPRRDWDAWDPTLLSECFFATANIFSSLKLVHIFTVSPHLGPLKISLGRMVIDIVKFFMVYALVLFAFACGLNQLLWYYASMRQNECNLYEQYKNEKSLSYKYEHLKESCDDKYKSCSSIYHTAETLFWALFGLVDLTHFRLKEDHF------LSEWTGKTIFGSYCCCSIIVLLNMLIAMMSNSYQYISDQADIEWKFARSRLFLEYFDDTATLPPPFNIVPSPKSIY-YCLHYL--TKKLCNCTKL 728          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Match: spe-41 (TRP homologous cation channel protein; TRP-3 channel protein [Source:UniProtKB/TrEMBL;Acc:G5EF09])

HSP 1 Score: 101.293 bits (251), Expect = 2.510e-22
Identity = 101/489 (20.65%), Postives = 213/489 (43.56%), Query Frame = 3
Query:  135 LTSQDPILDAFKLSVELSKLSSCEN-EFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEI-LSFKRLKLAIKFEQKHFVAHPHCQKLLNNI----WYNSMPEWSSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHN------ESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNIH---------NNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVS----SARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLN-TLISSKWIYR 1523
            L + D       ++ +L +L+S +  E+ ETY  L    +   C + ++     E   ++  +N  YC E+   +S  RL++A+  + + F    + Q  + ++    WYN   +   P    +  L   IL+P L  ++   P    GT +  PL +FI H   + +FL   ++           +S ++ +            +E  +  +V+G    +    +  G   +   WW W D  ++ ++L ++         R  + +    + R  WPS + +L+ E   +IA V S  +  +  Q+ + +G   IS+GK +     +  I + +I SF+ GL+ +   +L    +           + + T+ ++ KNL+W++FG          V +T  +       +  +  E L  VYH + +I ++N+  +++      + ++ ++E+K+ R+ ++  +       PPPLN  L+ + +++R
Sbjct:   67 LATDDVFAATCAVARDLQQLASDDQLEYVETYRDLEMNVQRFLCRISDQAWRVDEFNMMV--ANRNYCPERMTEISSPRLQMAMDSQMRQFTCSTNSQTTIKSVFRSDWYNYGIK---PKRDAWRFLRACILMPFLVMLHAFMPTK--GTTMCVPLARFIAHITMYLVFLIAAILRPTIGFYFAWTDSIEVTV----------QALEIFMYAYVMGLALEKGILFYRVGRDGFFAFWWRWFDAALIFIFLFSLIFFTGKWGKR--EAFDPSSVDRMHWPSFEFSLLHEICLAIACVLSILKCFYYAQMMKSIGGSVISVGKCVGKTYTYILIMVAIIVSFSVGLNIIVDPYLNRSTMKIGDQDYTKTTDSYETIGTSSKNLFWSIFGYLGPSTFTTVVGNTGPNMDPVKHTLNSSTFEILAAVYHGILIITVLNLMTSILVKGADEVLDNEEMEFKFTRAAIYSEFLSWEMAAPPPLNLILVVAHFVHR 536          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: trpl (gene:FBgn0005614 transcript:FBtr0088471)

HSP 1 Score: 367.851 bits (943), Expect = 2.412e-115
Identity = 211/553 (38.16%), Postives = 316/553 (57.14%), Query Frame = 3
Query:   15 PHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHE-KEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEW--SSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKI------------MRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDL---PRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFL--------------------GNPNIHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLL-VYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLKTSQR 1556
            PH   C C  C      D+LRHSL R++ YRAL SP+ ICLTS DPI+ AF+LS EL  L+  E E K  Y+ L  QC+  A DLL++ R++ E+  ILN   +   +E  + +S  RL  AI ++QK FVAH + Q+LL++IWY+ +P +   S   ++     + +L P+   IY+  P  + G  +R P +KF+ H++S+  FL ++++ S   + + ++I                +RG  PS +E ++V +VIGFVW EV++I+  G K+Y R  WN++DF+   LY+  + LR  A   + ++      +   PR  W   DP LI+E LF+ A VFS  +++ LF IN HLGPLQISLG+M+IDI+KF FI+ LV+ +FACGL+QL +YF                     G+  +   +FG L  + ++L+W  FG+       + ++D  +S  +        L+   Y  + VIVL+N+ IAMMSNS+  I  H+D EWK+AR+KLW+ YF++  TLPPP N L S KW+ R+     KT  R
Sbjct:  182 PHDIRCGCEECVRLTAEDSLRHSLSRVNIYRALCSPSLICLTSNDPIITAFQLSWELRNLALTEQECKSEYMDLRRQCQKFAVDLLDQTRTSNELAIILNYDPQMSSYEPGDRMSLTRLVQAISYKQKKFVAHSNIQQLLSSIWYDGLPGFRRKSIVDKVICIAQVAVLFPLYCLIYMCAPNCRTGQLMRKPFMKFLIHASSYLFFLFILILVSQRADDDFVRIFGTTRMKKELAEQELRQRGQTPSKLELIVVMYVIGFVWEEVQEIFAVGMKSYLRNMWNFIDFLRNSLYVSVMCLRAFAYIQQATEIARDPQMAYIPREKWHDFDPQLIAEGLFAAANVFSALKLVHLFSINPHLGPLQISLGRMVIDIVKFFFIYTLVLFAFACGLNQLLWYFAALEKSKCYVLPGGEADWGSHGDSCMKWRRFGNLFESSQSLFWASFGM-------VGLDDFELSGIKSYTRFWGLLMFGSYSVINVIVLLNLLIAMMSNSYAMIDEHSDTEWKFARTKLWMSYFEDSATLPPPFNVLPSVKWVIRIFRKSSKTIDR 727          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: trpl (gene:FBgn0005614 transcript:FBtr0301662)

HSP 1 Score: 367.851 bits (943), Expect = 2.412e-115
Identity = 211/553 (38.16%), Postives = 316/553 (57.14%), Query Frame = 3
Query:   15 PHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHE-KEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEW--SSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKI------------MRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDL---PRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFL--------------------GNPNIHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLL-VYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLKTSQR 1556
            PH   C C  C      D+LRHSL R++ YRAL SP+ ICLTS DPI+ AF+LS EL  L+  E E K  Y+ L  QC+  A DLL++ R++ E+  ILN   +   +E  + +S  RL  AI ++QK FVAH + Q+LL++IWY+ +P +   S   ++     + +L P+   IY+  P  + G  +R P +KF+ H++S+  FL ++++ S   + + ++I                +RG  PS +E ++V +VIGFVW EV++I+  G K+Y R  WN++DF+   LY+  + LR  A   + ++      +   PR  W   DP LI+E LF+ A VFS  +++ LF IN HLGPLQISLG+M+IDI+KF FI+ LV+ +FACGL+QL +YF                     G+  +   +FG L  + ++L+W  FG+       + ++D  +S  +        L+   Y  + VIVL+N+ IAMMSNS+  I  H+D EWK+AR+KLW+ YF++  TLPPP N L S KW+ R+     KT  R
Sbjct:  182 PHDIRCGCEECVRLTAEDSLRHSLSRVNIYRALCSPSLICLTSNDPIITAFQLSWELRNLALTEQECKSEYMDLRRQCQKFAVDLLDQTRTSNELAIILNYDPQMSSYEPGDRMSLTRLVQAISYKQKKFVAHSNIQQLLSSIWYDGLPGFRRKSIVDKVICIAQVAVLFPLYCLIYMCAPNCRTGQLMRKPFMKFLIHASSYLFFLFILILVSQRADDDFVRIFGTTRMKKELAEQELRQRGQTPSKLELIVVMYVIGFVWEEVQEIFAVGMKSYLRNMWNFIDFLRNSLYVSVMCLRAFAYIQQATEIARDPQMAYIPREKWHDFDPQLIAEGLFAAANVFSALKLVHLFSINPHLGPLQISLGRMVIDIVKFFFIYTLVLFAFACGLNQLLWYFAALEKSKCYVLPGGEADWGSHGDSCMKWRRFGNLFESSQSLFWASFGM-------VGLDDFELSGIKSYTRFWGLLMFGSYSVINVIVLLNLLIAMMSNSYAMIDEHSDTEWKFARTKLWMSYFEDSATLPPPFNVLPSVKWVIRIFRKSSKTIDR 727          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: trpl (gene:FBgn0005614 transcript:FBtr0088473)

HSP 1 Score: 367.851 bits (943), Expect = 2.412e-115
Identity = 211/553 (38.16%), Postives = 316/553 (57.14%), Query Frame = 3
Query:   15 PHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHE-KEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEW--SSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKI------------MRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDL---PRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFL--------------------GNPNIHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLL-VYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLKTSQR 1556
            PH   C C  C      D+LRHSL R++ YRAL SP+ ICLTS DPI+ AF+LS EL  L+  E E K  Y+ L  QC+  A DLL++ R++ E+  ILN   +   +E  + +S  RL  AI ++QK FVAH + Q+LL++IWY+ +P +   S   ++     + +L P+   IY+  P  + G  +R P +KF+ H++S+  FL ++++ S   + + ++I                +RG  PS +E ++V +VIGFVW EV++I+  G K+Y R  WN++DF+   LY+  + LR  A   + ++      +   PR  W   DP LI+E LF+ A VFS  +++ LF IN HLGPLQISLG+M+IDI+KF FI+ LV+ +FACGL+QL +YF                     G+  +   +FG L  + ++L+W  FG+       + ++D  +S  +        L+   Y  + VIVL+N+ IAMMSNS+  I  H+D EWK+AR+KLW+ YF++  TLPPP N L S KW+ R+     KT  R
Sbjct:  182 PHDIRCGCEECVRLTAEDSLRHSLSRVNIYRALCSPSLICLTSNDPIITAFQLSWELRNLALTEQECKSEYMDLRRQCQKFAVDLLDQTRTSNELAIILNYDPQMSSYEPGDRMSLTRLVQAISYKQKKFVAHSNIQQLLSSIWYDGLPGFRRKSIVDKVICIAQVAVLFPLYCLIYMCAPNCRTGQLMRKPFMKFLIHASSYLFFLFILILVSQRADDDFVRIFGTTRMKKELAEQELRQRGQTPSKLELIVVMYVIGFVWEEVQEIFAVGMKSYLRNMWNFIDFLRNSLYVSVMCLRAFAYIQQATEIARDPQMAYIPREKWHDFDPQLIAEGLFAAANVFSALKLVHLFSINPHLGPLQISLGRMVIDIVKFFFIYTLVLFAFACGLNQLLWYFAALEKSKCYVLPGGEADWGSHGDSCMKWRRFGNLFESSQSLFWASFGM-------VGLDDFELSGIKSYTRFWGLLMFGSYSVINVIVLLNLLIAMMSNSYAMIDEHSDTEWKFARTKLWMSYFEDSATLPPPFNVLPSVKWVIRIFRKSSKTIDR 727          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0080945)

HSP 1 Score: 363.229 bits (931), Expect = 1.567e-113
Identity = 218/550 (39.64%), Postives = 318/550 (57.82%), Query Frame = 3
Query:   15 PHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHE-KEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPFTRLFLCLGIV------ILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXH-----------NESEDIKIMRFI--KRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALW-LRLSQKYGHQ--DLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYF----------------LGNPNIHNN--------QFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLL-VYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIY 1520
            PH   C C  C +S Q D+LRHS  RI+ YRALASP+ I L+S+DPIL AF+LS EL +LS  E+EFK  Y +L  QC+  A  LL+  R++ E+  +LN       +E  E +   RLKLAIK  QK FVAH + Q+LL +IWY  +P     F R  + L  V      I+ PI +  Y++ P   +G  +R P +KFI HSAS+  FL L+++AS             + S  +  M  +  KRG +P+ +E LI+ WV G +WSEVKQ+W+ G + Y    WN +DF+   LY+ TV+LR+ + + ++    Y     DLPR  W + DP LISE LFS A +FS  +++++F +N HLGPLQ+SL +M++DI+KF F+++LV+ +F  GL+QL +Y+                L N N  N+        +F  L  T + L+W +FG+       I ++   +   +I       L+   Y  + ++VL+N+ IAMM++S+Q I   AD+EWK+ARSKLWI YF+EG T PPP N + + K I+
Sbjct:  161 PHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTRTSHELEILLNHDPTGPVYEHGERMHLNRLKLAIKLRQKKFVAHSNVQQLLASIWYEGLP----GFRRKNMALQAVDIIRIGIMFPIFSLAYILAPYSSIGQTMRKPFIKFICHSASYFTFLFLLMLASQRIETFIGGWFFADSSGMLNTMEELPTKRGAKPTFIEWLILAWVSGLIWSEVKQLWDVGLQEYLNDMWNVIDFVTNSLYVATVALRVVSFFQVQKEMIYNSHATDLPRERWDAWDPMLISEGLFSAANIFSSLKLVYIFSVNPHLGPLQVSLSRMVMDIMKFFFLYVLVLFAFGSGLNQLLWYYADLEKKRCPEVSPMSALLNMNGTNDPNACIVWRRFSNLFETTQTLFWAVFGL-------IDLDSFELDGIKIFTRFWGMLMFGTYSVINIVVLLNLLIAMMNHSYQLISERADVEWKFARSKLWISYFEEGGTCPPPFNIIPTPKSIW 699          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0080946)

HSP 1 Score: 363.229 bits (931), Expect = 1.567e-113
Identity = 218/550 (39.64%), Postives = 318/550 (57.82%), Query Frame = 3
Query:   15 PHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHE-KEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPFTRLFLCLGIV------ILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXH-----------NESEDIKIMRFI--KRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALW-LRLSQKYGHQ--DLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYF----------------LGNPNIHNN--------QFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLL-VYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIY 1520
            PH   C C  C +S Q D+LRHS  RI+ YRALASP+ I L+S+DPIL AF+LS EL +LS  E+EFK  Y +L  QC+  A  LL+  R++ E+  +LN       +E  E +   RLKLAIK  QK FVAH + Q+LL +IWY  +P     F R  + L  V      I+ PI +  Y++ P   +G  +R P +KFI HSAS+  FL L+++AS             + S  +  M  +  KRG +P+ +E LI+ WV G +WSEVKQ+W+ G + Y    WN +DF+   LY+ TV+LR+ + + ++    Y     DLPR  W + DP LISE LFS A +FS  +++++F +N HLGPLQ+SL +M++DI+KF F+++LV+ +F  GL+QL +Y+                L N N  N+        +F  L  T + L+W +FG+       I ++   +   +I       L+   Y  + ++VL+N+ IAMM++S+Q I   AD+EWK+ARSKLWI YF+EG T PPP N + + K I+
Sbjct:  161 PHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTRTSHELEILLNHDPTGPVYEHGERMHLNRLKLAIKLRQKKFVAHSNVQQLLASIWYEGLP----GFRRKNMALQAVDIIRIGIMFPIFSLAYILAPYSSIGQTMRKPFIKFICHSASYFTFLFLLMLASQRIETFIGGWFFADSSGMLNTMEELPTKRGAKPTFIEWLILAWVSGLIWSEVKQLWDVGLQEYLNDMWNVIDFVTNSLYVATVALRVVSFFQVQKEMIYNSHATDLPRERWDAWDPMLISEGLFSAANIFSSLKLVYIFSVNPHLGPLQVSLSRMVMDIMKFFFLYVLVLFAFGSGLNQLLWYYADLEKKRCPEVSPMSALLNMNGTNDPNACIVWRRFSNLFETTQTLFWAVFGL-------IDLDSFELDGIKIFTRFWGMLMFGTYSVINIVVLLNLLIAMMNHSYQLISERADVEWKFARSKLWISYFEEGGTCPPPFNIIPTPKSIW 699          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 430.254 bits (1105), Expect = 6.095e-141
Identity = 233/517 (45.07%), Postives = 340/517 (65.76%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN-KSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWI 1517
            ++ QPH   C+C  C  S   D+LRHS  R++ Y+ALASP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN + +     ++      RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       +L  C+ I ++ P+L+  YLV P+ + G F+R P +KFI H+AS+  FL L+L+AS H  S +       ++GP+P+ VE +I+ WV+GF+W+E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL+I A +++ S   G +  PR +W    PTL++EA+F+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+  +  +          NN F TL  T ++L+W++FG+ S+   ++K +       + T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLPPP N + S K I
Sbjct:  167 SVPQPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKAEYEELSHQCKHFAKDLLDQTRSSRELELILNFRDDMNLLQDEANNELARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAGKLITCVFIGLMFPLLSLCYLVAPKSRYGLFIRKPFIKFICHTASYLTFLFLLLLASQHIVSNNPD-----RQGPKPTTVEWMILPWVLGFIWTEIKQMWDGGFQDYIHDWWNLMDFVMNSLYLATISLKIVA-YVKYS---GCK--PRDTWEMWHPTLVAEAVFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYENSEGMTCKGIRCERQNNAFSTLFETLQSLFWSIFGLISLYVTNVKADH------KFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQHIADHADIEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSI 666          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 430.254 bits (1105), Expect = 6.095e-141
Identity = 233/517 (45.07%), Postives = 340/517 (65.76%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN-KSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWI 1517
            ++ QPH   C+C  C  S   D+LRHS  R++ Y+ALASP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN + +     ++      RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       +L  C+ I ++ P+L+  YLV P+ + G F+R P +KFI H+AS+  FL L+L+AS H  S +       ++GP+P+ VE +I+ WV+GF+W+E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL+I A +++ S   G +  PR +W    PTL++EA+F+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+  +  +          NN F TL  T ++L+W++FG+ S+   ++K +       + T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLPPP N + S K I
Sbjct:  167 SVPQPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKAEYEELSHQCKHFAKDLLDQTRSSRELELILNFRDDMNLLQDEANNELARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAGKLITCVFIGLMFPLLSLCYLVAPKSRYGLFIRKPFIKFICHTASYLTFLFLLLLASQHIVSNNPD-----RQGPKPTTVEWMILPWVLGFIWTEIKQMWDGGFQDYIHDWWNLMDFVMNSLYLATISLKIVA-YVKYS---GCK--PRDTWEMWHPTLVAEAVFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYENSEGMTCKGIRCERQNNAFSTLFETLQSLFWSIFGLISLYVTNVKADH------KFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQHIADHADIEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSI 666          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc5a (transient receptor potential cation channel, subfamily C, member 5a [Source:ZFIN;Acc:ZDB-GENE-040812-1])

HSP 1 Score: 431.795 bits (1109), Expect = 2.882e-140
Identity = 235/525 (44.76%), Postives = 336/525 (64.00%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKY--CHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYF----LGNPN--------IHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLC 1529
            TI +PH   C C  C  S + D+LRHS  R++ Y+ALASP+ I L+S+DPIL AF+L  EL +LS  ENEF++ Y +LS QCK  A DLL++ RS++E+  ILN  +++      +E     +LKLAIK+ QK FVA P+CQ+LL  +WY+  P W       +L +C  I +L P+ + +YL+ P+  LG F++ P +KFI H+AS+  FL L+L+AS H    ++ +     +GP P++VE +I+ WV+GF+W+E+K++W+ G   Y   WWN +DF M  LYL T+SL+I A       KY +   PR  W    PTLI+EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+       PN          NN F TL  T ++L+W++FG+ ++   ++K           T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YFDEG TLPPP N + S K  + LC
Sbjct:  167 TIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQARSSRELETILNHRDDQSEELDPRECRDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRRHWAVKLVMCFIIGLLFPVFSLVYLLAPKSTLGLFIKKPFIKFICHTASYLTFLFLLLLASQHIARTNLHM-----QGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFNEYVHDWWNLMDFAMNSLYLATISLKIVAY-----VKY-NSSRPREEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETEAADEPNHCKGIRCERQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARH------EFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFWYLC 674          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc5a (transient receptor potential cation channel, subfamily C, member 5a [Source:ZFIN;Acc:ZDB-GENE-040812-1])

HSP 1 Score: 431.795 bits (1109), Expect = 3.031e-140
Identity = 235/525 (44.76%), Postives = 336/525 (64.00%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKY--CHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYF----LGNPN--------IHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLC 1529
            TI +PH   C C  C  S + D+LRHS  R++ Y+ALASP+ I L+S+DPIL AF+L  EL +LS  ENEF++ Y +LS QCK  A DLL++ RS++E+  ILN  +++      +E     +LKLAIK+ QK FVA P+CQ+LL  +WY+  P W       +L +C  I +L P+ + +YL+ P+  LG F++ P +KFI H+AS+  FL L+L+AS H    ++ +     +GP P++VE +I+ WV+GF+W+E+K++W+ G   Y   WWN +DF M  LYL T+SL+I A       KY +   PR  W    PTLI+EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+       PN          NN F TL  T ++L+W++FG+ ++   ++K           T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YFDEG TLPPP N + S K  + LC
Sbjct:  170 TIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQARSSRELETILNHRDDQSEELDPRECRDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRRHWAVKLVMCFIIGLLFPVFSLVYLLAPKSTLGLFIKKPFIKFICHTASYLTFLFLLLLASQHIARTNLHM-----QGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFNEYVHDWWNLMDFAMNSLYLATISLKIVAY-----VKY-NSSRPREEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETEAADEPNHCKGIRCERQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARH------EFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFWYLC 677          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Match: trpc5a (transient receptor potential cation channel, subfamily C, member 5a [Source:ZFIN;Acc:ZDB-GENE-040812-1])

HSP 1 Score: 431.795 bits (1109), Expect = 3.732e-140
Identity = 235/525 (44.76%), Postives = 336/525 (64.00%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKY--CHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYF----LGNPN--------IHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLC 1529
            TI +PH   C C  C  S + D+LRHS  R++ Y+ALASP+ I L+S+DPIL AF+L  EL +LS  ENEF++ Y +LS QCK  A DLL++ RS++E+  ILN  +++      +E     +LKLAIK+ QK FVA P+CQ+LL  +WY+  P W       +L +C  I +L P+ + +YL+ P+  LG F++ P +KFI H+AS+  FL L+L+AS H    ++ +     +GP P++VE +I+ WV+GF+W+E+K++W+ G   Y   WWN +DF M  LYL T+SL+I A       KY +   PR  W    PTLI+EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+       PN          NN F TL  T ++L+W++FG+ ++   ++K           T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YFDEG TLPPP N + S K  + LC
Sbjct:  170 TIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQARSSRELETILNHRDDQSEELDPRECRDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRRHWAVKLVMCFIIGLLFPVFSLVYLLAPKSTLGLFIKKPFIKFICHTASYLTFLFLLLLASQHIARTNLHM-----QGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFNEYVHDWWNLMDFAMNSLYLATISLKIVAY-----VKY-NSSRPREEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETEAADEPNHCKGIRCERQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARH------EFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFWYLC 677          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: TRPC5 (transient receptor potential cation channel, subfamily C, member 5 [Source:NCBI gene;Acc:100493720])

HSP 1 Score: 428.713 bits (1101), Expect = 1.031e-139
Identity = 233/530 (43.96%), Postives = 336/530 (63.40%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNE-------KYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGN----PN--------IHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLC 1529
            TI +PH   C+C  C  S + D+LRHS  R++ Y+ALASP+ I L+S+DPIL AF+L  EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN  ++       + CH+       +LK+AIK+ QK FVA P+CQ+LL  +WY+  P W       +L  C+ I +L P+L+  YL+ P+ +LG F++ P +KFI H+AS+  FL L+L+AS H    ++ +     +GP P++VE +I+ WV+GF+W E+K++W+ G   Y   WWN +DF M  LYL T+SL+I A       KY     PR  W    PTLI+EA F+I+ + S  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+  +    PN          NN F TL  T ++L+W++FG+ ++   ++K      +    T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YFDEG T+PPP N + S K I+  C
Sbjct:  167 TIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKKFAKDLLDQARSSRELEIILNHRDDQSEELDPQKCHD-----LAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWAVKLVTCITIGLLFPVLSVAYLIAPKSRLGLFIKKPFIKFICHTASYLTFLFLLLLASQHIVRTELHM-----QGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFNEYVHDWWNLMDFAMNSLYLATISLKIVAY-----VKYNGSK-PREEWDMWHPTLIAEAFFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETSASEEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVK------ARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGATMPPPFNIIASPKSIWYFC 674          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: hint1 (histidine triad nucleotide binding protein 1 [Source:Xenbase;Acc:XB-GENE-1014427])

HSP 1 Score: 414.461 bits (1064), Expect = 3.265e-134
Identity = 227/530 (42.83%), Postives = 330/530 (62.26%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN-KSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSP--FTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXH-NESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI----------HNNQFGTLVSTYKNLYWNMFGVSS--IPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLK 1544
            ++ +PH   C+C  C      D+LRHS  R++ YRAL+SP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN + +     +       RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       ++  C+ + +L P  +  YL+ P+   G F+R P +KFI H+AS+  FL L+L+AS + N++E ++       GP P++VE +I+ WV+GF+W E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL+I A   R           R  W    PTL++EA+F+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+  +              NN F TL  T ++L+W++FG+ +  + N+D K           T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLP P N + S K ++ L  +  K
Sbjct:  167 SVPRPHEVRCNCVECVSGSDVDSLRHSRSRLNIYRALSSPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSSQCKQFAKDLLDQTRSSRELEIILNYRDDGGLLDDSNGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWVVKMVTCVIVGLLFPAFSCCYLIAPKSTFGLFIRKPFIKFICHTASYLTFLFLLLLASQNINKTESLQ-------GPAPTIVEWMILPWVLGFIWGEIKQMWDGGFQDYIHDWWNLMDFVMNSLYLATISLKIVAYVKR----------NRAEWEMFHPTLVAEAVFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEADAKSSDCKGIRCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVDPK--------HEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNIIPSPKSLWYLIKWIRK 671          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 367.851 bits (943), Expect = 8.057e-118
Identity = 216/537 (40.22%), Postives = 306/537 (56.98%), Query Frame = 3
Query:    6 IEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEIL---SFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPFT--RLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXH---------NES-EDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALW-LRLSQKYGHQD-------------------LPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNIHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSK 1511
            IE+PH   C C  C E  + D+  HS  RI+ Y+ LASPA++ L+S+DP++ A +LS EL+ L++ E EFK  Y +LS QCK     LL+ CR+ +EV  ILN   +      E+    S  RLKLAIK+E K FVAHP+CQ+ L +IWY ++       T  +  + L + + LP LA +Y + P  KLG  +R P +KF+ H+ASF IFL L+++ +A          NES  D     F  +    S +E LI+ WVIG +WSE K+IW +G + Y  + WN LDF ML ++  +   R  A W    +Q Y   D                   L R  W   DP +ISE L++IA+V SF+RI ++   NE  GPLQISLG+ + DI KF  IF++V  +F  G+  LY Y+LG     N+ F T+  ++K L+W +FG+S + ++ I      + +      +   L  VY+   VIVL+NM IAM++NSFQ I + AD+EWK+AR+KLW  YF+EG TLP P N + S K
Sbjct:  174 IERPHDYFCKCTECSEKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVDTNGGNVELDGRPSLCRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTTAVKFLVVLAVAMGLPFLAMVYWIAPCSKLGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKILPNESLTDNAKQLFRMKTSCFSWMELLIISWVIGMIWSECKEIWSQGPREYMFELWNILDFGMLAIFAASFIARFMAFWHASRAQNYVDDDESIKDLSSATLPPEIKYYTLARIKWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYLGAK--QNDAFTTVEESFKTLFWAIFGLSEVKSVVINYGHKFIEN------IGYVLYGVYNVTMVIVLLNMLIAMINNSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPK 702          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 367.466 bits (942), Expect = 9.490e-118
Identity = 216/537 (40.22%), Postives = 306/537 (56.98%), Query Frame = 3
Query:    6 IEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEIL---SFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPFT--RLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXH---------NES-EDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALW-LRLSQKYGHQD-------------------LPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNIHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSK 1511
            IE+PH   C C  C E  + D+  HS  RI+ Y+ LASPA++ L+S+DP++ A +LS EL+ L++ E EFK  Y +LS QCK     LL+ CR+ +EV  ILN   +      E+    S  RLKLAIK+E K FVAHP+CQ+ L +IWY ++       T  +  + L + + LP LA +Y + P  KLG  +R P +KF+ H+ASF IFL L+++ +A          NES  D     F  +    S +E LI+ WVIG +WSE K+IW +G + Y  + WN LDF ML ++  +   R  A W    +Q Y   D                   L R  W   DP +ISE L++IA+V SF+RI ++   NE  GPLQISLG+ + DI KF  IF++V  +F  G+  LY Y+LG     N+ F T+  ++K L+W +FG+S + ++ I      + +      +   L  VY+   VIVL+NM IAM++NSFQ I + AD+EWK+AR+KLW  YF+EG TLP P N + S K
Sbjct:  170 IERPHDYFCKCTECSEKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVDTNGGNVELDGRPSLCRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTTAVKFLVVLAVAMGLPFLAMVYWIAPCSKLGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKILPNESLTDNAKQLFRMKTSCFSWMELLIISWVIGMIWSECKEIWSQGPREYMFELWNILDFGMLAIFAASFIARFMAFWHASRAQNYVDDDESIKDLSSATLPPEIKYYTLARIKWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYLGAK--QNDAFTTVEESFKTLFWAIFGLSEVKSVVINYGHKFIEN------IGYVLYGVYNVTMVIVLLNMLIAMINNSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPK 698          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 366.696 bits (940), Expect = 3.786e-117
Identity = 216/537 (40.22%), Postives = 306/537 (56.98%), Query Frame = 3
Query:    6 IEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEIL---SFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPFT--RLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXH---------NES-EDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALW-LRLSQKYGHQD-------------------LPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNIHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSK 1511
            IE+PH   C C  C E  + D+  HS  RI+ Y+ LASPA++ L+S+DP++ A +LS EL+ L++ E EFK  Y +LS QCK     LL+ CR+ +EV  ILN   +      E+    S  RLKLAIK+E K FVAHP+CQ+ L +IWY ++       T  +  + L + + LP LA +Y + P  KLG  +R P +KF+ H+ASF IFL L+++ +A          NES  D     F  +    S +E LI+ WVIG +WSE K+IW +G + Y  + WN LDF ML ++  +   R  A W    +Q Y   D                   L R  W   DP +ISE L++IA+V SF+RI ++   NE  GPLQISLG+ + DI KF  IF++V  +F  G+  LY Y+LG     N+ F T+  ++K L+W +FG+S + ++ I      + +      +   L  VY+   VIVL+NM IAM++NSFQ I + AD+EWK+AR+KLW  YF+EG TLP P N + S K
Sbjct:  191 IERPHDYFCKCTECSEKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVDTNGGNVELDGRPSLCRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTTAVKFLVVLAVAMGLPFLAMVYWIAPCSKLGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKILPNESLTDNAKQLFRMKTSCFSWMELLIISWVIGMIWSECKEIWSQGPREYMFELWNILDFGMLAIFAASFIARFMAFWHASRAQNYVDDDESIKDLSSATLPPEIKYYTLARIKWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYLGAK--QNDAFTTVEESFKTLFWAIFGLSEVKSVVINYGHKFIEN------IGYVLYGVYNVTMVIVLLNMLIAMINNSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPK 719          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc4 (transient receptor potential cation channel, subfamily C, member 4 [Source:MGI Symbol;Acc:MGI:109525])

HSP 1 Score: 430.639 bits (1106), Expect = 3.059e-141
Identity = 233/520 (44.81%), Postives = 335/520 (64.42%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN-KSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRL 1526
            ++ +PH   C+C  C  S   D+LRHS  R++ Y+ALASP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN + +     E+      RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       ++  C  I +L P+ +  YL+ P+  LG F+R P +KFI H+AS+  FL L+L+AS H +  D+      ++GP P++VE +I+ WV+GF+W E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL+I A       KY   + PR SW    PTL++EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+     +          NN F TL  T ++L+W++FG+     I++ V + + +    T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLP P N + S K ++ L
Sbjct:  167 SVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDLN-----RQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAF-----VKYSALN-PRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLSCKGIRCEKQNNAFSTLFETLQSLFWSIFGL-----INLYVTNVK-AQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYL 669          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc4 (transient receptor potential cation channel, subfamily C, member 4 [Source:MGI Symbol;Acc:MGI:109525])

HSP 1 Score: 431.409 bits (1108), Expect = 1.184e-140
Identity = 233/520 (44.81%), Postives = 335/520 (64.42%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN-KSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRL 1526
            ++ +PH   C+C  C  S   D+LRHS  R++ Y+ALASP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN + +     E+      RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       ++  C  I +L P+ +  YL+ P+  LG F+R P +KFI H+AS+  FL L+L+AS H +  D+      ++GP P++VE +I+ WV+GF+W E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL+I A       KY   + PR SW    PTL++EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+     +          NN F TL  T ++L+W++FG+     I++ V + + +    T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLP P N + S K ++ L
Sbjct:  167 SVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDLN-----RQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFV-----KYSALN-PRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLSCKGIRCEKQNNAFSTLFETLQSLFWSIFGL-----INLYVTNVK-AQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYL 669          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc5 (transient receptor potential cation channel, subfamily C, member 5 [Source:MGI Symbol;Acc:MGI:109524])

HSP 1 Score: 425.631 bits (1093), Expect = 1.809e-138
Identity = 237/534 (44.38%), Postives = 337/534 (63.11%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEILSFK-----RLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSP--FTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYF----LGNPN--------IHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLKT 1547
            TI +PH   C+C  C  S + D+LRHS  R++ Y+ALASP+ I L+S+DPIL AF+L  EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN  ++   H +E+   K     +LK+AIK+ QK FVA P+CQ+LL  +WY+  P W       +L  C+ I  L P+L+  YL+ P+  LG F++ P +KFI H+AS+  FL ++L+AS H    D+ +     +GP P++VE +I+ WV+GF+W E+K++W+ G   Y   WWN +DF M  LYL T+SL+I A       KY +   PR  W    PTLI+EALF+I+ + S  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+    +  PN          NN F TL  T ++L+W++FG+ ++   ++K           T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YFDEG TLPPP N + S K    L  +F  T
Sbjct:  167 TIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHRDD---HSEELDPQKYHDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFICHTASYLTFLFMLLLASQHIVRTDLHV-----QGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAY-----VKY-NGSRPREEWEMWHPTLIAEALFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARH------EFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFLYLGNWFNNT 680          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc7 (transient receptor potential cation channel, subfamily C, member 7 [Source:MGI Symbol;Acc:MGI:1349470])

HSP 1 Score: 365.54 bits (937), Expect = 1.587e-116
Identity = 213/543 (39.23%), Postives = 314/543 (57.83%), Query Frame = 3
Query:    6 IEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKS-NEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMP--EWSSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXH---------NES-EDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQD------------LP---------RTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNIHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCV 1532
            IE+PH   C C+ C E  ++D+  HS  R++ Y+ LAS A++ L+S+DP+L A +LS EL++L++ E EFK  Y +LS QCK     +L+ CR  +EV  ILN   N +   +    S  R+KLAIK+E K FVAHP+CQ+ L  +WY ++      S   +     G+ I LP LA  Y + P  KLG  LRSP +KF+ H+ SF IFL L+++ ++          NE+  D     F  +  + S  E LI+ WV+G +WSE K+IWEEG + Y    WN LDF ML +++ + + R  A +L+ S+   + D            LP         R  W   DP +ISE L++IA+V SF+RI ++   NE  GPLQISLG+ + DI KF  IF++V  +F  G+  LY Y+ G    +N  F T+  ++K L+W++FG+S + ++ +K +   + +      +   L  VY+   V+VL+NM IAM++NS+Q I   AD+EWK+AR+KLW+ YFDEG TLP P N + S K  Y L +
Sbjct:  190 IERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDVNLQVWSDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSIAVKFLAVFGVSIGLPFLAIAYWIAPCSKLGQTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNETFTDYPKQIFRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLSIFVASFTARFMA-FLKASEAQLYVDQYVQDVTLHNVSLPPEVAYFTYARDKWWPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYRGAK--YNPAFTTVEESFKTLFWSIFGLSEVISVVLKYDHKFIEN------IGYVLYGVYNVTMVVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPSPKSFYYLIM 723          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Match: Trpc7 (transient receptor potential cation channel, subfamily C, member 7 [Source:MGI Symbol;Acc:MGI:1349470])

HSP 1 Score: 365.155 bits (936), Expect = 1.730e-116
Identity = 213/543 (39.23%), Postives = 314/543 (57.83%), Query Frame = 3
Query:    6 IEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKS-NEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMP--EWSSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXH---------NES-EDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQD------------LP---------RTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNIHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCV 1532
            IE+PH   C C+ C E  ++D+  HS  R++ Y+ LAS A++ L+S+DP+L A +LS EL++L++ E EFK  Y +LS QCK     +L+ CR  +EV  ILN   N +   +    S  R+KLAIK+E K FVAHP+CQ+ L  +WY ++      S   +     G+ I LP LA  Y + P  KLG  LRSP +KF+ H+ SF IFL L+++ ++          NE+  D     F  +  + S  E LI+ WV+G +WSE K+IWEEG + Y    WN LDF ML +++ + + R  A +L+ S+   + D            LP         R  W   DP +ISE L++IA+V SF+RI ++   NE  GPLQISLG+ + DI KF  IF++V  +F  G+  LY Y+ G    +N  F T+  ++K L+W++FG+S + ++ +K +   + +      +   L  VY+   V+VL+NM IAM++NS+Q I   AD+EWK+AR+KLW+ YFDEG TLP P N + S K  Y L +
Sbjct:  190 IERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDVNLQVWSDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSIAVKFLAVFGVSIGLPFLAIAYWIAPCSKLGQTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNETFTDYPKQIFRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLSIFVASFTARFMA-FLKASEAQLYVDQYVQDVTLHNVSLPPEVAYFTYARDKWWPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYRGAK--YNPAFTTVEESFKTLFWSIFGLSEVISVVLKYDHKFIEN------IGYVLYGVYNVTMVVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPSPKSFYYLIM 723          
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|P34586|TRPL_CAEEL (Transient-receptor-potential-like protein OS=Caenorhabditis elegans OX=6239 GN=trp-1 PE=2 SV=3)

HSP 1 Score: 485.723 bits (1249), Expect = 3.529e-160
Identity = 254/552 (46.01%), Postives = 368/552 (66.67%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEI----LSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMP--EWSSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKF----INHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSK-WIYRLCVYFLKTSQRFVNLLKITYRKFRG 1598
            +IE+PH  SC C  C      D+L++SL+RI+T+RALASPAW+ LTS DPIL AFKLS +L +L+  E+EFKETYLQLS+QCK  +CDLL +CRS++EVI ILNK         ++    LS  RLKLAIK+EQK FV+HPHCQ+LL +IWY  +P  + S  +   FL   ++ L PI   +Y++ P+ +LG  +RSP +KF    ++ +    +          + + E   + R   RGP  + VE L+  WVIG +WSE+KQ+WEEG K Y RQWWNWLDF+M+CLYLCT+S+R++A ++   ++  ++   RT W S++P L++EALF++  VFSFARII+LFQ N +LGPLQISLG ML+D+ KF FIF+L+I+SF+ GL QLY+Y+  N ++          +N F ++  +Y  L W++F ++   + D+      V + +IT  V + + ++YH  ++IVL+NM IAMMS+SFQ I++HAD+EWK+ R+KLW+ +FDEG +LPPP N +++ K  IY +   F   + R++ L K TY+K R 
Sbjct:  189 SIEKPHRHSCICETCDRERLNDSLQYSLKRINTFRALASPAWMSLTSPDPILSAFKLSWDLQRLAFEEHEFKETYLQLSEQCKQYSCDLLSQCRSSEEVIAILNKDGNVNDDNIDVWASKLSLSRLKLAIKYEQKAFVSHPHCQQLLTSIWYEGIPYRQRSGTWANFFLYAFLLFLWPIFCLMYILMPKSRLGRLVRSPFMKFFYYSVSFATFLGLLTWATFEDYRYEKGERGGMTRASDRGPPATWVESLVFTWVIGMLWSEIKQLWEEGFKRYMRQWWNWLDFLMICLYLCTISIRLSAYYIFTYREDPYRYTVRTYWTSEEPMLVAEALFAVGNVFSFARIIYLFQTNPYLGPLQISLGCMLVDVAKFCFIFVLIISSFSIGLAQLYWYYDPNTDVCLPGATCKHSSNVFSSIADSYLTLLWSLFSITKPEDTDV------VENHKITQWVGQGMFIMYHCTSIIVLLNMLIAMMSHSFQIINDHADLEWKFHRTKLWMAHFDEGSSLPPPFNIIVTPKSLIYVMNCLF--NTVRWL-LGKYTYQKNRN 731          
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|Q9QUQ5|TRPC4_MOUSE (Short transient receptor potential channel 4 OS=Mus musculus OX=10090 GN=Trpc4 PE=1 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 8.283e-140
Identity = 233/520 (44.81%), Postives = 335/520 (64.42%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN-KSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRL 1526
            ++ +PH   C+C  C  S   D+LRHS  R++ Y+ALASP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN + +     E+      RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       ++  C  I +L P+ +  YL+ P+  LG F+R P +KFI H+AS+  FL L+L+AS H +  D+      ++GP P++VE +I+ WV+GF+W E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL+I A       KY   + PR SW    PTL++EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+     +          NN F TL  T ++L+W++FG+     I++ V + + +    T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLP P N + S K ++ L
Sbjct:  167 SVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDLN-----RQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFV-----KYSALN-PRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLSCKGIRCEKQNNAFSTLFETLQSLFWSIFGL-----INLYVTNVK-AQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYL 669          
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|O35119|TRPC4_RAT (Short transient receptor potential channel 4 OS=Rattus norvegicus OX=10116 GN=Trpc4 PE=1 SV=2)

HSP 1 Score: 431.024 bits (1107), Expect = 1.161e-139
Identity = 233/520 (44.81%), Postives = 335/520 (64.42%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN-KSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRL 1526
            ++ +PH   C+C  C  S   D+LRHS  R++ Y+ALASP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN + +     E+      RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       ++  C  I +L P+ +  YL+ P+  LG F+R P +KFI H+AS+  FL L+L+AS H +  D+      ++GP P++VE +I+ WV+GF+W E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL+I A       KY   + PR SW    PTL++EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+     +          NN F TL  T ++L+W++FG+     I++ V + + +    T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLP P N + S K ++ L
Sbjct:  167 SVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDLN-----RQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFV-----KYSALN-PRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLSCKGIRCEKQNNAFSTLFETLQSLFWSIFGL-----INLYVTNVK-AQHEFTDFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYL 669          
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|Q9UBN4|TRPC4_HUMAN (Short transient receptor potential channel 4 OS=Homo sapiens OX=9606 GN=TRPC4 PE=1 SV=1)

HSP 1 Score: 430.639 bits (1106), Expect = 1.376e-139
Identity = 233/520 (44.81%), Postives = 335/520 (64.42%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN-KSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRL 1526
            ++ +PH   C+C  C  S   D+LRHS  R++ Y+ALASP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN + +     E+      RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       ++  C  I +L P+ +  YL+ P+  LG F+R P +KFI H+AS+  FL L+L+AS H +  D+      ++GP P++VE +I+ WV+GF+W E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL+I A       KY   + PR SW    PTL++EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+     +          NN F TL  T ++L+W++FG+     I++ V + + +    T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLP P N + S K ++ L
Sbjct:  167 SVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDLN-----RQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFV-----KYSALN-PRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGIRCEKQNNAFSTLFETLQSLFWSIFGL-----INLYVTNVK-AQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYL 669          
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Match: sp|P79100|TRPC4_BOVIN (Short transient receptor potential channel 4 OS=Bos taurus OX=9913 GN=TRPC4 PE=2 SV=2)

HSP 1 Score: 430.254 bits (1105), Expect = 2.050e-139
Identity = 232/520 (44.62%), Postives = 335/520 (64.42%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN-KSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRL 1526
            ++ +PH   C+C  C  S   D+LRHS  R++ Y+ALASP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN + +     E+      RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       ++  C  + +L P+ +  YL+ P+  LG F+R P +KFI H+AS+  FL L+L+AS H +  D+      ++GP P++VE +I+ WV+GF+W E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL+I A       KY   + PR SW    PTL++EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+     +          NN F TL  T ++L+W++FG+     I++ V + + +    T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLP P N + S K ++ L
Sbjct:  167 SVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLLEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIVGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDLN-----RQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFV-----KYSALN-PRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLSCKGIRCEKQNNAFSTLFETLQSLFWSIFGL-----INLYVTNVK-AQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYL 669          
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A1I8GJE9 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 304/555 (54.77%), Postives = 390/555 (70.27%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKS-NEKYCHEK----------------------------EILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEW--SSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNIHNNQFGTLVSTYKNLYWNMFGVSSIPNI-----DIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLKTSQRF 1559
            +I++PH  SC+C  C++ ++ D+LRHSL RI+TYRALASPAWICLTS DPIL AF+LS EL +L+S ENEFK  +  LS QC   ACDLL++CRS++EV  +LNKS ++   H+                             E+L+  RLKLA+KFEQK FVA+ HCQ+LL  IWY+ +P W   S   +   C+G V+++P+LA +Y+++P  +LG  +RSP +KF+NHSASFAIFL L+LIAS    +      R + RGP P  VE LI+WWV+GFVW+E+KQIW EG KAY RQWWNWLDFIML LYL T+SLRIAA  L  + KYG +   R  WP  DPTLISEA+FSIA VFSFARIIFLFQ+NEHLGPLQISLG M+IDI KF FIF LVITSFACGL+QLY++++ +  I N  F TL  TY+ L+W++FGV++  ++     +    D  V + + T  V+E + L YH + +IVL+NM IAMMSNSFQTI NHADIEWK+ARSKLW+ YFDEGCTLPPP NT++S K +Y    Y L+++ R 
Sbjct:  207 SIDRPHQLSCNCDRCKQLVRDDSLRHSLLRINTYRALASPAWICLTSADPILTAFRLSWELQRLASVENEFKAAFGALSQQCCKYACDLLDQCRSSEEVTAVLNKSESDGDSHDGFLPLSRSDLAASASASSLTGGSGDQPACEVLTLDRLKLALKFEQKQFVANSHCQQLLTTIWYDRLPGWRKQSLAAKALFCVGFVLVMPVLALVYILFPHSRLGRLMRSPFMKFLNHSASFAIFLVLLLIASTDWGAFHRAKERHMMRGPPPDFVETLILWWVLGFVWAEMKQIWAEGFKAYVRQWWNWLDFIMLALYLSTLSLRIAAYVLAKTGKYGSEPQSRLDWPLLDPTLISEAVFSIANVFSFARIIFLFQVNEHLGPLQISLGCMVIDIAKFIFIFYLVITSFACGLNQLYFFYMQDSKIKNEGFSTLTVTYQTLFWSLFGVTNRRDVLIFSSEAGSTDNAVEN-KATEFVSELMWLSYHFVAIIVLVNMLIAMMSNSFQTIQNHADIEWKFARSKLWMSYFDEGCTLPPPFNTIVSPKSVY----YCLRSAVRL 756          
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A1I8JC65 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 304/555 (54.77%), Postives = 390/555 (70.27%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKS-NEKYCHEK----------------------------EILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEW--SSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNIHNNQFGTLVSTYKNLYWNMFGVSSIPNI-----DIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLKTSQRF 1559
            +I++PH  SC+C  C++ ++ D+LRHSL RI+TYRALASPAWICLTS DPIL AF+LS EL +L+S ENEFK  +  LS QC   ACDLL++CRS++EV  +LNKS ++   H+                             E+L+  RLKLA+KFEQK FVA+ HCQ+LL  IWY+ +P W   S   +   C+G V+++P+LA +Y+++P  +LG  +RSP +KF+NHSASFAIFL L+LIAS    +      R + RGP P  VE LI+WWV+GFVW+E+KQIW EG KAY RQWWNWLDFIML LYL T+SLRIAA  L  + KYG +   R  WP  DPTLISEA+FSIA VFSFARIIFLFQ+NEHLGPLQISLG M+IDI KF FIF LVITSFACGL+QLY++++ +  I N  F TL  TY+ L+W++FGV++  ++     +    D  V + + T  V+E + L YH + +IVL+NM IAMMSNSFQTI NHADIEWK+ARSKLW+ YFDEGCTLPPP NT++S K +Y    Y L+++ R 
Sbjct:  200 SIDRPHQLSCNCDRCKQLVRDDSLRHSLLRINTYRALASPAWICLTSADPILTAFRLSWELQRLASVENEFKAAFGALSQQCCKYACDLLDQCRSSEEVTAVLNKSESDGDSHDGFLPLSRSDLAASASASSLTGGSGDQPACEVLTLDRLKLALKFEQKQFVANSHCQQLLTTIWYDRLPGWRKQSLAAKALFCVGFVLVMPVLALVYILFPHSRLGRLMRSPFMKFLNHSASFAIFLVLLLIASTDWGAFHRAKERHMMRGPPPDFVETLILWWVLGFVWAEMKQIWAEGFKAYVRQWWNWLDFIMLALYLSTLSLRIAAYVLAKTGKYGSEPQSRLDWPLLDPTLISEAVFSIANVFSFARIIFLFQVNEHLGPLQISLGCMVIDIAKFIFIFYLVITSFACGLNQLYFFYMQDSKIKNEGFSTLTVTYQTLFWSLFGVTNRRDVLIFSSEAGSTDNAVEN-KATEFVSELMWLSYHFVAIIVLVNMLIAMMSNSFQTIQNHADIEWKFARSKLWMSYFDEGCTLPPPFNTIVSPKSVY----YCLRSAVRL 749          
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A1I8I4R7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 300/522 (57.47%), Postives = 377/522 (72.22%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEK--------EILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEW-SSPFT-RLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNIHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRV------SSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIY 1520
            TIE+PH  SC C  C++ ++ D+LRHSL RI+TYRALASPAWICLTS DPIL AF+LS EL +L+S ENEFKE ++ LS QC+  ACDLL++CRS++EVI +LNKS       +        E LS  RLKLA+KFEQK FVAH HCQ+LL  IWY+ +P W   P   +  +C G V+L+P+LA +Y+++P+ +LG  +RSP +KF+NHSASFAIFL L+LIAS    +      R++ RGP P LVE LI+WWV+GFVW+E+KQIWEEG +AY RQWWNWLDFIML LYL T++LR+AA  L  + KYG +   R  WP  DPTL+SEA+FSIA VFSFARIIFLFQ+NEHLGPLQISLG M+IDI KF FIF LVITSFACGL+QL                 L ++Y+ L+W++FGV++  ++ I+               R T  VAE +LL YH + +IVL+NM IAMMS+SFQ I NHADIEWK+ARSKLW+GYFDEGCTLPPP NT++S K I+
Sbjct:  166 TIERPHQLSCRCDRCKQLVRDDSLRHSLLRINTYRALASPAWICLTSSDPILTAFRLSWELQRLASRENEFKEAFVALSQQCRKYACDLLDQCRSSEEVIAVLNKSKSADDDPQLPPQQPPVESLSLDRLKLALKFEQKQFVAHSHCQQLLTTIWYDRLPGWRKQPLAVKALMCFGFVLLMPVLALVYVLFPRSRLGQLMRSPFMKFLNHSASFAIFLVLLLIASTDWGAFKRPKERYMVRGPPPDLVETLILWWVLGFVWAEMKQIWEEGFQAYVRQWWNWLDFIMLALYLTTLALRLAAFTLARTGKYGAEPQSRLEWPVMDPTLLSEAVFSIANVFSFARIIFLFQVNEHLGPLQISLGCMVIDIAKFIFIFYLVITSFACGLNQL-----------------LTNSYQTLFWSLFGVTNRRDVIIQSASPTTSTSSGFGEGRTTEVVAELMLLTYHFVAIIVLVNMLIAMMSSSFQNIQNHADIEWKFARSKLWMGYFDEGCTLPPPFNTIVSPKSIF 670          
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A210R266 (Transient-receptor-potential-like protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12937 PE=3 SV=1)

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 293/526 (55.70%), Postives = 376/526 (71.48%), Query Frame = 3
Query:    6 IEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNK-SNEKYCHEKEI-------LSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWS--SPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNIHN-NQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIY---RLCVYFL 1541
            I QPH  SC C  CQE +  D+LRHSL RI+TY+ALASPAWI LTS DPIL AF+LS  L KL+  ENEFK+TY+ LS+QCK  ACDL+++CR+++EVI +LNK S+E+    ++        L+  RLKLA+K+EQK FVAHPHCQ+LL +IWY  +P W   +  T+  LC+G+++L+P +A  YL++P+ K+G  LRSP +KF+ HSASF +FL L++  S    S D    RF  RGP PS +E  IV+WV GFVW EVKQ+W+EG KAY RQWWNWLDFIML LYL T SLR+ A  L  S +YG +++ R+ WP  DPTLISE+LF++A VFSF+RII+LFQ N+HLGP+QISLG MLIDI KF FIF LV+TSFACGL+QLY+Y+ G+ +  + + F TL  +Y  LYW++FG++++ +I I           IT  +   L + YH M  IVLINM IAMMSNS+Q I NHAD+EWK+ RSKLW+GYFDEG TLP P N +IS K IY   R C  FL
Sbjct:  174 INQPHQLSCSCKVCQEHVHEDSLRHSLLRINTYKALASPAWISLTSPDPILSAFRLSWVLQKLALRENEFKDTYMGLSEQCKKYACDLIDQCRTSEEVIAVLNKESDEEEADHRQYGIVDNNKLTLARLKLALKYEQKQFVAHPHCQQLLTSIWYEGLPGWRKRNGVTKFLLCIGLILLVPFMAVYYLIFPRSKIGQLLRSPFMKFLYHSASFGVFLFLLVCVSTEI-SGDSNRERF--RGPTPSQLEWFIVFWVTGFVWQEVKQLWDEGLKAYIRQWWNWLDFIMLSLYLATFSLRLVAYILIKSDRYGPREMNRSDWPPLDPTLISESLFAVANVFSFSRIIYLFQANQHLGPMQISLGCMLIDIAKFLFIFFLVLTSFACGLNQLYWYYNGSRSEGDPDSFYTLGESYITLYWSLFGLTALKDIKIP------QGQYITELMGMLLFMAYHGMASIVLINMLIAMMSNSYQNIENHADMEWKFCRSKLWMGYFDEGSTLPAPFNLIISPKSIYYCLRSCNAFL 690          
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Match: A0A0F7VHQ1 (Eka-Trp1 protein OS=Euperipatoides kanangrensis OX=488523 GN=Eka-Trp1 PE=2 SV=1)

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 284/547 (51.92%), Postives = 376/547 (68.74%), Query Frame = 3
Query:    6 IEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYC----------------HEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWS--SPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYF----------LGNPNIHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLKTSQRFV 1562
            I++PH  SC C  CQES++ D+LR+SL RI TYRALASPAWI LTS DPIL AFKLS EL +L+  ENEFK+TY++L+  CK  ACDLL++CRS++EVI +LNK N+                    E  IL+  RLKLA+K+EQK FVAHP+CQ+LL ++WY  +P W       ++ +C+G++ L P +A  YL++P+ ++G FLRSP +KF+ HS SF  FL L+++AS   E+ D K  R   RGP P+ VE LI+ WV G VW+E KQ+WEEG KAY RQWWNWLDFIML LYLCT+SLR+ A     S K  ++++ R+ WP +DPTLISE +F+IA VFSFARII+LFQ N HLGPLQISLG MLIDI KF FIF L++TSFACGL+QLY+Y+           G   ++ + F TL +T+  L+W++FG+++  + D+  +   + +      V + L + YH   +IVLINM IAMMSNSFQ I +HAD EWK+ARSKLW+ YFDEG TLP P N + S K ++    YFL+ S+ F+
Sbjct:   59 IDKPHSVSCRCSKCQESLRTDSLRYSLLRIHTYRALASPAWISLTSADPILTAFKLSWELERLAMRENEFKDTYIELAMSCKKYACDLLDQCRSSEEVIAVLNKKNDSDSEDDDEDDEDDSSDGERGEDRILTLARLKLALKYEQKQFVAHPNCQQLLTSVWYEGLPGWRRYDGALKILICIGLIFLFPFMAFYYLIFPRSRIGQFLRSPFMKFLYHSTSFGCFLILLVLASTRTEATDGKRERI--RGPPPTPVEWLIMLWVTGMVWAECKQLWEEGLKAYIRQWWNWLDFIMLSLYLCTLSLRMVAYIQVQSGKNEYREIERSLWPDNDPTLISEGVFAIANVFSFARIIYLFQTNPHLGPLQISLGCMLIDIAKFLFIFFLILTSFACGLNQLYWYYDSDCSQGKNADGECKMNTDAFTTLDNTFVTLFWSLFGITTPKSTDLHDDHKFIET------VGQGLFMAYHVAAIIVLINMLIAMMSNSFQVIEDHADREWKFARSKLWMSYFDEGATLPSPFNVIPSPKSLF----YFLRGSKNFI 593          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc5a (short transient receptor potential channel 5-like [Source:NCBI gene;Acc:103044006])

HSP 1 Score: 429.098 bits (1102), Expect = 1.936e-139
Identity = 233/528 (44.13%), Postives = 338/528 (64.02%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKY--CHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYF----LGNPN--------IHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYF 1538
            TI +PH   C C  C  S + D+LRHS  R++ Y+ALASP+ I L+S+DPIL AF+L  EL +LS  ENEF++ Y +LS QCK  A DLL++ RS++E+  ILN  +++      +E     +LKLAIK+ QK FV+ P+CQ+LL  +WY+  P W       +L +C+ I +L P+ + IYL+ P+  LG F++ P +KFI H+AS+  FL L+L+AS H    ++ +     +GP P++VE +I+ WV+GF+W+E+K++W+ G   Y   WWN +DF M  LYL T+SL++ A       KY +   PR  W    PTL++EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+       PN          NN F TL  T ++L+W++FG+ ++   ++K           T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YFDEG TLPPP N + S K  + LC + 
Sbjct:  170 TIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKRFAKDLLDQARSSRELETILNHRDDQSEELDPRECRDLAKLKLAIKYHQKEFVSQPNCQQLLATLWYDGFPGWRRRHWAVKLVMCIIIGLLFPVFSIIYLLAPRSSLGFFIKKPFIKFICHTASYLTFLFLLLLASQHIARTNLHM-----QGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFTEYVHDWWNLMDFAMNSLYLATISLKMVAY-----VKY-NSSRPREEWEMWHPTLMAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETQAADEPNHCKGIRCEKQNNAFSTLFETLQSLFWSIFGLLNLYVTNVKARH------EFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIVPSPKSAWYLCCWL 680          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc4a (short transient receptor potential channel 4-like [Source:NCBI gene;Acc:103035222])

HSP 1 Score: 422.935 bits (1086), Expect = 4.987e-138
Identity = 236/544 (43.38%), Postives = 345/544 (63.42%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKE-ILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI------------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLKTSQRFVNLLKITYRK 1589
            ++ QPH   C+C  C  S   D+LRHS  R++ YRAL+SP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A +LL++ RS++E+  ILN  ++    E E +    RLKLA+++ QK FVA P+CQ+LL + WY+  P W       +   C+ I +L P+ +  YLV P+   G F+R P +KFI H+AS+  FL L+L+AS H     I   + + +GP P+ VE +I+ WV+GF+W+E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL++ A +L+ S         R SW    PTL++EA+F+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+  + +              NN F TL  T ++L+W++FG+     ID+ V +      R T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLPPP N + S K ++    YF++  +R  N+ ++   K
Sbjct:  167 SMPQPHEVRCNCVECVSSSDVDSLRHSRSRLNIYRALSSPSLIALSSEDPFLTAFRLSWELEELSKVENEFKYEYEELSQQCKQFAKNLLDQTRSSRELELILNYRDDINPLEDEGVNDLARLKLAVRYHQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKFITCIFIGLLFPLFSIFYLVAPKSHYGLFIRKPFIKFICHTASYLTFLFLLLLASQH-----ITGSKALSQGPPPNTVEWMILPWVLGFIWAEIKQMWDGGFQDYVHDWWNLMDFVMNSLYLATISLKVVA-YLKYSGSNA-----RESWDMWHPTLVAEAVFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETDASNSTKWCKGIRCEHQNNAFTTLFETLQSLFWSIFGL-----IDLHVTNVG-PDHRFTEFVGATMFGTYNIISLVVLLNMLIAMMNNSYQHIADHADIEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSVW----YFVRWIKR--NVFRVAATK 687          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc4b (short transient receptor potential channel 4-like [Source:NCBI gene;Acc:103045092])

HSP 1 Score: 416.387 bits (1069), Expect = 1.331e-135
Identity = 234/536 (43.66%), Postives = 342/536 (63.81%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN-KSNEKYCHEKEILS-FKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI---------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVY-----FLKTSQR 1556
            ++ QPH   C+C  C  S   D+LRHS  R++ YRAL+SP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN + +     ++E  +   RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       +   C+ I +L P L+  YLV P+ + G F+R P +KFI H+AS+  FL L+L+AS H  S    +     +GP P+ VE +I+ WV+GF+W+E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL+I A +++ S   G++   R  W    PTL++EA+F+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+    +           NN F TL  T ++L+W++FG+  +   +++ +       + T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLP P N + S K I+ L  +     F + S+R
Sbjct:  167 SVPQPHEVRCNCMECVSSSDVDSLRHSRSRLNIYRALSSPSLIALSSEDPFLTAFQLSWELQELSKVENEFKTEYEELSHQCKRFAKDLLDQTRSSRELELILNFRDDLSLLQDQESNNELARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAGKFITCVFIGLLFPTLSICYLVAPKSRYGLFIRKPFIKFICHTASYLTFLFLLLLASQHIVSTKPNL-----QGPAPTTVEWMILPWVLGFIWTEIKQMWDGGFQDYIHDWWNLMDFVMNSLYLATISLKIVA-YVKYS---GYKQ--RDKWEMWHPTLVAEAVFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYDTKDDRVCKGIRCEHQNNAFSTLFETLQSLFWSIFGLIGLYVTNVQADH------KFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQHIADHADIEWKFARTKLWMSYFEEGGTLPTPFNIIPSPKSIWYLITWIKIHVFRRKSKR 685          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc5b (transient receptor potential cation channel, subfamily C, member 5b [Source:ZFIN;Acc:ZDB-GENE-091112-24])

HSP 1 Score: 387.882 bits (995), Expect = 5.978e-125
Identity = 223/530 (42.08%), Postives = 319/530 (60.19%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNE--KYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSP--FTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYF----LGNPN--------IHNNQFGTLVSTYKNLYWNMFGVSSIPNI--DIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYF 1538
            TI +PH   C C  C  S + D+LRHS  R++ Y+ LASP+ I L+S+DPIL AF+L  EL +LS  ENEF++ Y +LS QCK  A DLL++ RS++E+  ILN  ++  +    +E     +LKLAIK+ QK FVA P+CQ+LL  +WY+  P W       +L  C  I +L P+ + IYL+ P+  LG F++ P +KFI H+AS+  FL L+L+AS H    D+ +     +GP P++VE +I+ WV+GF+W+E+K++W+ G   Y   WWN +DF M  LYL T+SL++ A       KY +   PR  W    PTLI+EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+       PN          NN F T +      +  +F ++++ +   D+K+                        +++ + I  FIAM     Q   +HADIEWK+AR+KLW+ YFDEG TLPPP N + S K ++ LCV+ 
Sbjct:  167 TIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKTLASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQARSSRELETILNHRDDHSEELDPRECRDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRRHWVVKLVTCFTIGLLFPVFSIIYLLAPKSALGFFIKKPFIKFICHTASYLTFLFLLLLASQHIVRTDLHV-----QGPPPTIVEWMILPWVLGFIWAEIKEMWDGGFTEYVHDWWNLMDFAMNSLYLATISLKMVAYL-----KY-NSSRPREEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETEAADEPNHCKGIRCEKQNNAFSTFIII---TFLTVFALTALEDTFKDLKI-----------------------PLSIAMFITRFIAMFPLPPQ---DHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSVWYLCVWL 656          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Match: trpc6a (short transient receptor potential channel 6-like [Source:NCBI gene;Acc:103025180])

HSP 1 Score: 375.555 bits (963), Expect = 1.687e-120
Identity = 213/532 (40.04%), Postives = 305/532 (57.33%), Query Frame = 3
Query:    6 IEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPFT--RLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNES----------EDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALW------------------LRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNIHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSK 1511
            IEQPH   C C  C    + D+  HS  RI+ YR LASPA++ L+++DP+L A +LS EL+ L++ E EFK  Y +LS QCK     LL+ CR+ +EV  ILN   +  C      S  RL LAIK+E K FVAHP+CQ+ L +IWY ++P      T  +L + LG+ I LP L+ +Y V P  KLG  +R P +KF+ H+ASF IFL ++++ +A               D     F  +    + +E LIV+WVIG +W+E K+IW +G + Y  + WN LDF ML +++ +   R+ A W                  + L  +  +  L R  W   DP L+SE L+SIA+V SF+RI ++   NE  GPLQISLG+ + DI KF  IF+LV  +F  G+  LY Y+LG     N+ F T+  ++K L+W +FG+S + ++ +       +  +        L  VY+   VIVL+NM IAM+++SFQ I + AD+EWK+AR+KLW  YF+EG TLP P N + S K
Sbjct:  229 IEQPHDYFCTCDTCNYHQKYDSFSHSRSRINAYRGLASPAYLSLSNEDPVLAALELSNELACLANIEKEFKNDYRKLSIQCKDFVVGLLDLCRNTEEVEAILNGEEDDSCDLPGRPSLTRLNLAIKYELKKFVAHPNCQQQLLSIWYENLPGLRQQTTAVKLLVVLGVAIGLPFLSMVYWVAPCSKLGKIMRGPFLKFVAHAASFTIFLGMLVLNAADRFDGTKLLPNMTIHDYPTQLFRMKTTPLTWMEMLIVFWVIGMIWAECKEIWSQGPREYLLEPWNMLDFGMLAIFVASFVTRLMAFWHTYAAQCYVDVHYTDITNITLPLEVEYFRLARIDWLPSDPQLVSEGLYSIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFILVFLAFMIGMFNLYSYYLGAK--QNDAFTTIEESFKTLFWAIFGLSEVKSVVVN------NGHKFIENTGYVLYGVYNVTMVIVLLNMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLMPSPK 752          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Sea Lamprey
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 372.089 bits (954), Expect = 2.085e-123
Identity = 219/530 (41.32%), Postives = 313/530 (59.06%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN--KSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYF-----LGNPNI-------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVN---DTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVY 1535
            ++ +PH   C C  C    + D LRHS  R++ YRALASP  + L S+DP L AF LS EL +LS  ENEFK  Y +LS QCK  A +LL++ RS +E+  +LN  + ++      +  + +RLKLAIK+ QK FVA P+CQ+LL ++WY+  P W       +L  C  + +L P+ +  YL+ P+ ++  FLR P +KFI H+AS+  FL L+L+AS      D  +     +GP P+LVE +I+ W+   +W+E+KQ+W+ G   Y   WWN +DF+M  LYL T+SL++ A +L+ S         R  W    PTL++EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+      GN           NN F TL +  K+L+         P++ I V+      +     T     F L  Y S+ V +  ++ I    N+F+   +HADIEWK+AR+KLW+ YF+EG TLPPP N + S K  + LC Y
Sbjct:   42 SVPRPHAVRCACLQCAAGSEADGLRHSRSRLAVYRALASPCLVALASEDPFLTAFTLSCELCELSRVENEFKAEYEELSQQCKQFAKELLDQTRSTRELEIVLNYKEESDGAPEAPDAFNLERLKLAIKYHQKEFVAQPNCQQLLASLWYDGFPGWRRRHWAVKLVTCATLGLLFPLFSVCYLLAPRSRMAFFLRKPFIKFICHTASYLTFLFLLLLASQQIARTDPNM-----QGPSPTLVEWMILPWICRLIWAEIKQMWDGGFSEYVHDWWNLMDFVMNSLYLATISLKLVA-YLKYSGSKA-----REQWEMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETSAGQGNDTCKGIRCEKQNNAFSTLCNCLKHLF---------PSVSICVHLCPSGSICFHLFTSVSICFHLFPYVSICVHLFPSVSIT-SCNAFKNTVDHADIEWKFARTKLWMSYFEEGATLPPPFNIVPSPKSAWYLCRY 550          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Sea Lamprey
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 368.237 bits (944), Expect = 4.601e-122
Identity = 216/532 (40.60%), Postives = 315/532 (59.21%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILN--KSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYF-----LGNPNI-------HNNQFGTLVSTYKNLYWNMFGVSSI-----PNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVY 1535
            ++ +PH   C C  C    + D LRHS  R++ YRALASP  + L S+DP L AF LS EL +LS  ENEFK  Y +LS QCK  A +LL++ RS +E+  +LN  + ++      +  + +RLKLAIK+ QK FVA P+CQ+LL ++WY+  P W       +L  C  + +L P+ +  YL+ P+ ++  FLR P +KFI H+AS+  FL L+L+AS      D  +     +GP P+LVE +I+ W+   +W+E+KQ+W+ G   Y   WWN +DF+M  LYL T+SL++ A +L+ S         R  W    PTL++EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+      GN           NN F T  ++  ++ +++F   SI     P++ I       +  R  +  A +L  ++ S + IV     I   ++    + +HADIEWK+AR+KLW+ YF+EG TLPPP N + S K  + LC Y
Sbjct:   28 SVPRPHAVRCACLQCAAGSEADGLRHSRSRLAVYRALASPCLVALASEDPFLTAFTLSCELCELSRVENEFKAEYEELSQQCKQFAKELLDQTRSTRELEIVLNYKEESDGAPEAPDAFNLERLKLAIKYHQKEFVAQPNCQQLLASLWYDGFPGWRRRHWAVKLVTCATLGLLFPLFSVCYLLAPRSRMAFFLRKPFIKFICHTASYLTFLFLLLLASQQIARTDPNM-----QGPSPTLVEWMILPWICRLIWAEIKQMWDGGFSEYVHDWWNLMDFVMNSLYLATISLKLVA-YLKYSGSKA-----REQWEMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETSAGQGNDTCKGIRCEKQNNAFSTWFTSV-SICFHLFPYVSICVHLFPSVSIFF----YTDKRKNMLNAAYLREMHFS-SAIVACQTIIRASASDPNHVEDHADIEWKFARTKLWMSYFEEGATLPPPFNIVPSPKSAWYLCRY 542          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Sea Lamprey
Match: trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:ZFIN;Acc:ZDB-GENE-140129-1])

HSP 1 Score: 302.368 bits (773), Expect = 5.689e-94
Identity = 196/535 (36.64%), Postives = 282/535 (52.71%), Query Frame = 3
Query:    6 IEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKS---NEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXH---------NESE-DIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQD--------------------LPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNIHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSK 1511
            IE+PH   C C  C E  + D   HS  RI+ YR LASPA++ L+S+DP+L A +LS EL+ L++ E EFK  Y +LS QCK     LL+ CR  +EV  ILN     N   C +++  +  RLKLAIK                                                     Y   K+G  LRSP +KF+ H+ASF IFLAL+++ ++          NE+E D     F  +    +  E LIV W+IG +W+E K++W EG K Y  Q WN LDF ML +++ + + R+ A +L+ S+     D                    L R+ W   DP +ISE L+SIAIV SF+RI ++   NE  GPLQISLG+ + DI KF  IF++V  +F  G+  LY Y+ G     N  F T+  ++K L+W++FG+S + ++ I  N   + +      +   L  VY+   V+VL+NM IAM+++S+Q I + +D+EWK+AR+KLWI YF++G TLP P N + S K
Sbjct:  190 IERPHDYFCKCGECTEKQRHDAFSHSRSRINAYRGLASPAYLSLSSEDPVLTALELSNELAMLANIEKEFKNDYKKLSVQCKDFVVGLLDLCRDTEEVEAILNGDAELNPPAC-DRQRAALIRLKLAIK-----------------------------------------------------YEVKKIGKVLRSPFMKFVAHAASFTIFLALLVLNASDRFEGVKLLPNETETDHPQQLFRIKTTSFTWTELLIVAWIIGMIWAECKELWAEGLKEYLFQLWNVLDFGMLSIFVASFTARLFA-FLKASEAQRFVDSEGFPNVSNATLPEHIRYFNLARSHWLPSDPQIISEGLYSIAIVLSFSRIAYILPANESFGPLQISLGQTVKDIFKFMVIFIMVFLAFMIGMFNLYSYYRGAK--VNRAFVTVEESFKTLFWSIFGLSEVASVVINYNHKFIEN------IGYILYGVYNVTMVVVLLNMLIAMINSSYQEIEDDSDVEWKFARAKLWISYFEQGRTLPVPFNLVPSPK 661          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001180.1 (pep scaffold:Pmarinus_7.0:GL486488:994:2494:1 gene:ENSPMAG00000001058.1 transcript:ENSPMAT00000001180.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 2.633e-15
Identity = 39/112 (34.82%), Postives = 62/112 (55.36%), Query Frame = 3
Query: 1122 CGLHQLYYYFLGNPNIHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGY 1457
            CG++ LY ++  N      + G    T++ L+W +FG+      DI        +  I   V   L  VY  +  IVL+NM IAM+++SF+ I + AD+EWK+ARS+L++ Y
Sbjct:    2 CGINNLYVHYTFN------KLGRFNETFQYLFWTVFGMEDRRTTDIP-------NFEIAQFVGRSLYGVYAIIMAIVLLNMLIAMITSSFERIEDDADVEWKFARSRLYLSY 100          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007332.1 (pep scaffold:Pmarinus_7.0:GL483392:1130:9476:1 gene:ENSPMAG00000006613.1 transcript:ENSPMAT00000007332.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 4.686e-11
Identity = 52/204 (25.49%), Postives = 94/204 (46.08%), Query Frame = 3
Query:  966 LFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLY--YYFLGNPNIHNNQFG----------TLVSTYKNLYWNMFGVS---SIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCV 1532
            L + A+ F   +++     +   GP  I +  ++ D+ +F  +  +   +F   L  L    Y  G+P  +++             T +     L++++FG+    S+P++      +R  S   T+  A F   VY  +T+IVLIN+ IAMMS+++Q I   +D +WK+ R  L +       T P PLN +    W+ + C 
Sbjct:  435 LLAKALAFCCVQLLDFLSFHHLFGPWAIIISDLMKDLARFGMVLGIFHVAFTLHLTALCQPVYPQGDPVGNSSTAAAAWDPSTAAQTTLDVTVLLFFSLFGMGDQNSLPDV------SRSPSIVSTLVNATFG--VYLIVTLIVLINLLIAMMSDTYQRIQAQSDTQWKFGRVVL-VREATRRTTPPAPLNVVTQLLWLLQRCA 629          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Nematostella
Match: EDO45311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ7])

HSP 1 Score: 269.626 bits (688), Expect = 5.207e-84
Identity = 179/500 (35.80%), Postives = 269/500 (53.80%), Query Frame = 3
Query:   12 QPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEIL-SFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSP--FTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSL--RIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYY-----YFLGNP--NIHNNQFGTLVSTYKNLYWNMFGV--SSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEG 1469
            +PH   C C  CQ     D  R S RR+  YR LA+P +I +TS DP L AF+LS EL  ++  E+E+++ YLQLS QC      LL+ECR+++E  CILN   E    E     S   +  AI + QK FVAHP CQ L+    +  +  W +     R+   L  VI+ P+LA IY   P  ++G  ++ P VKFINH++SF +FL L+ ++S H        +RF K    PS +E LI  W++G  WSE KQ+W EG++ Y    WNW+D  M+ L L    L   I  +    + K  H  L  T          ++ +++  +V SF R+I+L QI+ +LG LQ+SL +M+  I +FAFI  +V+ SF+  +  LY      Y L  P  N+ ++    L   Y NL   M  +  +S+  + +   +     + I    A  L  +YH+ +++VL+NM IAMMSNS+Q + ++ + E+K+AR++LW  Y  + 
Sbjct:   26 KPHNVLCRCEECQA----DNFRESQRRLDIYRGLANPVFISMTSNDPFLTAFELSSELEVIARREDEYEKDYLQLSQQCSQFTIGLLDECRTSREQRCILNYPGENGSVEDYAENSLGLVNSAISYNQKEFVAHPFCQHLVMQHIFGDITGWRTNHFLYRIAYVLTQVIIFPVLAVIYFFMPFLEVGRKIKRPFVKFINHTSSFVVFLILLAVSSHHQFE-----IRFRKM---PSGLEWLIFSWILGVAWSECKQVWHEGARRYFSSGWNWMDIGMVFLLLGAFVLWTIIFIVDFDSNAKLAHDVLLST----------ADGMYAFGVVASFFRLIYLCQISRYLGLLQLSLSRMVRVIFQFAFISCVVLWSFSVAMTMLYMSSFEAYQLPRPVKNVTSDIDAILDKGYDNLLSTMVTLMWASLDMVGLDTLNVFKKQSLIQFWTAA-LFTLYHAASMVVLLNMLIAMMSNSYQQVEDNIETEYKFARTQLWTDYIGDA 502          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Nematostella
Match: EDO48346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJX1])

HSP 1 Score: 228.794 bits (582), Expect = 9.373e-68
Identity = 162/513 (31.58%), Postives = 272/513 (53.02%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLT---SQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSN-EKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPFT--RLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHN-ESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLY-YYFLGNPNIHN----NQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLIS 1505
            TI++ H   C C  CQ S+ R  +  SL R+ TYRALASP ++ LT    +DP+  AF+L+ EL +L+  E EF+  YLQLS QC+  A  LL++CR   E+  +++  + +    +    S   L  AI  +   FVAHP+CQ +LN++ Y     W       ++   L   I +P+ A +Y   P   L   L +P++KFI H+ +F +FL L++++S     S +  +++F+      +  + LI  W+ G +  E+K +W +G + Y  QWWN +   ML L++ +  L +A   L +S++    +  R         L++ A F+I ++ +F       Q+N  LGPLQ+SL KM+ DI+KF  +F L+  +F   L ++Y  Y       H     + F ++  + + ++W +F  + +     + N       +IT +  E L  +++  +++V INM IAMMSNSFQ + +  D  WK++R+++W+ Y  +G  LP P + L S
Sbjct:   88 TIDRVHDRGCLCPWCQ-SLGR--IGTSLHRLYTYRALASPVYMSLTFLSCKDPVRQAFELNKELVELADIEYEFRSDYLQLSQQCEEFAVALLDQCRDMSEIEQMMSVPDMDGALTKNGSKSLGVLDYAINNKNGRFVAHPYCQMMLNSVIYGDFHTWEKMGVTLKILFALLFTIFIPVWAIVYFFTPTSCLSQKLATPILKFIMHTGAFGLFLLLLILSSIQRFISSNTFLLKFLF-----NFSDILITIWIFGLIVQELKDMWRQGKERYLSQWWNLVTLAMLGLFIISGILWVAGSALSVSKEGSLAESYRF-------ILLANAFFTIGVLLAFLHFSNAVQVNSTLGPLQLSLVKMVKDILKFLLLFFLIYLAFVVALRRVYSQYVWAGKTPHTISLYSVFCSVQGSMRLVFWAIFDKTELE----EFNTDPSFPTKITQSTGEVLFALFNIASILVAINMLIAMMSNSFQKVADSEDFLWKFSRTRMWMEYIIKGSVLPAPFSVLPS 581          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Nematostella
Match: EDO49302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH68])

HSP 1 Score: 151.369 bits (381), Expect = 1.248e-39
Identity = 113/380 (29.74%), Postives = 192/380 (50.53%), Query Frame = 3
Query:   90 RISTYRALASPAWICL------TSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNE-KYCHEKEI-------LSFKRL---KLAIKFEQKHFVAHPHCQKLLNNIWYNSMP---------EWSSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYF 1151
            R++ YRALASP +I         +  PI    +L+ +L      + EF   Y Q+S  C+  A DLLE+CR+  E   +L+   E +  +EK+         +FK L    LAI+ +    VAHP  Q  L+ I Y+ +           + S +T     L   +LLP LA  Y++ P  ++   L++P+VKF +H+ +F +F   + ++S  +   D  ++        P L++   + +V+G    EVK ++ +G+  Y RQWWN +  +M+ L+L + SLR+ A    LS +     L   +  S   +L++ + F+ A+VFSF  +    Q+++  GPLQ+SL  +  D+IKF   F ++  +F   L +LY ++
Sbjct:  181 RVNAYRALASPLYISYFFIMNPDALHPIFHVLELNKKLKNQMYRDFEFNNDYKQISKDCQRFAVDLLEQCRTTDETNVLLDVYPEIQRVYEKDKKHIEGSHTAFKELSMLNLAIRNDMNELVAHPQSQLRLDKILYHGLYMFKREPRVWRYRSWYTGKLFWLRHTLLLPFLALFYIIAPDCRISNVLKTPMVKFYSHTGAFVLFAIALAVSSFEDHFTDYTLI--------PVLIDWGTLLFVLGLFLQEVKDLYFQGAFRYIRQWWNIISLLMVVLFLISYSLRLTAY---LSPQTSPPHLKNLAVRSSQLSLLANSFFAFAMVFSFIHLTNFLQVSDVFGPLQLSLYMLFADLIKFFVFFFVLFLAFGLSLRKLYSHY 549          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Nematostella
Match: EDO31100 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYW3])

HSP 1 Score: 100.523 bits (249), Expect = 3.411e-22
Identity = 68/278 (24.46%), Postives = 141/278 (50.72%), Query Frame = 3
Query:  702 EPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEA--LFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYY----FLGNPNIHNNQFG--------TLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLN 1493
            +P+ VE +I+ + +G + +EV+Q     SK Y R  WN+LD  ++  Y+  V +RI  +                S P     L++    ++ I  +F   R+  + ++N   GPLQ++L +ML+D+      F++VI +F+  + ++Y+      +G    +    G         L  T ++L W++FG++ +        D+  ++ R    +A +L  ++  + V++L+N  +A+++N+++ I +++D EWKY R+ ++   ++     PPP+N
Sbjct:  483 QPTAVEYVILVFFLGRILAEVQQYQRSRSKIYFRDMWNYLDITIILCYITIVIVRIVTM--------------AKSGPVQGNNLLAGVMYMYGINTLFLILRVSSVLELNRTTGPLQLALMRMLVDLWVIIVQFVVVILAFSFAITKVYFAQRSLAMGQTETNATYSGFCPLDGGNCLRKTTESLVWSLFGLTDL--------DSIATNNRAASTLAYYLYAIFLVICVVMLLNTLVALLNNTYEDIKSNSDTEWKYVRA-MYADQYNRCHPFPPPVN 737          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Nematostella
Match: EDO36284 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ19])

HSP 1 Score: 68.1662 bits (165), Expect = 5.435e-14
Identity = 30/87 (34.48%), Postives = 55/87 (63.22%), Query Frame = 3
Query: 1209 NLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEG 1469
            +L+W++FG++ + +     ND + +   IT    E +   +  + VIV +NM IAMM+ SF++I  HAD++WK +R++LW+ +  +G
Sbjct:    3 SLFWSVFGLTELNSFG--TNDAKFT---ITKETGEVMFGFFQVIAVIVAVNMLIAMMTRSFESIAEHADVKWKVSRTRLWMSWIQKG 84          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc5a (short transient receptor potential channel 5 [Source:NCBI gene;Acc:101169488])

HSP 1 Score: 428.713 bits (1101), Expect = 9.090e-139
Identity = 235/529 (44.42%), Postives = 336/529 (63.52%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHE---KEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLG----NPN--------IHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYF 1538
            TI +PH   C C  C  S + D+LRHS  R++ Y+ALASP+ I L+S+DPIL AF+L  EL +LS  ENEF++ Y +LS QCK  A DLL++ RS++E+  ILN  +     E   ++     +LKLAIK+ QK FVA P+CQ+LL  +WY+  P W       +L  C  I +L P+ + IYL+ P+  LG F++ P +KFI H+AS+  FL L+L+AS H    ++ +     +GP P++VE +I+ WV+GF+W+E+K++W+ G   Y   WWN +DF M  LYL T+SL+I A       KY +   PR  W    PTLI+EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+       PN          NN F TL  T ++L+W++FG+ ++   ++K           T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YFDEG TLPPP N + S K ++ L ++ 
Sbjct:  167 TIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKRFAKDLLDQARSSRELETILNHRDSDQSEELDPRQCHDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRHHWAVKLVTCFIIGLLFPVFSMIYLLAPKSALGRFIKKPFIKFICHTASYLTFLFLLLLASQHIARTNLHM-----QGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYV-----KY-NSSRPREEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETKASEEPNNCKGIRCERQNNAFSTLFETLQSLFWSIFGLLNLYVTNVKARH------EFTEFVGATMFGTYNIISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSVWYLLMWL 678          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc5a (short transient receptor potential channel 5 [Source:NCBI gene;Acc:101169488])

HSP 1 Score: 428.713 bits (1101), Expect = 1.037e-138
Identity = 235/529 (44.42%), Postives = 336/529 (63.52%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHE---KEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLG----NPN--------IHNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYF 1538
            TI +PH   C C  C  S + D+LRHS  R++ Y+ALASP+ I L+S+DPIL AF+L  EL +LS  ENEF++ Y +LS QCK  A DLL++ RS++E+  ILN  +     E   ++     +LKLAIK+ QK FVA P+CQ+LL  +WY+  P W       +L  C  I +L P+ + IYL+ P+  LG F++ P +KFI H+AS+  FL L+L+AS H    ++ +     +GP P++VE +I+ WV+GF+W+E+K++W+ G   Y   WWN +DF M  LYL T+SL+I A       KY +   PR  W    PTLI+EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+       PN          NN F TL  T ++L+W++FG+ ++   ++K           T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YFDEG TLPPP N + S K ++ L ++ 
Sbjct:  170 TIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKRFAKDLLDQARSSRELETILNHRDSDQSEELDPRQCHDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRHHWAVKLVTCFIIGLLFPVFSMIYLLAPKSALGRFIKKPFIKFICHTASYLTFLFLLLLASQHIARTNLHM-----QGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYV-----KY-NSSRPREEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETKASEEPNNCKGIRCERQNNAFSTLFETLQSLFWSIFGLLNLYVTNVKARH------EFTEFVGATMFGTYNIISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSVWYLLMWL 681          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc4a (transient receptor potential cation channel subfamily C member 4 [Source:NCBI gene;Acc:101170611])

HSP 1 Score: 422.935 bits (1086), Expect = 1.470e-137
Identity = 240/557 (43.09%), Postives = 345/557 (61.94%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNE-KYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI------------HNNQFGTLVSTYKNLYWNMFGVSS--IPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSK-------WI-YRLCVYF-LKTSQRFVNLLKITYRKFR 1595
            ++ QPH   C+C  C  S   D+LRHS  R++ Y+AL+SP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS QCK  A DLL++ RS++E+  ILN  ++     ++      RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       +L  C+ I +L P+ A  YL+ P+ + G F+R P +KFI H+AS+  FL L+L+AS H  + +    R  ++GP P+ VE +I+ WV+GF+W+E+KQ+W+ G + Y   WWN +DF+M  LYL T+SL+I A       KY     PR  W    PTL++EALF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+    +              NN F +L  T ++L+W++FG+ S  + N+D        +  + T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HADIEWK+AR+KLW+ YF+EG TLP P N + S K       WI  R+C    LK+++ F  L +      R
Sbjct:  167 SMPQPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALSSPSLIALSSEDPFLTAFRLSWELQELSKVENEFKSEYEELSQQCKQFAKDLLDQTRSSRELEMILNYRDDINLLDDEGNNELARLKLAIKYHQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAGKLITCVFIGLLFPLFAFCYLIAPKSRYGNFIRKPFIKFICHTASYLTFLFLLLLASQHIVATEQD--RQNRQGPAPTTVEWMILPWVLGFIWAEIKQMWDGGFQDYIHDWWNLMDFVMNSLYLATISLKIVAY-----TKYSGTK-PRNQWEMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETKASDERGKCKGIRCVEQNNAFSSLFETLQSLFWSIFGLISLYVTNVD--------ADHQFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQHIADHADIEWKFARTKLWMSYFEEGATLPTPFNIIPSPKSFWYLMCWIKRRVCKRTRLKSAENFGTLGRRAAENLR 707          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc4b (short transient receptor potential channel 4 [Source:NCBI gene;Acc:101154885])

HSP 1 Score: 416.772 bits (1070), Expect = 1.053e-135
Identity = 233/531 (43.88%), Postives = 334/531 (62.90%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNE-KYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKY-GHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI--------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLKTSQRF 1559
            +I QPH   C C  C  S   D LR+S  R++ Y+ALASP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS  CK  A DLL++ RS+KE+  ILN  ++     ++      RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       +L  C  I +L P+L+  YL++P+ + G  +R P VKFI H+AS+  FL L+ +AS H +S     +    +GP P+ VE +I+ W+IGF+W+E+KQ+W+ G + Y   WWN +DFIM  LYL T++L+I A ++++   Y G +  P   W    PTL++E+LF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+               NN F TL  T ++L+W++FG+ S+   ++K           T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HAD+EWK+AR+KLW+ YF+EG TLPPP N + S K +   C  F    +RF
Sbjct:  167 SIPQPHAVRCSCVECMSSTDVDCLRYSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELKELSRVENEFKSEYEELSHTCKQFAKDLLDQTRSSKELEIILNYRDDINPILDESTNDLARLKLAIKYCQKEFVAQPNCQQLLASRWYDKFPGWRRRHWAGKLITCFFIGLLFPLLSIFYLIFPKSRYGLLIRKPFVKFICHTASYLTFLLLLFLASQHIDSTGPNSLSHDVQGPPPTTVEWMILPWIIGFIWTEIKQMWDNGLEDYADDWWNIMDFIMNSLYLATIALKIVA-YVKMKVLYVGCR--PLDDWEVWHPTLLAESLFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYATEEKSCYGIRCLQQNNAFSTLFETVQSLFWSVFGLVSLYVTNVK------PPHEFTEFVGTTMFGTYNIISLVVLLNMLIAMMNNSYQHIADHADMEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSV---CYLFGWIRKRF 685          
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Match: trpc4b (short transient receptor potential channel 4 [Source:NCBI gene;Acc:101154885])

HSP 1 Score: 414.075 bits (1063), Expect = 9.764e-135
Identity = 230/530 (43.40%), Postives = 332/530 (62.64%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNE-KYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPF--TRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNI--------HNNQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLKTSQRF 1559
            +I QPH   C C  C  S   D LR+S  R++ Y+ALASP+ I L+S+DP L AF+LS EL +LS  ENEFK  Y +LS  CK  A DLL++ RS+KE+  ILN  ++     ++      RLKLAIK+ QK FVA P+CQ+LL + WY+  P W       +L  C  I +L P+L+  YL++P+ + G  +R P VKFI H+AS+  FL L+ +AS H +S     +    +GP P+ VE +I+ W+IGF+W+E+KQ+W+ G + Y   WWN +DFIM  LYL T++L+I A ++++      ++     W    PTL++E+LF+IA +FS  R+I LF  N HLGPLQISLG+ML+DI+KF FI+ LV+ +FA GL+QLY+Y+               NN F TL  T ++L+W++FG+ S+   ++K           T  V   +   Y+ ++++VL+NM IAMM+NS+Q I +HAD+EWK+AR+KLW+ YF+EG TLPPP N + S K +   C  F    +RF
Sbjct:  167 SIPQPHAVRCSCVECMSSTDVDCLRYSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELKELSRVENEFKSEYEELSHTCKQFAKDLLDQTRSSKELEIILNYRDDINPILDESTNDLARLKLAIKYCQKEFVAQPNCQQLLASRWYDKFPGWRRRHWAGKLITCFFIGLLFPLLSIFYLIFPKSRYGLLIRKPFVKFICHTASYLTFLLLLFLASQHIDSTGPNSLSHDVQGPPPTTVEWMILPWIIGFIWTEIKQMWDNGLEDYADDWWNIMDFIMNSLYLATIALKIVA-YVKM------KNHCMDDWEVWHPTLLAESLFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYATEEKSCYGIRCLQQNNAFSTLFETVQSLFWSVFGLVSLYVTNVK------PPHEFTEFVGTTMFGTYNIISLVVLLNMLIAMMNNSYQHIADHADMEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSV---CYLFGWIRKRF 680          
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000024108.1 (SMESG000024108.1)

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 339/340 (99.71%), Postives = 340/340 (100.00%), Query Frame = 3
Query:    3 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQI 1022
            TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHSASFAIFLALILIASAHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQ+
Sbjct:  163 TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEWSSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHSASFAIFLALILIASAHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQV 502          
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000039904.1 (SMESG000039904.1)

HSP 1 Score: 400.979 bits (1029), Expect = 7.859e-129
Identity = 227/555 (40.90%), Postives = 332/555 (59.82%), Query Frame = 3
Query:    6 IEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEK----------EILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEW-SSPFT-RLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXX-----XHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYY----------------YFLGNPNIHNNQ-----------FGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYF 1538
            I +PH   C C  C ES ++D+LRHS  RI+ Y+ALASP+ I L+S+DPIL AF+LS EL +L   ENEFK  Y  LS +C+  A  LLE+ R ++E+  +LN SN  + +            +     RLKLAIK+ QK FVAHPHCQ+LL ++WY  +P +   PF  ++ +  GI  + P+LA IYL+YP+      ++ P +KFI HS+S+ +FL L+++A+      H E++D        RG  P+++E +++ ++ GF+W EVK++WE G K Y    WN LDF    LY+ T+SLR  A +   ++       P+  W S DPTLISE LF+ A +FS  +++++F +N +LGPLQISLG+ML DI+KF  I++LV+ +FACGL+QL +                YFL   N   N+           F +L    ++LYW+ +G+  + N++++         + T  V + +   Y  +T+IVL+NM IAMM+ S+Q I   ADIEWK+ARSKLWI YF++G TLP P N +IS K IY L  +F
Sbjct:  189 IPKPHDLRCACDICVESQKQDSLRHSKSRINAYQALASPSLIALSSKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMLFLLLLILAALRIEYNHLENDDY-------RGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENIISMGRPK--WDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEY------PHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWF 728          
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000039904.1 (SMESG000039904.1)

HSP 1 Score: 400.979 bits (1029), Expect = 8.289e-129
Identity = 227/555 (40.90%), Postives = 332/555 (59.82%), Query Frame = 3
Query:    6 IEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNEKYCHEK----------EILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEW-SSPFT-RLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXX-----XHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYY----------------YFLGNPNIHNNQ-----------FGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYF 1538
            I +PH   C C  C ES ++D+LRHS  RI+ Y+ALASP+ I L+S+DPIL AF+LS EL +L   ENEFK  Y  LS +C+  A  LLE+ R ++E+  +LN SN  + +            +     RLKLAIK+ QK FVAHPHCQ+LL ++WY  +P +   PF  ++ +  GI  + P+LA IYL+YP+      ++ P +KFI HS+S+ +FL L+++A+      H E++D        RG  P+++E +++ ++ GF+W EVK++WE G K Y    WN LDF    LY+ T+SLR  A +   ++       P+  W S DPTLISE LF+ A +FS  +++++F +N +LGPLQISLG+ML DI+KF  I++LV+ +FACGL+QL +                YFL   N   N+           F +L    ++LYW+ +G+  + N++++         + T  V + +   Y  +T+IVL+NM IAMM+ S+Q I   ADIEWK+ARSKLWI YF++G TLP P N +IS K IY L  +F
Sbjct:  192 IPKPHDLRCACDICVESQKQDSLRHSKSRINAYQALASPSLIALSSKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMLFLLLLILAALRIEYNHLENDDY-------RGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENIISMGRPK--WDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEY------PHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWF 731          
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000077497.1 (SMESG000077497.1)

HSP 1 Score: 374.785 bits (961), Expect = 3.830e-121
Identity = 221/549 (40.26%), Postives = 324/549 (59.02%), Query Frame = 3
Query:    6 IEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNE-------KYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEW-SSPFT-RLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGN---------------------PNIHN------NQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLK 1544
            I +PH   C C  C E+ + D+L HS+ RI+ Y+ALASP  I L+S+DP+L AF+LS ELS+LS  ENEF   Y +LS +C+  A  LLE+ R + E+  +LN ++         Y    +  S  RLKLAIK+ QK FVA+PHCQ+LL + WY  +P +   PF  +L +   +  + P L  +YLV+P+ K+G  +R P +KFI HSAS+ IFLAL+++A+   E  + ++M    R   P+ +E L+V ++ GF+W E+K++W  G K Y    WN LDF    LY+ T+SLR  A + + +         R  W S DP LISE LFS A +FS  +++ +F +N HLGPLQISLG+ML DI+KF  +++LV+ +FACGL+QL +++                         +++N        F  L    ++LYW+ +G+  +  ++++           T  V + +  VY  +T++VL+NM IAMM+ S+Q I   ADIEWK+ARSKLWI YF++G TLP P N +IS K IY    YFL+
Sbjct:  145 IPKPHDLRCSCQICVEAQKIDSLHHSMSRINAYKALASPCLIALSSKDPVLTAFELSWELSRLSRLENEFASEYEKLSKKCEEFATALLEQTRESSELAVLLNHNSTSVGVNDINYGDSFQTHSLTRLKLAIKYNQKSFVANPHCQQLLASFWYEGLPGFRRKPFIYKLTIISALGFMFPGLGVVYLVFPRSKIGRLMRKPFIKFICHSASYIIFLALLILAALRIEFTNSEVME--SRQNPPTAIECLLVVYICGFIWQEIKELWIAGVKCYIMDMWNLLDFATNALYVATISLRAVA-YYKFNNVENLLQEQRPKWDSYDPILISECLFSAANIFSTLKLVSIFTMNPHLGPLQISLGRMLNDILKFFCVYMLVLIAFACGLNQLLWFYAKKRRDICAKSSHRFFQPSEKEPVSDLYNYCATRGKYFTNLFEIVQSLYWSTYGLVDLTYLNLEY------PHEFTEFVGKLMFGVYSVITLVVLLNMLIAMMNTSYQIIVEKADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKAIY----YFLR 680          
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Match: SMESG000077497.1 (SMESG000077497.1)

HSP 1 Score: 374.785 bits (961), Expect = 4.460e-121
Identity = 221/549 (40.26%), Postives = 324/549 (59.02%), Query Frame = 3
Query:    6 IEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDPILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVICILNKSNE-------KYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNSMPEW-SSPFT-RLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINHXXXXXXXXXXXXXXXXHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFVWSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKYGHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQISLGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGN---------------------PNIHN------NQFGTLVSTYKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIVLINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLISSKWIYRLCVYFLK 1544
            I +PH   C C  C E+ + D+L HS+ RI+ Y+ALASP  I L+S+DP+L AF+LS ELS+LS  ENEF   Y +LS +C+  A  LLE+ R + E+  +LN ++         Y    +  S  RLKLAIK+ QK FVA+PHCQ+LL + WY  +P +   PF  +L +   +  + P L  +YLV+P+ K+G  +R P +KFI HSAS+ IFLAL+++A+   E  + ++M    R   P+ +E L+V ++ GF+W E+K++W  G K Y    WN LDF    LY+ T+SLR  A + + +         R  W S DP LISE LFS A +FS  +++ +F +N HLGPLQISLG+ML DI+KF  +++LV+ +FACGL+QL +++                         +++N        F  L    ++LYW+ +G+  +  ++++           T  V + +  VY  +T++VL+NM IAMM+ S+Q I   ADIEWK+ARSKLWI YF++G TLP P N +IS K IY    YFL+
Sbjct:  158 IPKPHDLRCSCQICVEAQKIDSLHHSMSRINAYKALASPCLIALSSKDPVLTAFELSWELSRLSRLENEFASEYEKLSKKCEEFATALLEQTRESSELAVLLNHNSTSVGVNDINYGDSFQTHSLTRLKLAIKYNQKSFVANPHCQQLLASFWYEGLPGFRRKPFIYKLTIISALGFMFPGLGVVYLVFPRSKIGRLMRKPFIKFICHSASYIIFLALLILAALRIEFTNSEVME--SRQNPPTAIECLLVVYICGFIWQEIKELWIAGVKCYIMDMWNLLDFATNALYVATISLRAVA-YYKFNNVENLLQEQRPKWDSYDPILISECLFSAANIFSTLKLVSIFTMNPHLGPLQISLGRMLNDILKFFCVYMLVLIAFACGLNQLLWFYAKKRRDICAKSSHRFFQPSEKEPVSDLYNYCATRGKYFTNLFEIVQSLYWSTYGLVDLTYLNLEY------PHEFTEFVGKLMFGVYSVITLVVLLNMLIAMMNTSYQIIVEKADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKAIY----YFLR 693          
The following BLAST results are available for this feature:
BLAST of Transient-receptor-potential-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPC41.886e-14144.81transient receptor potential cation channel subfam... [more]
TRPC44.655e-14144.81transient receptor potential cation channel subfam... [more]
TRPC42.866e-14044.81transient receptor potential cation channel subfam... [more]
TRPC42.992e-14044.81transient receptor potential cation channel subfam... [more]
TRPC52.568e-13844.38transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp-12.774e-16146.01Transient-receptor-potential-like protein [Source... [more]
trp-14.556e-16146.01Transient-receptor-potential-like protein [Source... [more]
trp-21.529e-11536.54TRP (Transient receptor potential) channel family;... [more]
trp-21.330e-11436.54TRP (Transient receptor potential) channel family;... [more]
spe-412.510e-2220.65TRP homologous cation channel protein; TRP-3 chann... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpl2.412e-11538.16gene:FBgn0005614 transcript:FBtr0088471[more]
trpl2.412e-11538.16gene:FBgn0005614 transcript:FBtr0301662[more]
trpl2.412e-11538.16gene:FBgn0005614 transcript:FBtr0088473[more]
Trpgamma1.567e-11339.64gene:FBgn0032593 transcript:FBtr0080945[more]
Trpgamma1.567e-11339.64gene:FBgn0032593 transcript:FBtr0080946[more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc4b6.095e-14145.07transient receptor potential cation channel, subfa... [more]
trpc4b6.095e-14145.07transient receptor potential cation channel, subfa... [more]
trpc5a2.882e-14044.76transient receptor potential cation channel, subfa... [more]
trpc5a3.031e-14044.76transient receptor potential cation channel, subfa... [more]
trpc5a3.732e-14044.76transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPC51.031e-13943.96transient receptor potential cation channel, subfa... [more]
hint13.265e-13442.83histidine triad nucleotide binding protein 1 [Sour... [more]
nup1888.057e-11840.22nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
nup1889.490e-11840.22nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
nup1883.786e-11740.22nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpc43.059e-14144.81transient receptor potential cation channel, subfa... [more]
Trpc41.184e-14044.81transient receptor potential cation channel, subfa... [more]
Trpc51.809e-13844.38transient receptor potential cation channel, subfa... [more]
Trpc71.587e-11639.23transient receptor potential cation channel, subfa... [more]
Trpc71.730e-11639.23transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P34586|TRPL_CAEEL3.529e-16046.01Transient-receptor-potential-like protein OS=Caeno... [more]
sp|Q9QUQ5|TRPC4_MOUSE8.283e-14044.81Short transient receptor potential channel 4 OS=Mu... [more]
sp|O35119|TRPC4_RAT1.161e-13944.81Short transient receptor potential channel 4 OS=Ra... [more]
sp|Q9UBN4|TRPC4_HUMAN1.376e-13944.81Short transient receptor potential channel 4 OS=Ho... [more]
sp|P79100|TRPC4_BOVIN2.050e-13944.62Short transient receptor potential channel 4 OS=Bo... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GJE90.000e+054.77ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A1I8JC650.000e+054.77ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A1I8I4R70.000e+057.47Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A210R2660.000e+055.70Transient-receptor-potential-like protein OS=Mizuh... [more]
A0A0F7VHQ10.000e+051.92Eka-Trp1 protein OS=Euperipatoides kanangrensis OX... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc5a1.936e-13944.13short transient receptor potential channel 5-like ... [more]
trpc4a4.987e-13843.38short transient receptor potential channel 4-like ... [more]
trpc4b1.331e-13543.66short transient receptor potential channel 4-like ... [more]
trpc5b5.978e-12542.08transient receptor potential cation channel, subfa... [more]
trpc6a1.687e-12040.04short transient receptor potential channel 6-like ... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc4b2.085e-12341.32transient receptor potential cation channel, subfa... [more]
trpc4b4.601e-12240.60transient receptor potential cation channel, subfa... [more]
trpc35.689e-9436.64transient receptor potential cation channel, subfa... [more]
ENSPMAT00000001180.12.633e-1534.82pep scaffold:Pmarinus_7.0:GL486488:994:2494:1 gene... [more]
ENSPMAT00000007332.14.686e-1125.49pep scaffold:Pmarinus_7.0:GL483392:1130:9476:1 gen... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO453115.207e-8435.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483469.373e-6831.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493021.248e-3929.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311003.411e-2224.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362845.435e-1434.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc5a9.090e-13944.42short transient receptor potential channel 5 [Sour... [more]
trpc5a1.037e-13844.42short transient receptor potential channel 5 [Sour... [more]
trpc4a1.470e-13743.09transient receptor potential cation channel subfam... [more]
trpc4b1.053e-13543.88short transient receptor potential channel 4 [Sour... [more]
trpc4b9.764e-13543.40short transient receptor potential channel 4 [Sour... [more]
back to top
BLAST of Transient-receptor-potential-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024108.10.000e+099.71SMESG000024108.1[more]
SMESG000039904.17.859e-12940.90SMESG000039904.1[more]
SMESG000039904.18.289e-12940.90SMESG000039904.1[more]
SMESG000077497.13.830e-12140.26SMESG000077497.1[more]
SMESG000077497.14.460e-12140.26SMESG000077497.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025288 ID=SMED30025288|Name=Transient-receptor-potential-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1600bp
CTACAATAGAACAACCTCATCCAGCTTCATGCCATTGCCATCCATGCCAA
GAGAGCATCCAAAGAGACACATTACGACATTCATTAAGAAGAATTAGCAC
ATATCGAGCCTTAGCAAGTCCAGCTTGGATTTGTTTAACATCTCAAGATC
CGATTCTAGATGCGTTCAAGCTATCAGTTGAATTAAGCAAGCTGTCGAGT
TGCGAAAACGAATTTAAGGAGACTTATTTACAACTGTCAGACCAATGCAA
GGGGTTAGCCTGTGATTTACTGGAAGAATGCCGATCTAATAAAGAAGTCA
TTTGCATTTTGAACAAATCAAATGAGAAATACTGCCATGAAAAAGAAATT
CTCAGTTTCAAGCGGTTGAAATTAGCAATAAAATTTGAACAAAAACATTT
TGTTGCGCATCCACATTGCCAGAAACTCCTCAACAACATTTGGTACAATT
CGATGCCGGAATGGAGCAGTCCTTTTACACGGCTTTTTCTCTGTCTAGGA
ATCGTTATATTATTACCAATTTTAGCACCAATTTATTTAGTTTATCCCCA
AGGAAAACTTGGAACTTTTCTTCGCAGTCCTCTCGTTAAGTTTATCAATC
ACAGTGCATCATTCGCTATATTTTTGGCACTAATTCTTATTGCATCGGCT
CACAACGAGTCCGAAGACATAAAAATCATGAGGTTTATCAAGCGAGGCCC
AGAACCAAGTTTAGTTGAAGGGTTAATTGTGTGGTGGGTGATAGGATTTG
TTTGGAGTGAAGTAAAGCAAATTTGGGAGGAAGGAAGTAAAGCTTATACT
AGACAGTGGTGGAACTGGCTTGATTTTATTATGCTTTGTCTTTATTTATG
TACAGTATCACTGAGAATAGCAGCGTTATGGTTACGCCTGTCCCAAAAAT
ACGGACATCAAGATCTACCTCGAACGTCATGGCCTTCAGATGATCCAACA
CTGATATCAGAAGCCCTGTTTTCAATAGCAATTGTATTTAGTTTTGCAAG
GATTATATTCCTTTTTCAAATAAATGAACATTTGGGACCTTTGCAAATAT
CACTTGGAAAAATGTTAATTGACATAATCAAATTTGCATTTATCTTTCTT
TTGGTCATAACTTCGTTTGCTTGTGGCTTGCATCAGTTGTATTATTATTT
TCTTGGCAATCCAAATATTCATAACAATCAATTTGGAACGTTAGTTTCGA
CGTATAAGAACCTTTACTGGAACATGTTTGGGGTGTCGTCAATTCCGAAT
ATTGATATTAAAGTGAATGACACCAGAGTTTCCTCAGCAAGGATAACAGT
TGCAGTCGCGGAATTCTTACTACTAGTCTACCATTCCATGACAGTGATAG
TGTTGATTAACATGTTCATTGCAATGATGTCAAATTCCTTTCAAACTATT
CATAATCATGCCGATATTGAATGGAAATATGCTCGAAGTAAGTTATGGAT
TGGTTACTTCGACGAAGGATGTACGCTACCCCCTCCTTTAAACACATTAA
TTAGCAGCAAGTGGATATATAGACTATGTGTATATTTTCTAAAAACTTCC
CAGAGATTTGTGAATTTATTGAAGATTACTTACAGAAAATTCCGAGGAGA
back to top

protein sequence of SMED30025288-orf-1

>SMED30025288-orf-1 ID=SMED30025288-orf-1|Name=SMED30025288-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=532bp
TIEQPHPASCHCHPCQESIQRDTLRHSLRRISTYRALASPAWICLTSQDP
ILDAFKLSVELSKLSSCENEFKETYLQLSDQCKGLACDLLEECRSNKEVI
CILNKSNEKYCHEKEILSFKRLKLAIKFEQKHFVAHPHCQKLLNNIWYNS
MPEWSSPFTRLFLCLGIVILLPILAPIYLVYPQGKLGTFLRSPLVKFINH
SASFAIFLALILIASAHNESEDIKIMRFIKRGPEPSLVEGLIVWWVIGFV
WSEVKQIWEEGSKAYTRQWWNWLDFIMLCLYLCTVSLRIAALWLRLSQKY
GHQDLPRTSWPSDDPTLISEALFSIAIVFSFARIIFLFQINEHLGPLQIS
LGKMLIDIIKFAFIFLLVITSFACGLHQLYYYFLGNPNIHNNQFGTLVST
YKNLYWNMFGVSSIPNIDIKVNDTRVSSARITVAVAEFLLLVYHSMTVIV
LINMFIAMMSNSFQTIHNHADIEWKYARSKLWIGYFDEGCTLPPPLNTLI
SSKWIYRLCVYFLKTSQRFVNLLKITYRKFRG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002153TRPC_channel
IPR005821Ion_trans_dom
IPR013555TRP_dom
Vocabulary: molecular function
TermDefinition
GO:0005262calcium channel activity
GO:0005216ion channel activity
GO:0005515protein binding
GO:0008013beta-catenin binding
GO:0015279store-operated calcium channel activity
GO:0045296cadherin binding
GO:0070679inositol 1,4,5 trisphosphate binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0005901caveola
GO:0005911cell-cell junction
GO:0009986cell surface
GO:0016021integral component of membrane
GO:0016323basolateral plasma membrane
GO:0030863cortical cytoskeleton
GO:0034704calcium channel complex
GO:0043234protein complex
GO:0045121membrane raft
Vocabulary: biological process
TermDefinition
GO:0070588calcium ion transmembrane transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0006816calcium ion transport
GO:0006828manganese ion transport
GO:0014051gamma-aminobutyric acid secretion
GO:0048709oligodendrocyte differentiation
GO:0051480regulation of cytosolic calcium ion concentration
GO:0070509calcium ion import
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002153Transient receptor potential channel, canonicalPRINTSPR01097TRNSRECEPTRPcoord: 491..504
score: 53.78
coord: 441..462
score: 48.66
coord: 463..476
score: 57.98
IPR002153Transient receptor potential channel, canonicalPANTHERPTHR10117TRANSIENT RECEPTOR POTENTIAL CHANNELcoord: 1..508
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 206..470
e-value: 7.9E-26
score: 90.8
IPR013555Transient receptor ion channel domainPFAMPF08344TRP_2coord: 10..72
e-value: 1.8E-26
score: 92.1
NoneNo IPR availablePANTHERPTHR10117:SF46TRANSIENT-RECEPTOR-POTENTIAL-LIKE PROTEINcoord: 1..508
NoneNo IPR availableTMHMMTMhelixcoord: 272..294
NoneNo IPR availableTMHMMTMhelixcoord: 197..216
NoneNo IPR availableTMHMMTMhelixcoord: 160..182
NoneNo IPR availableTMHMMTMhelixcoord: 359..381
NoneNo IPR availableTMHMMTMhelixcoord: 434..456
NoneNo IPR availableTMHMMTMhelixcoord: 316..338