Delta-like protein

Overview
NameDelta-like protein
Smed IDSMED30025285
Length (bp)1946
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Delta-like protein (SMED30025285) t-SNE clustered cells

Violin plots show distribution of expression levels for Delta-like protein (SMED30025285) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Delta-like protein (SMED30025285) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Delta-like protein (SMED30025285) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025285

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30025285h1SMcG0010240 dd_Smed_v4_9663_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025285h1SMcG0010240 dd_Smed_v4_9663_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025285h1SMcG0010240 dd_Smed_v4_9663_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Delta-like protein vs. Ensembl Human
Match: NOTCH3 (notch receptor 3 [Source:HGNC Symbol;Acc:HGNC:7883])

HSP 1 Score: 73.1738 bits (178), Expect = 1.349e-12
Identity = 45/130 (34.62%), Postives = 59/130 (45.38%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDLCLYQSCVLDGKC-IEIDGKPQCMCN-GRIGPHCFPNYNPCR-SNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C  G++G  C+  D CL   C    +C +  DG+  C C  G  G  C  + + CR   PC++ G C+ N  G    RC C   + G LCE     C   PC N  TC    D    C CLPG+ G  C+
Sbjct:  108 CPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGEPCRHGGTCL-NTPGS--FRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCE 234          

HSP 2 Score: 71.633 bits (174), Expect = 4.312e-12
Identity = 53/161 (32.92%), Postives = 71/161 (44.10%), Query Frame = 3
Query:  681 CDHNRYGEKCEIFCKPSNLYKCSRNGKKLCNEGWKGEQCNEQ-DLCLYQS-CVLDGKCIEIDGKPQCMCNG-RIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV--PCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            C+H   G +CE    P  L  CS      C +GW+G +C +  D C   + C   G C  + G   C C+G   GP C  + N C  NPC N G C   + G     C C P F G  C + + E +  PC      ++   F   C C PGY G  C+Q+
Sbjct:  780 CEH---GGRCE--SAPGQLPVCS------CPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGGYTGPSCDQDINDCDPNPCLNGGSC---QDGVGSFSCSCLPGFAGPRCARDVDECLSNPCGPGTCTDHVASFT--CTCPPGYGGFHCEQD 924          

HSP 3 Score: 70.4774 bits (171), Expect = 7.774e-12
Identity = 55/191 (28.80%), Postives = 79/191 (41.36%), Query Frame = 3
Query:  681 CDHNRYGEKCEIFCKPSNLYKCSRNGKK-------LCNEGWKGEQCNEQDL-C----------LYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILC-----DQEPIIPVETTP 1175
            C  +  G +C+      +   C   G+        LC  GW G  C+ + L C          L Q C   G+C++ D    C+C  GR G HC    +PC + PC++ G C   +    G  C C P + G  CE  +  C   PC +  +C  D      C C PG  G+LC     D  P  P+++ P
Sbjct:  988 CLESFTGPQCQTLVDWCSRQPCQNGGRCVQTGAYCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCPEGRTGSHCEQEVDPCLAQPCQHGGTC---RGYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGGSC-IDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGP 1174          

HSP 4 Score: 69.707 bits (169), Expect = 1.462e-11
Identity = 46/130 (35.38%), Postives = 59/130 (45.38%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDL--CLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C  G+ G  C EQDL  C   SC   G C++      C+C  G  G HC    +PC S PC + G C        G RC C  +F G  C+  +  C   PC N   C     +   C+C PG++G LCD
Sbjct:  912 CPPGYGGFHC-EQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQHEADPCLSRPCLHGGVC---SAAHPGFRCTCLESFTGPQCQTLVDWCSRQPCQNGGRCVQTGAY---CLCPPGWSGRLCD 1034          

HSP 5 Score: 67.0106 bits (162), Expect = 1.115e-10
Identity = 50/152 (32.89%), Postives = 66/152 (43.42%), Query Frame = 3
Query:  747 SRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKC----IEIDGKPQCMC-NGRIGPHC-FPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEI---VPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            SR    LC  GW GE+C  +D C    C   G C    +    +  C C  G  GP C  P  +PC S+PC +  RC     G     C C P + G  C   + E     PC +  TC  +   + +C C  GYTG LC + P +P   +P
Sbjct:   60 SREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLP--DPCLSSPCAHGARCSVGPDGR--FLCSCPPGYQGRSCRSDVDECRVGEPCRHGGTC-LNTPGSFRCQCPAGYTGPLC-ENPAVPCAPSP 205          

HSP 6 Score: 64.6994 bits (156), Expect = 4.834e-10
Identity = 47/139 (33.81%), Postives = 63/139 (45.32%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVP---------CHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C EG  G  C ++ D CL Q C   G C    G   C C  G  G +C  + + C S PC++ G CI      +   C C P   GVLCE +  +  P         C +N TC  D     +C C PGYTG+ C+ +
Sbjct: 1071 VCPEGRTGSHCEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGGSCIDLVARYL---CSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTC-VDLVGGFRCTCPPGYTGLRCEAD 1205          

HSP 7 Score: 64.6994 bits (156), Expect = 5.219e-10
Identity = 55/184 (29.89%), Postives = 74/184 (40.22%), Query Frame = 3
Query:  681 CDHNRYGEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEG-RCIPNKTGEV---GIRCHCNPNFFGVLCEQSL--CEIVPCHNNAT--CEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            C   R G  CE    P     C   G            C  G+ G+ C +  D C  Q C   G CI++  +  C C  G +G  C  N + C   P  + G RC+ N T      G RC C P + G+ CE  +  C    CH   T  C  D     +C+C  G++G  C Q  + P E+ P
Sbjct: 1072 CPEGRTGSHCEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGGSCIDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGLRCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRC-QTVLSPCESQP 1254          

HSP 8 Score: 63.929 bits (154), Expect = 9.399e-10
Identity = 43/137 (31.39%), Postives = 64/137 (46.72%), Query Frame = 3
Query:  753 NGKKLCN--EGWKGEQCNEQ-DLCLYQS--CVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            NG+ +C    G+ G  C++  D C   +  C   G+C+   G   C C  G  GP C  + N C S PC+N+  C+ ++ G+    C C   F G  CE  +  C+  PC N   C+ D+     C C  G++G  C
Sbjct:  372 NGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCL-DRIGQ--FTCICMAGFTGTYCEVDIDECQSSPCVNGGVCK-DRVNGFSCTCPSGFSGSTC 504          

HSP 9 Score: 63.1586 bits (152), Expect = 1.427e-9
Identity = 45/144 (31.25%), Postives = 62/144 (43.06%), Query Frame = 3
Query:  765 LCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHNNAT---------CE-----YDKDFNRKCICLPGYTGILCDQE 1148
            LC  G+ G  C +E D CL + C+  G C       +C C     GP C    + C   PC+N GRC+     + G  C C P + G LC+      +PC   A          C+      D+D +  C+C  G TG  C+QE
Sbjct:  949 LCRPGYTGAHCQHEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQTLVDWCSRQPCQNGGRCV-----QTGAYCLCPPGWSGRLCD---IRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCPEGRTGSHCEQE 1084          

HSP 10 Score: 63.1586 bits (152), Expect = 1.796e-9
Identity = 54/173 (31.21%), Postives = 66/173 (38.15%), Query Frame = 3
Query:  666 SMSAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLC--EQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            S S  C     G +CE          C   GK L         C  G  G  C    D C    C   G C +   +  C+C  G  GP C    N C S+PC   G C+    GE G RC C P     LC      C   PC ++  C YD     +C+C PG++G  C Q
Sbjct:  565 SFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDLVDKYLCRCPSGTTGVNCEVNIDDCASNPCTF-GVCRDGINRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCV---DGENGFRCLCPPGSLPPLCLPPSHPCAHEPC-SHGIC-YDAPGGFRCVCEPGWSGPRCSQ 731          

HSP 11 Score: 58.5362 bits (140), Expect = 4.095e-8
Identity = 48/165 (29.09%), Postives = 65/165 (39.39%), Query Frame = 3
Query:  699 GEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQ--SCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE-QSLCEIVPCHNNATCEYDKDFNRK-CICLPGYTGILCDQE 1148
            G+ CE+       ++C   G  +         C   W G+ C E  D C  Q  +C   G C    G   C+C NG  G  C  N + C +  C +   C           C C     G+LC     C   PCH +A C+ +    R  C C PG+TG  CDQ+
Sbjct:  230 GQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATC---HDRVASFYCACPMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQD 391          

HSP 12 Score: 57.7658 bits (138), Expect = 7.306e-8
Identity = 40/134 (29.85%), Postives = 60/134 (44.78%), Query Frame = 3
Query:  765 LCNEGWKGEQCNE---QDLCLYQSCVLDGKCIEIDGKPQCMCNGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEI---VPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C  GW G +C++   +D C  Q C   G C        C C   +        +PC  NPC++ GRC  +  G++ + C C   + G  C+Q + E     PC  +  C  +   +  C C  GYTG  CDQ+
Sbjct:  719 VCEPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGRQCELLSPCTPNPCEHGGRC-ESAPGQLPV-CSCPQGWQGPRCQQDVDECAGPAPCGPHGICT-NLAGSFSCTCHGGYTGPSCDQD 849          

HSP 13 Score: 56.225 bits (134), Expect = 1.995e-7
Identity = 51/173 (29.48%), Postives = 70/173 (40.46%), Query Frame = 3
Query:  672 SAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKL----------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            S  C     G  C++         C RNG K           C EG++G  C+   D C    C   G+C++      C C  G  G  C    + CRS PC++ G+C+      +   C C     GV CE ++  C   PC     C  D      C+C PG+TG LC+ E
Sbjct:  492 SCTCPSGFSGSTCQLDVDECASTPC-RNGAKCVDQPDGYECRCAEGFEGTLCDRNVDDCSPDPC-HHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDLVDKYL---CRCPSGTTGVNCEVNIDDCASNPC-TFGVCR-DGINRYDCVCQPGFTGPLCNVE 657          

HSP 14 Score: 53.9138 bits (128), Expect = 1.113e-6
Identity = 44/141 (31.21%), Postives = 64/141 (45.39%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDL--CLYQSC--VLDGKCIEIDGKP-QCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPN--KTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIP 1160
            C  G+ G +C E D+  C   +C       C++  G   +C+C+ G  GP C    +PC S PC++ G+C P+    G +   CHC   F+G  CE+    C  + C     C+      R C C PG +G  C   P  P
Sbjct: 1193 CPPGYTGLRC-EADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPCESQPCQHGGQCRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPVGVPCQQTPRGPR-CACPPGLSGPSCRSFPGSP 1331          

HSP 15 Score: 52.373 bits (124), Expect = 3.222e-6
Identity = 51/205 (24.88%), Postives = 77/205 (37.56%), Query Frame = 3
Query:  669 MSAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKLCNEGWKGEQC-NEQDLC-LYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKN---------------------------------------EGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVP--CHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            +S+ C H   G +C +   P   + CS      C  G++G  C ++ D C + + C   G C+   G  +C C  G  GP C     PC  +PC+N                                        G C+    G     C C P + G  C + +  C++ P  CHN  TC ++      C+C+ G+TG  C Q
Sbjct:  124 LSSPCAH---GARCSV--GPDGRFLCS------CPPGYQGRSCRSDVDECRVGEPCRHGGTCLNTPGSFRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCV---DGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTC-FNTLGGHSCVCVNGWTGESCSQ 313          

HSP 16 Score: 51.2174 bits (121), Expect = 6.471e-6
Identity = 52/174 (29.89%), Postives = 72/174 (41.38%), Query Frame = 3
Query:  666 SMSAQCDHNRYGEKCE---IFCKPS---NLYKCSRNGKKL----CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCNGR-IGPHCFPNYNPCRSNP--CKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            S   QC     G  CE   + C PS   N   C ++G       C  G++G+ C    D C    C+  G C++      C C     G  C  + + C+  P  C N G C  N  G  G  C C   + G  C Q++  C    C + ATC +D+  +  C C  G TG+LC
Sbjct:  180 SFRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCF-NTLG--GHSCVCVNGWTGESCSQNIDDCATAVCFHGATC-HDRVASFYCACPMGKTGLLC 349          
BLAST of Delta-like protein vs. Ensembl Human
Match: SVEP1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:15985])

HSP 1 Score: 70.4774 bits (171), Expect = 1.043e-11
Identity = 49/131 (37.40%), Postives = 67/131 (51.15%), Query Frame = 3
Query:  765 LCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            LC  G+ G +C  + D C    C+ +G C ++ G+  C C +G  G  C  N N C S+PC N+G C+    G  G RC C   F G+ CE  +  C+  PC NNA CE D+     C C PG+ G  C +
Sbjct: 1218 LCPLGYTGLKCETDIDECSPLPCLNNGVCKDLVGEFICECPSGYTGQRCEENINECSSSPCLNKGICV---DGVAGYRCTCVKGFVGLHCETEVNECQSNPCLNNAVCE-DQVGGFLCKCPPGFLGTRCGK 1344          

HSP 2 Score: 68.1662 bits (165), Expect = 4.371e-11
Identity = 45/129 (34.88%), Postives = 66/129 (51.16%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C  G+ G++C E  + C    C+  G C++     +C C  G +G HC    N C+SNPC N   C  ++ G  G  C C P F G  C +++  C   PC N ATC+ D   + +C+C  G+TG  C+
Sbjct: 1257 CPSGYTGQRCEENINECSSSPCLNKGICVDGVAGYRCTCVKGFVGLHCETEVNECQSNPCLNNAVC-EDQVG--GFLCKCPPGFLGTRCGKNVDECLSQPCKNGATCK-DGANSFRCLCAAGFTGSHCE 1381          

HSP 3 Score: 62.7734 bits (151), Expect = 2.395e-9
Identity = 54/175 (30.86%), Postives = 77/175 (44.00%), Query Frame = 3
Query:  678 QCDHNRYGEKCEIFCKPSNLYKCSRN---GKKLCNEGWKGEQCN------------EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C     G++CE      N+ +CS +    K +C +G  G +C             E + C    C+ +  C +  G   C C  G +G  C  N + C S PCKN   C   K G    RC C   F G  CE ++  C+  PC N ATC  D+  +  C C PG++G  C+ E
Sbjct: 1256 ECPSGYTGQRCE-----ENINECSSSPCLNKGICVDGVAGYRCTCVKGFVGLHCETEVNECQSNPCLNNAVCEDQVGGFLCKCPPGFLGTRCGKNVDECLSQPCKNGATC---KDGANSFRCLCAAGFTGSHCELNINECQSNPCRNQATC-VDELNSYSCKCQPGFSGKRCETE 1421          
BLAST of Delta-like protein vs. Ensembl Human
Match: SVEP1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:15985])

HSP 1 Score: 70.0922 bits (170), Expect = 1.061e-11
Identity = 49/131 (37.40%), Postives = 67/131 (51.15%), Query Frame = 3
Query:  765 LCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            LC  G+ G +C  + D C    C+ +G C ++ G+  C C +G  G  C  N N C S+PC N+G C+    G  G RC C   F G+ CE  +  C+  PC NNA CE D+     C C PG+ G  C +
Sbjct: 1218 LCPLGYTGLKCETDIDECSPLPCLNNGVCKDLVGEFICECPSGYTGQRCEENINECSSSPCLNKGICV---DGVAGYRCTCVKGFVGLHCETEVNECQSNPCLNNAVCE-DQVGGFLCKCPPGFLGTRCGK 1344          

HSP 2 Score: 68.1662 bits (165), Expect = 4.484e-11
Identity = 45/129 (34.88%), Postives = 66/129 (51.16%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C  G+ G++C E  + C    C+  G C++     +C C  G +G HC    N C+SNPC N   C  ++ G  G  C C P F G  C +++  C   PC N ATC+ D   + +C+C  G+TG  C+
Sbjct: 1257 CPSGYTGQRCEENINECSSSPCLNKGICVDGVAGYRCTCVKGFVGLHCETEVNECQSNPCLNNAVC-EDQVG--GFLCKCPPGFLGTRCGKNVDECLSQPCKNGATCK-DGANSFRCLCAAGFTGSHCE 1381          

HSP 3 Score: 62.3882 bits (150), Expect = 2.521e-9
Identity = 54/175 (30.86%), Postives = 77/175 (44.00%), Query Frame = 3
Query:  678 QCDHNRYGEKCEIFCKPSNLYKCSRN---GKKLCNEGWKGEQCN------------EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C     G++CE      N+ +CS +    K +C +G  G +C             E + C    C+ +  C +  G   C C  G +G  C  N + C S PCKN   C   K G    RC C   F G  CE ++  C+  PC N ATC  D+  +  C C PG++G  C+ E
Sbjct: 1256 ECPSGYTGQRCE-----ENINECSSSPCLNKGICVDGVAGYRCTCVKGFVGLHCETEVNECQSNPCLNNAVCEDQVGGFLCKCPPGFLGTRCGKNVDECLSQPCKNGATC---KDGANSFRCLCAAGFTGSHCELNINECQSNPCRNQATC-VDELNSYSCKCQPGFSGKRCETE 1421          
BLAST of Delta-like protein vs. Ensembl Human
Match: NOTCH2 (notch receptor 2 [Source:HGNC Symbol;Acc:HGNC:7882])

HSP 1 Score: 69.707 bits (169), Expect = 1.365e-11
Identity = 51/134 (38.06%), Postives = 71/134 (52.99%), Query Frame = 3
Query:  765 LCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCI--PNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            LC  G+KG  C  E + C    CV +G+C++   + QC+C  G  GP C  + + C S PC N  +CI  PN     G  C C   F GVLCE+++  C+  PCH+   C+   D +  CIC PGY G +C  +
Sbjct:  481 LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPN-----GYECQCATGFTGVLCEENIDNCDPDPCHH-GQCQDGID-SYTCICNPGYMGAICSDQ 607          

HSP 2 Score: 63.5438 bits (153), Expect = 1.244e-9
Identity = 47/131 (35.88%), Postives = 67/131 (51.15%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDL--CLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            C +G+ G +C E D+  C    C  D  C++  G   C+C  G  G HC    N C+SNPC N G+C+ +K      +C C P F G +C+  +  C   PC N A C  D     +C C  G+TG+LC++
Sbjct:  444 CLKGYAGPRC-EMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCV-DKVNR--FQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKC-IDHPNGYECQCATGFTGVLCEE 569          

HSP 3 Score: 61.2326 bits (147), Expect = 6.119e-9
Identity = 46/132 (34.85%), Postives = 63/132 (47.73%), Query Frame = 3
Query:  759 KKLCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNR-KCICLPGYTGILC 1139
            K LC+ GW G  C  +++ CL   C   G C  +    +C C  G  G +C  N + C SNPC N+G C  + +   G  CHC   + G  C+  L  C   PC N A C+   +F    C+C PG+ G  C
Sbjct:  742 KCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDIS---GYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRC 870          

HSP 4 Score: 60.8474 bits (146), Expect = 8.977e-9
Identity = 49/147 (33.33%), Postives = 64/147 (43.54%), Query Frame = 3
Query:  768 CNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQ--SLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRG 1196
            C  G+ G  C N  + C   SC   G C++      C+C  G  G  C    N C S+PC NEG C+    G    RC C   + G  C+   +LC   PC N  TC   K    +C+C  G+ G  CD    +P  +    A RRG
Sbjct:  975 CQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCV---DGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTC-VQKKAESQCLCPSGWAGAYCD----VPNVSCDIAASRRG 1113          

HSP 5 Score: 58.5362 bits (140), Expect = 3.916e-8
Identity = 45/136 (33.09%), Postives = 65/136 (47.79%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQDLCLYQSCVLDGKCIE--IDGKPQCMC-NGRIGPHCFPNYNPCR---SNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C EG  G  C+  D C+   C     C    ++G+  C C  G  G  C  + + C    SNPC++ G+C+ N  G     C C   + G  CE  +  C   PC N+ATC  DK     C+C+PG+ G+ C+ E
Sbjct:  363 MCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCV-NTDG--AFHCECLKGYAGPRCEMDINECHSDPCQNDATC-LDKIGGFTCLCMPGFKGVHCELE 494          

HSP 6 Score: 56.225 bits (134), Expect = 2.095e-7
Identity = 41/130 (31.54%), Postives = 56/130 (43.08%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCR-SNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            C  G+ G++C   D CL   C     C  +  +  C C  G  G  C  + N C     C++ G C+ N  G    +C C   F G  C+     C   PC N  TC    DF  +C CLPG+ G  C++
Sbjct:  133 CQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCL-NLPGS--YQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCER 259          

HSP 7 Score: 56.225 bits (134), Expect = 2.420e-7
Identity = 46/141 (32.62%), Postives = 62/141 (43.97%), Query Frame = 3
Query:  765 LCNEGWKGEQCN-----------EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            LC  GW G  C+            + + +   C   G CI       C C  G  G +C    + C SNPC++   C  +  G  G RC C P + GV CE  +  C+  PC N  TC  D   + KC C PG  G+LC++
Sbjct: 1088 LCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLGYTGSYCEEQLDECASNPCQHGATCS-DFIG--GYRCECVPGYQGVNCEYEVDECQNQPCQNGGTC-IDLVNHFKCSCPPGTRGLLCEE 1224          

HSP 8 Score: 51.2174 bits (121), Expect = 7.846e-6
Identity = 45/131 (34.35%), Postives = 55/131 (41.98%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            C  G+ G  C E  D CL   C   G C++      C+C  G  G  C  + N C S PCKN G C           C C   F GV CE ++  C    C N  TC  D   +  C+C  G+TG  C  E
Sbjct:  899 CPPGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVN---SYTCKCQAGFDGVHCENNINECTESSCFNGGTC-VDGINSFSCLCPVGFTGSFCLHE 1025          
BLAST of Delta-like protein vs. Ensembl Human
Match: CRB1 (crumbs cell polarity complex component 1 [Source:HGNC Symbol;Acc:HGNC:2343])

HSP 1 Score: 68.9366 bits (167), Expect = 2.397e-11
Identity = 52/131 (39.69%), Postives = 62/131 (47.33%), Query Frame = 3
Query:  765 LCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHC-NPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +C   + G  C  E D C  Q C+    C +  G   C C  G +G HC  N + C S PC + G C+    GE    C+C    F G  CE    LC   PCHNNATCE   D N  C C PGYTG  C+
Sbjct:  142 ICPHNYSGVNCELEIDECWSQPCLNGATCQDALGAYFCDCAPGFLGDHCELNTDECASQPCLHGGLCV---DGENRYSCNCTGSGFTGTHCETLMPLCWSKPCHNNATCEDSVD-NYTCHCWPGYTGAQCE 268          

HSP 2 Score: 59.6918 bits (143), Expect = 1.615e-8
Identity = 48/154 (31.17%), Postives = 64/154 (41.56%), Query Frame = 3
Query:  768 CNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCNGR--IGPHCFPNYNPCRSNPCKNEGRC---IPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATC---EYDKDFNR----------------KCICLPGYTGILCDQE 1148
            C  G+ G+ C    D C  Q C+  G C++ + +  C C G    G HC      C S PC N   C   + N T      CHC P + G  CE  L  C   PC +N  C     +K + R                 CIC PG+TGI C+++
Sbjct:  181 CAPGFLGDHCELNTDECASQPCLHGGLCVDGENRYSCNCTGSGFTGTHCETLMPLCWSKPCHNNATCEDSVDNYT------CHCWPGYTGAQCEIDLNECNSNPCQSNGECVELSSEKQYGRITGLPSSFSYHEASGYVCICQPGFTGIHCEED 328          

HSP 3 Score: 52.7582 bits (125), Expect = 2.145e-6
Identity = 48/131 (36.64%), Postives = 61/131 (46.56%), Query Frame = 3
Query:  765 LCNEGWKGEQCN-EQDLCLYQSCVLDGKCIE-IDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +C  G+ G  C  + D C    C     C + IDG   C C  G  G HC    + C S+PCKNE  C+ N+ G     C C  N+ GV CE  +  C   PC N ATC+ D      C C PG+ G  C+
Sbjct:   66 ICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGY-SCFCVPGYQGRHCDLEVDECASDPCKNEATCL-NEIGRY--TCICPHNYSGVNCELEIDECWSQPCLNGATCQ-DALGAYFCDCAPGFLGDHCE 191          

HSP 4 Score: 52.373 bits (124), Expect = 2.916e-6
Identity = 58/203 (28.57%), Postives = 83/203 (40.89%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDL--CLYQSCVLDGKCIEIDGKPQ--------------------CMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHC-----NPNFFGVL-CEQSL--CEIVPCHNNATCE---YDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGN-SSHGALADKNIQLGSTQTILFFSF 1271
            C  G+ G QC E DL  C    C  +G+C+E+  + Q                    C+C  G  G HC  + N C SNPC+N G C  N  G     CHC     +  F+G   C   L  C    C NN TC     D      C+C  GYTG LC+    +  E       + G+ ++ G++ +  ++  + Q +    F
Sbjct:  258 CWPGYTGAQC-EIDLNECNSNPCQSNGECVELSSEKQYGRITGLPSSFSYHEASGYVCICQPGFTGIHCEEDVNECSSNPCQNGGTC-ENLPGNY--TCHCPFDNLSRTFYGGRDCSDILLGCTHQQCLNNGTCIPHFQDGQHGFSCLCPSGYTGSLCEIATTLSFEGDGFLWVKSGSVTTKGSVCNIALRFQTVQPMALLLF 456          

HSP 5 Score: 51.9878 bits (123), Expect = 4.066e-6
Identity = 44/139 (31.65%), Postives = 60/139 (43.17%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHN---NATC-------EYDKDFNRKCICLPGYTGILCDQE 1148
            C  GW G+ C    D C    C+  G C +      C C  G  G +C  + + C+S+ C N   CI +  G     C C  NF G  C QS      C N   N TC       E+  +   KC+C PG+TG  C+++
Sbjct: 1141 CPLGWSGKHCELNIDECFSNPCI-HGNCSDRVAAYHCTCEPGYTGVNCEVDIDNCQSHQCANGATCISHTNG---YSCLCFGNFTGKFCRQSRLPSTVCGNEKTNLTCYNGGNCTEFQTEL--KCMCRPGFTGEWCEKD 1273          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 72.4034 bits (176), Expect = 7.794e-13
Identity = 49/154 (31.82%), Postives = 75/154 (48.70%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCNGRI-GPHCFPNYNPC--RSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHG 1211
            CN+G++G+ C +  D C+   C   GKC+++    +C C     G HC      C  + NPC+N G+CIP         C C+P F G  CE ++  C+ V C N  +C  D   +  C+C PGY G  C+  P++ +E     A ++     G
Sbjct:  935 CNKGFEGDYCEKNIDDCVNSKCENGGKCVDLINSYRCDCPMEYEGKHCEDKLEYCTKKLNPCENNGKCIPINGS---YSCMCSPGFTGNNCETNIDDCKNVECQNGGSC-VDGILSYDCLCRPGYAGQYCEIPPMMDMEYQKTDACQQSACGQG 1084          

HSP 2 Score: 50.0618 bits (118), Expect = 5.299e-6
Identity = 54/226 (23.89%), Postives = 85/226 (37.61%), Query Frame = 3
Query:  543 ALFGYQFTQSPSANYSNPIYDNITMYRQDRSIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQ--SCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE-----------QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
              +G        A Y +P  +N T           KV      +  C+    G+ CE         KC   GK +         C   ++G+ C ++ + C  +   C  +GKCI I+G   CMC+ G  G +C  N + C++  C+N G C+    G +   C C P + G  CE              C+   C            +  C C  G++G  CD++
Sbjct:  899 GFYGVHCENQIDACYGSPCLNNATC----------KVAQAGRFNCYCNKGFEGDYCEKNIDDCVNSKCENGGKCVDLINSYRCDCPMEYEGKHCEDKLEYCTKKLNPCENNGKCIPINGSYSCMCSPGFTGNNCETNIDDCKNVECQNGGSCV---DGILSYDCLCRPGYAGQYCEIPPMMDMEYQKTDACQQSACGQGECVASQNSSDFTCKCHEGFSGPSCDRQ 1111          

HSP 3 Score: 50.0618 bits (118), Expect = 6.073e-6
Identity = 30/94 (31.91%), Postives = 44/94 (46.81%), Query Frame = 3
Query:  870 QCMCNGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            Q  C+ ++        + C ++PCKN   C    T      C+C P F+GV CE  +  C   PC NNATC+  +     C C  G+ G  C++
Sbjct:  855 QFTCDSKVPTKLATKCDLCLNSPCKNNAIC--ETTSSRKYTCNCTPGFYGVHCENQIDACYGSPCLNNATCKVAQAGRFNCYCNKGFEGDYCEK 946          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: clec-78 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531])

HSP 1 Score: 67.3958 bits (163), Expect = 2.917e-11
Identity = 48/141 (34.04%), Postives = 72/141 (51.06%), Query Frame = 3
Query:  732 NLYKCSRNGKKLCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            N YKC       C  G+ G++C+ +++LC    CV  G CI+     QC+C  G  G +C  N + C ++PC+N+ +CI    G +   C C   + GV C+  +  C   PCHNNATC  +      C C  G+ G+ C+
Sbjct: 2189 NDYKCE------CPTGFSGKRCHIKENLCASSPCV-HGLCIDKLYSRQCLCQPGWTGENCDQNIDECAASPCQNDAKCIDEINGYM---CECADGYEGVHCQHLVDHCAKQPCHNNATCT-NMGATYHCDCTLGFDGVHCE 2318          

HSP 2 Score: 64.6994 bits (156), Expect = 2.216e-10
Identity = 46/165 (27.88%), Postives = 69/165 (41.82%), Query Frame = 3
Query:  759 KKLCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCI----------------------PNK--------TGEVG-----IRCHCNPNFFGVLCEQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            K +C  G+ G +C+ +QD C    C+ D +C+++ G  +C+C +G  GP C  +   C + PC+N G C+                      PN+         GE G     + C C  +F G  CE        C N   C       +KC C PG+TG  C+
Sbjct: 2345 KCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCPPGVSGKNCESAPNRCIGQPCHNGGECGDFGSHLECACPASFTGKGCEFKNTGCKTCENGGKCAEAAGGLQKCECSPGFTGERCE 2509          

HSP 3 Score: 61.6178 bits (148), Expect = 1.754e-9
Identity = 61/208 (29.33%), Postives = 86/208 (41.35%), Query Frame = 3
Query:  678 QCDHNRYGEKCEIF---CKPSNLY---KCSRNG---KKLCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDG--KPQCMC-NGRIGPHCFPNYNPCRSN-PCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATC-----EY-------------------------------DKDFNRKCICLPGYTGILCDQ 1145
             C     G++CE+    C     Y   KC + G   K  C + + G +C  E D C    C   G C ++ G     C+C  G  GP C    + C +N PC+N  RCI  K G    +C C P + G  C++++  C   PC  NATC     +Y                               DK ++R+C+C PG+TG  CDQ
Sbjct: 2038 HCKPGYVGDRCEMLEDVCSTQPCYNGGKCEQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVCHDLPGVKSTTCLCRTGFAGPQCEEITDICSTNNPCRNGARCIGEKLGR--FKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSPCVHGLCIDKLYSRQCLCQPGWTGENCDQ 2243          

HSP 4 Score: 57.7658 bits (138), Expect = 3.007e-8
Identity = 51/170 (30.00%), Postives = 67/170 (39.41%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQSCVLDGKCI-EIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEG---------------------------RCIPNKTGEVG----------IRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            LC  GW GE C++  D C    C  D KCI EI+G   C C +G  G HC    + C   PC N                              C  N+  ++G           +C C P + G  C+  Q  C   PC N+A C  D     KC+C  G+TG  C+Q+
Sbjct: 2231 LCQPGWTGENCDQNIDECAASPCQNDAKCIDEINGY-MCECADGYEGVHCQHLVDHCAKQPCHNNATCTNMGATYHCDCTLGFDGVHCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQC-VDMGGAYKCVCKSGWTGPKCEQD 2398          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 63.929 bits (154), Expect = 3.070e-10
Identity = 49/172 (28.49%), Postives = 68/172 (39.53%), Query Frame = 3
Query:  753 NGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTG----ILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQLGSTQT 1253
            +GK  C  G+ G  C+E  +C     V  G  +   G   C+C +G  G  C   +N C    C   GRC      +   RC CNP + G  CE   C    CH+   C      N  C C+ G+ G    +  D    +P   +P   PRRG     +   +  Q+  T T
Sbjct:  271 HGKCHCAPGFTGRTCDEA-VC---PVVCSGNGVFSGGI--CVCKSGFKGKECEMRHNWCEVADCNGRGRC------DTDGRCRCNPGWTGEACELRACPHASCHDRGVC-----VNGTCYCMDGWRGNDCSVFADAIVHVPQAQSP---PRRGQEPTESSKTRKAQVKPTPT 422          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 63.929 bits (154), Expect = 3.201e-10
Identity = 49/172 (28.49%), Postives = 68/172 (39.53%), Query Frame = 3
Query:  753 NGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTG----ILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQLGSTQT 1253
            +GK  C  G+ G  C+E  +C     V  G  +   G   C+C +G  G  C   +N C    C   GRC      +   RC CNP + G  CE   C    CH+   C      N  C C+ G+ G    +  D    +P   +P   PRRG     +   +  Q+  T T
Sbjct:  453 HGKCHCAPGFTGRTCDEA-VC---PVVCSGNGVFSGGI--CVCKSGFKGKECEMRHNWCEVADCNGRGRC------DTDGRCRCNPGWTGEACELRACPHASCHDRGVC-----VNGTCYCMDGWRGNDCSVFADAIVHVPQAQSP---PRRGQEPTESSKTRKAQVKPTPT 604          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 63.929 bits (154), Expect = 3.496e-10
Identity = 49/172 (28.49%), Postives = 68/172 (39.53%), Query Frame = 3
Query:  753 NGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTG----ILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQLGSTQT 1253
            +GK  C  G+ G  C+E  +C     V  G  +   G   C+C +G  G  C   +N C    C   GRC      +   RC CNP + G  CE   C    CH+   C      N  C C+ G+ G    +  D    +P   +P   PRRG     +   +  Q+  T T
Sbjct:  532 HGKCHCAPGFTGRTCDEA-VC---PVVCSGNGVFSGGI--CVCKSGFKGKECEMRHNWCEVADCNGRGRC------DTDGRCRCNPGWTGEACELRACPHASCHDRGVC-----VNGTCYCMDGWRGNDCSVFADAIVHVPQAQSP---PRRGQEPTESSKTRKAQVKPTPT 683          
BLAST of Delta-like protein vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0304659)

HSP 1 Score: 73.1738 bits (178), Expect = 6.428e-13
Identity = 55/144 (38.19%), Postives = 69/144 (47.92%), Query Frame = 3
Query:  732 NLYKCSRNGKKLCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIR---CHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            N YKC       C  G+ G+ C +  D C+   C  +G CI+     +C C  G    HC  + + C SNPC NEGRC      E GI    CHC P + G  CE  +  C   PC +  TC YDK     C C+PGYTG  C+
Sbjct:  697 NSYKCQ------CVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRC------EDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTC-YDKLNAFSCQCMPGYTGQKCE 827          

HSP 2 Score: 72.4034 bits (176), Expect = 1.011e-12
Identity = 52/129 (40.31%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQS-CVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            C  G+KG  C+E  D C   S C  +G C+   G  +C C+ G  GP C  N N C S+PC+NEG C+ +       RC C P F G  CE  +  C+  PC N+ TC +DK    KC C  G+TG  C
Sbjct:  437 CATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPG---TFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTC-HDKINGFKCSCALGFTGARC 561          

HSP 3 Score: 63.929 bits (154), Expect = 4.030e-10
Identity = 56/178 (31.46%), Postives = 75/178 (42.13%), Query Frame = 3
Query:  681 CDHNRYGEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            C     G +CE        + C   G  L         C  G+ G QC  + D C    C+ DG C +     +C C  G  G  C  N + C+S PC+N G C        G  C C P + G  CE ++  C+  PCH     +    F  KC+C PGYTG +C Q+ I   E+ P
Sbjct:  476 CSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGIC---HDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSF--KCLCDPGYTGYIC-QKQINECESNP 647          

HSP 4 Score: 58.151 bits (139), Expect = 2.638e-8
Identity = 56/185 (30.27%), Postives = 74/185 (40.00%), Query Frame = 3
Query:  648 KVKMFISMSAQCDHNRYGEKCEIFCKPSNLYKCS--RNGKKL------------CNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            ++K     +  C +   GE+CE      NL   S  RNG               C  G+ G+ C+ + + C    C   G C+   G  QCMC  G  G  C   Y PC  +PC+N G C  N    +   C C   F G  CEQ+   C    C N  TC  D   +  C C P +TG  C  +
Sbjct:  155 QLKTLEEYTCACANGYTGERCET----KNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNG---LSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTC-IDGISDYTCRCPPNFTGRFCQDD 331          

HSP 5 Score: 55.0694 bits (131), Expect = 2.270e-7
Identity = 45/139 (32.37%), Postives = 62/139 (44.60%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-----------DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C+ GW G+ C+ Q            L L Q C  +G C +      C C+ G  G +C    + C+S PC+N G C   +       C C   F G  CE ++  C   PC N  TC +D+  N  C C PG  GI+C+
Sbjct: 1124 CSAGWTGKLCDVQTISCQDAADRKGLSLRQLCN-NGTCKDYGNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTC---RDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTC-HDRVMNFSCSCPPGTMGIICE 1257          

HSP 6 Score: 54.6842 bits (130), Expect = 2.737e-7
Identity = 53/159 (33.33%), Postives = 65/159 (40.88%), Query Frame = 3
Query:  732 NLYKCSRNGKKLCNEGWKGEQCNEQDL-CLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRG 1196
            N Y C+      C  G+ G  C   D  C   SC+  G CI+      C C  G  G +C    N C SNPC N   C           CHC   F G  C + +  C   PC N ATC   K     C C  G+TG LCD + I    +  + A R+G
Sbjct: 1004 NSYTCT------CPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNN---EYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMK-HQFSCKCSAGWTGKLCDVQTI----SCQDAADRKG 1148          

HSP 7 Score: 54.6842 bits (130), Expect = 3.190e-7
Identity = 45/142 (31.69%), Postives = 67/142 (47.18%), Query Frame = 3
Query:  813 CLYQSCVLDGKCI-EIDGKPQCMCNGR-IGPHCFPNYNPCRSNPCKNEGRC-IPNKTGEVGIRCHCNPNFFGVLCEQSL---CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALA 1220
            C    C   G C+ +++GK  C C+   +G +C  + NPC S  C+N G C +  + G  GI C C   F   LCE ++   C+ V C N  TC+        C C  GYTG  C+ + +        ++P R  ++  ALA
Sbjct:   62 CTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYC-EHRNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNLCA------SSPCRNGATCTALA 196          

HSP 8 Score: 52.373 bits (124), Expect = 1.412e-6
Identity = 47/168 (27.98%), Postives = 66/168 (39.29%), Query Frame = 3
Query:  765 LCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPN----------KTGEVGI----------------------------RCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +C  GW G  C N  D C   +C     CI+  G   C C  G+ G  C  + + C SNPC  +  C  +           TG  G+                            RC+C+  F G  CE ++  CE  PC N  +C  D     +C+C+PG+TG  C+
Sbjct:  359 ICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLD-DACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSC-LDDPGTFRCVCMPGFTGTQCE 524          

HSP 9 Score: 51.6026 bits (122), Expect = 2.884e-6
Identity = 44/132 (33.33%), Postives = 57/132 (43.18%), Query Frame = 3
Query:  768 CNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDF-NRKCICLPGYTGILCDQE 1148
            C  G+ G++C  + D C    C   G C +      C C  G  G  C  N + C +NPC N G CI    G    +C C   F G  CE  +  C    C N A C    +F +  C C  GYTG  CD++
Sbjct:  779 CPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNG---YKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDED 907          

HSP 10 Score: 51.2174 bits (121), Expect = 3.390e-6
Identity = 40/129 (31.01%), Postives = 61/129 (47.29%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCNGR-IGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEI---VPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            C  G+ G++C    D C+   C   G CI+     +C+C     G  C    +PC SN CKNE +C P+ +  +   C C   + G  C++ + E     PC N A+C  +   + +C+C  GY G  C
Sbjct:  817 CMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPS-SNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASC-LNVPGSYRCLCTKGYEGRDC 943          

HSP 11 Score: 50.447 bits (119), Expect = 5.503e-6
Identity = 39/105 (37.14%), Postives = 55/105 (52.38%), Query Frame = 3
Query:  840 GKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            GKCI+     +C+C+ G  G  C    N C SNPC+ +G C  ++ G     C C     G  CE ++  C   PC+N ATC  D   + KC C+PG+TG  C++
Sbjct:  614 GKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHC-QDRVGS--YYCQCQAGTSGKNCEVNVNECHSNPCNNGATC-IDGINSYKCQCVPGFTGQHCEK 714          
BLAST of Delta-like protein vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0070507)

HSP 1 Score: 73.1738 bits (178), Expect = 6.428e-13
Identity = 55/144 (38.19%), Postives = 69/144 (47.92%), Query Frame = 3
Query:  732 NLYKCSRNGKKLCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIR---CHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            N YKC       C  G+ G+ C +  D C+   C  +G CI+     +C C  G    HC  + + C SNPC NEGRC      E GI    CHC P + G  CE  +  C   PC +  TC YDK     C C+PGYTG  C+
Sbjct:  697 NSYKCQ------CVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRC------EDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTC-YDKLNAFSCQCMPGYTGQKCE 827          

HSP 2 Score: 72.4034 bits (176), Expect = 1.011e-12
Identity = 52/129 (40.31%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQS-CVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            C  G+KG  C+E  D C   S C  +G C+   G  +C C+ G  GP C  N N C S+PC+NEG C+ +       RC C P F G  CE  +  C+  PC N+ TC +DK    KC C  G+TG  C
Sbjct:  437 CATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPG---TFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTC-HDKINGFKCSCALGFTGARC 561          

HSP 3 Score: 63.929 bits (154), Expect = 4.030e-10
Identity = 56/178 (31.46%), Postives = 75/178 (42.13%), Query Frame = 3
Query:  681 CDHNRYGEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            C     G +CE        + C   G  L         C  G+ G QC  + D C    C+ DG C +     +C C  G  G  C  N + C+S PC+N G C        G  C C P + G  CE ++  C+  PCH     +    F  KC+C PGYTG +C Q+ I   E+ P
Sbjct:  476 CSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGIC---HDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSF--KCLCDPGYTGYIC-QKQINECESNP 647          

HSP 4 Score: 58.151 bits (139), Expect = 2.638e-8
Identity = 56/185 (30.27%), Postives = 74/185 (40.00%), Query Frame = 3
Query:  648 KVKMFISMSAQCDHNRYGEKCEIFCKPSNLYKCS--RNGKKL------------CNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            ++K     +  C +   GE+CE      NL   S  RNG               C  G+ G+ C+ + + C    C   G C+   G  QCMC  G  G  C   Y PC  +PC+N G C  N    +   C C   F G  CEQ+   C    C N  TC  D   +  C C P +TG  C  +
Sbjct:  155 QLKTLEEYTCACANGYTGERCET----KNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNG---LSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTC-IDGISDYTCRCPPNFTGRFCQDD 331          

HSP 5 Score: 55.0694 bits (131), Expect = 2.270e-7
Identity = 45/139 (32.37%), Postives = 62/139 (44.60%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-----------DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C+ GW G+ C+ Q            L L Q C  +G C +      C C+ G  G +C    + C+S PC+N G C   +       C C   F G  CE ++  C   PC N  TC +D+  N  C C PG  GI+C+
Sbjct: 1124 CSAGWTGKLCDVQTISCQDAADRKGLSLRQLCN-NGTCKDYGNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTC---RDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTC-HDRVMNFSCSCPPGTMGIICE 1257          

HSP 6 Score: 54.6842 bits (130), Expect = 2.737e-7
Identity = 53/159 (33.33%), Postives = 65/159 (40.88%), Query Frame = 3
Query:  732 NLYKCSRNGKKLCNEGWKGEQCNEQDL-CLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRG 1196
            N Y C+      C  G+ G  C   D  C   SC+  G CI+      C C  G  G +C    N C SNPC N   C           CHC   F G  C + +  C   PC N ATC   K     C C  G+TG LCD + I    +  + A R+G
Sbjct: 1004 NSYTCT------CPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNN---EYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMK-HQFSCKCSAGWTGKLCDVQTI----SCQDAADRKG 1148          

HSP 7 Score: 54.6842 bits (130), Expect = 3.190e-7
Identity = 45/142 (31.69%), Postives = 67/142 (47.18%), Query Frame = 3
Query:  813 CLYQSCVLDGKCI-EIDGKPQCMCNGR-IGPHCFPNYNPCRSNPCKNEGRC-IPNKTGEVGIRCHCNPNFFGVLCEQSL---CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALA 1220
            C    C   G C+ +++GK  C C+   +G +C  + NPC S  C+N G C +  + G  GI C C   F   LCE ++   C+ V C N  TC+        C C  GYTG  C+ + +        ++P R  ++  ALA
Sbjct:   62 CTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYC-EHRNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNLCA------SSPCRNGATCTALA 196          

HSP 8 Score: 52.373 bits (124), Expect = 1.412e-6
Identity = 47/168 (27.98%), Postives = 66/168 (39.29%), Query Frame = 3
Query:  765 LCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPN----------KTGEVGI----------------------------RCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +C  GW G  C N  D C   +C     CI+  G   C C  G+ G  C  + + C SNPC  +  C  +           TG  G+                            RC+C+  F G  CE ++  CE  PC N  +C  D     +C+C+PG+TG  C+
Sbjct:  359 ICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLD-DACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSC-LDDPGTFRCVCMPGFTGTQCE 524          

HSP 9 Score: 51.6026 bits (122), Expect = 2.884e-6
Identity = 44/132 (33.33%), Postives = 57/132 (43.18%), Query Frame = 3
Query:  768 CNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDF-NRKCICLPGYTGILCDQE 1148
            C  G+ G++C  + D C    C   G C +      C C  G  G  C  N + C +NPC N G CI    G    +C C   F G  CE  +  C    C N A C    +F +  C C  GYTG  CD++
Sbjct:  779 CPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNG---YKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDED 907          

HSP 10 Score: 51.2174 bits (121), Expect = 3.390e-6
Identity = 40/129 (31.01%), Postives = 61/129 (47.29%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCNGR-IGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEI---VPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            C  G+ G++C    D C+   C   G CI+     +C+C     G  C    +PC SN CKNE +C P+ +  +   C C   + G  C++ + E     PC N A+C  +   + +C+C  GY G  C
Sbjct:  817 CMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPS-SNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASC-LNVPGSYRCLCTKGYEGRDC 943          

HSP 11 Score: 50.447 bits (119), Expect = 5.503e-6
Identity = 39/105 (37.14%), Postives = 55/105 (52.38%), Query Frame = 3
Query:  840 GKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            GKCI+     +C+C+ G  G  C    N C SNPC+ +G C  ++ G     C C     G  CE ++  C   PC+N ATC  D   + KC C+PG+TG  C++
Sbjct:  614 GKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHC-QDRVGS--YYCQCQAGTSGKNCEVNVNECHSNPCNNGATC-IDGINSYKCQCVPGFTGQHCEK 714          
BLAST of Delta-like protein vs. Ensembl Fly
Match: wry (gene:FBgn0051665 transcript:FBtr0334823)

HSP 1 Score: 72.7886 bits (177), Expect = 7.859e-13
Identity = 48/135 (35.56%), Postives = 65/135 (48.15%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDLCLYQSCVLDGKCIEI----DGKP-QCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            C  G+ G  C E D C    C  +G C+++    +G   QC+C  G  G +C    +PC    C N G C+ N T     RC C P F G LC+ SL  CE  PC +    + +  F  +C C PG+ G LC+ E
Sbjct:  726 CCSGFAGPHCEEIDACNPSPCTNNGICVDLSQGHEGNSYQCLCPYGYAGKNCQYESDPCNPAECMNGGSCVGNST---HFRCDCAPGFTGPLCQHSLNECESSPCVHGICVDQEDGF--RCFCQPGFAGELCNFE 855          

HSP 2 Score: 58.5362 bits (140), Expect = 1.703e-8
Identity = 61/204 (29.90%), Postives = 86/204 (42.16%), Query Frame = 3
Query:  765 LCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQ---SLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQ------LGSTQTI--------LFFSFGILFC---ILGVVVSI 1310
             C  G+ GE CN E + C    C   G+CI+  G  +C C  G  G  C    + C + PC    RCI +        C C     G  C Q   + C + PC +  TC    D +  C C PGYTG +C+ E +  VET         +SS   + D N +       GS+  +         +F+ G+L     I+ VVV+I
Sbjct:  842 FCQPGFAGELCNFEYNECESNPCQNGGECIDHIGSYECRCTKGFSGNRCQIKVDFCANKPCPEGHRCIDHGND---FSCECPGGRNGPDCNQMPRTQCNVNPCTHGGTCWSSGD-SFYCACRPGYTGTMCEDEFV--VETVV-------SSSEFIVDDANARNFNDKTFGSSVVLKSPIELHNAYFAAGVLAAAIFIVAVVVTI 1032          
BLAST of Delta-like protein vs. Ensembl Fly
Match: wry (gene:FBgn0051665 transcript:FBtr0304911)

HSP 1 Score: 72.7886 bits (177), Expect = 7.925e-13
Identity = 48/135 (35.56%), Postives = 65/135 (48.15%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDLCLYQSCVLDGKCIEI----DGKP-QCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            C  G+ G  C E D C    C  +G C+++    +G   QC+C  G  G +C    +PC    C N G C+ N T     RC C P F G LC+ SL  CE  PC +    + +  F  +C C PG+ G LC+ E
Sbjct:  725 CCSGFAGPHCEEIDACNPSPCTNNGICVDLSQGHEGNSYQCLCPYGYAGKNCQYESDPCNPAECMNGGSCVGNST---HFRCDCAPGFTGPLCQHSLNECESSPCVHGICVDQEDGF--RCFCQPGFAGELCNFE 854          

HSP 2 Score: 58.5362 bits (140), Expect = 1.732e-8
Identity = 61/204 (29.90%), Postives = 86/204 (42.16%), Query Frame = 3
Query:  765 LCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQ---SLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQ------LGSTQTI--------LFFSFGILFC---ILGVVVSI 1310
             C  G+ GE CN E + C    C   G+CI+  G  +C C  G  G  C    + C + PC    RCI +        C C     G  C Q   + C + PC +  TC    D +  C C PGYTG +C+ E +  VET         +SS   + D N +       GS+  +         +F+ G+L     I+ VVV+I
Sbjct:  841 FCQPGFAGELCNFEYNECESNPCQNGGECIDHIGSYECRCTKGFSGNRCQIKVDFCANKPCPEGHRCIDHGND---FSCECPGGRNGPDCNQMPRTQCNVNPCTHGGTCWSSGD-SFYCACRPGYTGTMCEDEFV--VETVV-------SSSEFIVDDANARNFNDKTFGSSVVLKSPIELHNAYFAAGVLAAAIFIVAVVVTI 1031          
BLAST of Delta-like protein vs. Ensembl Fly
Match: wry (gene:FBgn0051665 transcript:FBtr0089786)

HSP 1 Score: 72.7886 bits (177), Expect = 8.000e-13
Identity = 48/135 (35.56%), Postives = 65/135 (48.15%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDLCLYQSCVLDGKCIEI----DGKP-QCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            C  G+ G  C E D C    C  +G C+++    +G   QC+C  G  G +C    +PC    C N G C+ N T     RC C P F G LC+ SL  CE  PC +    + +  F  +C C PG+ G LC+ E
Sbjct:  725 CCSGFAGPHCEEIDACNPSPCTNNGICVDLSQGHEGNSYQCLCPYGYAGKNCQYESDPCNPAECMNGGSCVGNST---HFRCDCAPGFTGPLCQHSLNECESSPCVHGICVDQEDGF--RCFCQPGFAGELCNFE 854          

HSP 2 Score: 56.9954 bits (136), Expect = 5.832e-8
Identity = 61/207 (29.47%), Postives = 85/207 (41.06%), Query Frame = 3
Query:  765 LCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQ------SLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQ------LGSTQTI--------LFFSFGILFC---ILGVVVSI 1310
             C  G+ GE CN E + C    C   G+CI+  G  +C C  G  G  C    + C + PC    RCI +        C C     G  C Q        C + PC +  TC    D +  C C PGYTG +C+ E +  VET         +SS   + D N +       GS+  +         +F+ G+L     I+ VVV+I
Sbjct:  841 FCQPGFAGELCNFEYNECESNPCQNGGECIDHIGSYECRCTKGFSGNRCQIKVDFCANKPCPEGHRCIDHGND---FSCECPGGRNGPDCNQMPRTYFQQCNVNPCTHGGTCWSSGD-SFYCACRPGYTGTMCEDEFV--VETVV-------SSSEFIVDDANARNFNDKTFGSSVVLKSPIELHNAYFAAGVLAAAIFIVAVVVTI 1034          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: jag1a (jagged canonical Notch ligand 1a [Source:NCBI gene;Acc:140421])

HSP 1 Score: 78.1814 bits (191), Expect = 2.062e-14
Identity = 81/333 (24.32%), Postives = 140/333 (42.04%), Query Frame = 3
Query:  198 ERVGYLYFKFLCYENFEHLDRNGAECD--------SVPSKNCDPIFTICINHQYISGIDKDNCQIYYTETSSYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALFGYQFTQSPSANYSNPIYDNITMYRQDRSIRN--PKVKMFISMSAQCDHNRYGEKCEIFCKPSN----LYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMCNGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL---CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            E  G+   + L  +N     +NGA CD        S  +  CD  F +C+  +Y S +       Y + ++      T   KP D     +++V+      P+ + + +  +D +  ++ S  ++ G    ++  +   NP        RQ + +++  P  +    +   CD + +G  C  FC+P +     Y C  NG K C EGW G +CN   +C  Q C ++    ++ G  +C+  G  G +C    + C  +P    G CI         +C C+ N+ G LC++ L     + PC N  TC         C C  GY+G  C++
Sbjct:   27 EASGHFEMQVLSMQNVNGELQNGACCDGARDPAERSCAADQCDTFFRVCLK-EYQSRVSSGGPCSYGSGSTPVIGGNTFSVKPLDQTNDKTRIVLPFSFAWPRSYTLIVEALDFN--NDSSTGSINGQVIEKAVQSGMINP-------NRQWQVLKHNGPVAQFQYQIRVTCDEHYFGFGCNKFCRPRDDFFGHYTCDHNGNKTCLEGWAGPECNTA-IC-KQGCSIEHGSCKVPGNCRCL-YGWQGEYC----DQCIPHPGCVHGTCIEP------WQCLCDTNWGGQLCDKDLNTCGTLQPCLNGGTCSNTGPDKYHCACPEGYSGQNCER 336          

HSP 2 Score: 63.1586 bits (152), Expect = 8.637e-10
Identity = 56/174 (32.18%), Postives = 74/174 (42.53%), Query Frame = 3
Query:  648 KVKMFISMSAQCDHNRYGEKCEIFCKPSNLYKCSRNG---KKLCNEGWKGEQCN--EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            K K   S  +QCD +            +N   CS  G   K LC+ GW+G  CN  +   CL   C     C+       C+C  G  GP C  N N C   PC N G C+    G+   RC C   F G  C  ++  C+  PC   +TC  D+    +C+C PG TG  C +
Sbjct:  701 KGKTCHSRESQCDEDTC----------NNGGTCSDEGDSFKCLCSPGWEGATCNIAKNSSCLPNPCENGATCVVTGDGFTCVCKEGWEGPTCSQNSNDCNPQPCYNSGTCV---DGDNWYRCECASGFAGPDCRININECQSSPCAFGSTC-VDEINGYRCLCPPGRTGPRCQE 860          

HSP 3 Score: 59.6918 bits (143), Expect = 1.075e-8
Identity = 43/129 (33.33%), Postives = 66/129 (51.16%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLC--EQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C +G+ G  C+E  + C    C+  G CI+     QC+C +G  GP+C  N + CR+NPC++ G C   +       C C   + G  C   +S C+   C+N  TC  + D + KC+C PG+ G  C+
Sbjct:  620 CQDGFTGTYCHENINDCESSPCLSGGTCIDKINAYQCICADGWEGPNCETNIDDCRTNPCRDRGVC---RDLVNDFYCECENGWKGKTCHSRESQCDEDTCNNGGTCSDEGD-SFKCLCSPGWEGATCN 744          

HSP 4 Score: 58.151 bits (139), Expect = 3.407e-8
Identity = 45/129 (34.88%), Postives = 61/129 (47.29%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQD-LCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLC--EQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C EG+ G+ C   D  CL + C+  G C+E     +C C  G  GP C  N + C  NPC + G C+       G +C C   + G  C  + + CE  PC N  +C  +      C CLPG+TG  CD
Sbjct:  325 CPEGYSGQNCERADNACLSEPCLNGGLCVESSLGFECQCAAGWTGPSCNINEDDCSPNPCNHSGVCVDLVD---GFKCICPVQWTGKTCLIDANECEESPCVNAHSCR-NLIGGYFCECLPGWTGQNCD 449          

HSP 5 Score: 52.7582 bits (125), Expect = 1.397e-6
Identity = 42/129 (32.56%), Postives = 56/129 (43.41%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            C  GW G+ C+      +  C+  G C ++    +C+C  G  G  C  + + C S PC N GRC        G +C C P F G  C+  L  CE  PC N A C +    +  C C   Y G  C Q
Sbjct:  439 CLPGWTGQNCDINVNDCHGQCLNGGLCKDLVNGYRCVCAAGFAGDRCERDVDECASRPCLNGGRCQDTLN---GFQCLCPPGFSGATCQLDLDYCESGPCQNGAQC-FSLASDYYCKCPEDYEGKNCSQ 563          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: jag1a (jagged canonical Notch ligand 1a [Source:NCBI gene;Acc:140421])

HSP 1 Score: 77.7962 bits (190), Expect = 2.542e-14
Identity = 81/333 (24.32%), Postives = 140/333 (42.04%), Query Frame = 3
Query:  198 ERVGYLYFKFLCYENFEHLDRNGAECD--------SVPSKNCDPIFTICINHQYISGIDKDNCQIYYTETSSYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALFGYQFTQSPSANYSNPIYDNITMYRQDRSIRN--PKVKMFISMSAQCDHNRYGEKCEIFCKPSN----LYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMCNGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL---CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            E  G+   + L  +N     +NGA CD        S  +  CD  F +C+  +Y S +       Y + ++      T   KP D     +++V+      P+ + + +  +D +  ++ S  ++ G    ++  +   NP        RQ + +++  P  +    +   CD + +G  C  FC+P +     Y C  NG K C EGW G +CN   +C  Q C ++    ++ G  +C+  G  G +C    + C  +P    G CI         +C C+ N+ G LC++ L     + PC N  TC         C C  GY+G  C++
Sbjct:   27 EASGHFEMQVLSMQNVNGELQNGACCDGARDPAERSCAADQCDTFFRVCLK-EYQSRVSSGGPCSYGSGSTPVIGGNTFSVKPLDQTNDKTRIVLPFSFAWPRSYTLIVEALDFN--NDSSTGSINGQVIEKAVQSGMINP-------NRQWQVLKHNGPVAQFQYQIRVTCDEHYFGFGCNKFCRPRDDFFGHYTCDHNGNKTCLEGWAGPECNTA-IC-KQGCSIEHGSCKVPGNCRCL-YGWQGEYC----DQCIPHPGCVHGTCIEP------WQCLCDTNWGGQLCDKDLNTCGTLQPCLNGGTCSNTGPDKYHCACPEGYSGQNCER 336          

HSP 2 Score: 63.1586 bits (152), Expect = 9.592e-10
Identity = 56/174 (32.18%), Postives = 74/174 (42.53%), Query Frame = 3
Query:  648 KVKMFISMSAQCDHNRYGEKCEIFCKPSNLYKCSRNG---KKLCNEGWKGEQCN--EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            K K   S  +QCD +            +N   CS  G   K LC+ GW+G  CN  +   CL   C     C+       C+C  G  GP C  N N C   PC N G C+    G+   RC C   F G  C  ++  C+  PC   +TC  D+    +C+C PG TG  C +
Sbjct:  701 KGKTCHSRESQCDEDTC----------NNGGTCSDEGDSFKCLCSPGWEGATCNIAKNSSCLPNPCENGATCVVTGDGFTCVCKEGWEGPTCSQNSNDCNPQPCYNSGTCV---DGDNWYRCECASGFAGPDCRININECQSSPCAFGSTC-VDEINGYRCLCPPGRTGPRCQE 860          

HSP 3 Score: 59.3066 bits (142), Expect = 1.289e-8
Identity = 43/129 (33.33%), Postives = 66/129 (51.16%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLC--EQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C +G+ G  C+E  + C    C+  G CI+     QC+C +G  GP+C  N + CR+NPC++ G C   +       C C   + G  C   +S C+   C+N  TC  + D + KC+C PG+ G  C+
Sbjct:  620 CQDGFTGTYCHENINDCESSPCLSGGTCIDKINAYQCICADGWEGPNCETNIDDCRTNPCRDRGVC---RDLVNDFYCECENGWKGKTCHSRESQCDEDTCNNGGTCSDEGD-SFKCLCSPGWEGATCN 744          

HSP 4 Score: 57.7658 bits (138), Expect = 4.226e-8
Identity = 45/129 (34.88%), Postives = 61/129 (47.29%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQD-LCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLC--EQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C EG+ G+ C   D  CL + C+  G C+E     +C C  G  GP C  N + C  NPC + G C+       G +C C   + G  C  + + CE  PC N  +C  +      C CLPG+TG  CD
Sbjct:  325 CPEGYSGQNCERADNACLSEPCLNGGLCVESSLGFECQCAAGWTGPSCNINEDDCSPNPCNHSGVCVDLVD---GFKCICPVQWTGKTCLIDANECEESPCVNAHSCR-NLIGGYFCECLPGWTGQNCD 449          

HSP 5 Score: 52.7582 bits (125), Expect = 1.577e-6
Identity = 42/129 (32.56%), Postives = 56/129 (43.41%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            C  GW G+ C+      +  C+  G C ++    +C+C  G  G  C  + + C S PC N GRC        G +C C P F G  C+  L  CE  PC N A C +    +  C C   Y G  C Q
Sbjct:  439 CLPGWTGQNCDINVNDCHGQCLNGGLCKDLVNGYRCVCAAGFAGDRCERDVDECASRPCLNGGRCQDTLN---GFQCLCPPGFSGATCQLDLDYCESGPCQNGAQC-FSLASDYYCKCPEDYEGKNCSQ 563          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: dll4 (delta-like 4 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-041014-73])

HSP 1 Score: 73.1738 bits (178), Expect = 4.857e-13
Identity = 85/352 (24.15%), Postives = 138/352 (39.20%), Query Frame = 3
Query:  138 VFITLLFIFYHIYIDRGVSSERVGYLYFKFLCYENFEHLDRNGAECDSVPSKNCDPIFTICI-NHQYISGIDKDNCQIYYTETSSYDNHE----TVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALFGYQFTQSPSANYSNPIYDNITMYRQDRSIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPSN----LYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKP-QCMCN-GRIGPHCFPNYNPCRSNPCKNEGRC-IPNKTGEVGIRCHCNPNFFGVLCEQSL---CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
             ++T L  F+   + +   S   G        ++NF+ L  NG  C    + +C   F +C+ N+Q +  +   +C      T     +        +  T  R P +         I + W    + +  D ++    I+ F  Q      A +S  +                + ++  S    C+ N YG+ C   C P +     Y C+ +G+  C  GWKGE C E+ +CL      +G C     KP +C+C  G  G  C      C++ P    G C +P +       C+C   + G+ C+Q L       PC N ATC      +  CIC PGYTG+ C+ +
Sbjct:    3 AWLTFLIAFFTTVLTQIFGS---GVFELDLHEFKNFKGLLANGNSC----TPDCRTFFRVCLKNYQVV--VSPGDCIFGSALTPVLGTNSFRIMGGGSFSTPIRLPFNFGWPGSFSLIIEAWHSPYSDLPVDAYNPNMQISFFAIQRKLEVGAEWSQDVQSG------------KQTELRYSYRFICNENYYGDSCSKKCTPRDDRFGHYTCNPDGQLSCLPGWKGEYC-EEPICLEGCSEANGNC----SKPGECVCREGWQGKFC----TECKTYPACKHGTCHLPGQ-------CNCKEGWGGLFCDQDLNFCTHHKPCVNGATCMNTGQGSYTCICRPGYTGVNCELQ 317          

HSP 2 Score: 63.1586 bits (152), Expect = 7.159e-10
Identity = 47/143 (32.87%), Postives = 59/143 (41.26%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPR 1190
            C  G+ G  C  + D C    C  DG C+ + GK  C C  G  G  C  N N C +NPC N G C       V   C C P + G  C++  C   PC N  +C         C C  G+TG LC+   +    T   T  R
Sbjct:  383 CPLGYTGLNCERRMDKCTSMLCANDGLCLILGGKRICSCRAGFTGQRCEININDCANNPCANGGTCYDRINEYV---CSCPPGYKGRNCDRPSCLSTPCLNGGSCVGITGNPPACFCPSGFTGPLCEYYAVTAPVTRGETQDR 522          

HSP 3 Score: 58.5362 bits (140), Expect = 1.718e-8
Identity = 50/143 (34.97%), Postives = 66/143 (46.15%), Query Frame = 3
Query:  744 CSRNGKKLCNEGWKGEQCNEQDLCL---YQSCVLDGKCIEI-DGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATC-EYDKDFNRKCICLPGYTGILCDQE 1148
            C   G+  C EGW G  C +QDL     ++ CV    C+    G   C+C  G  G +C      C S+PCKN G C  +   +    C C P+F G  CE SL  C   PC +   C E D   +  C C  GYTG+ C++ 
Sbjct:  257 CHLPGQCNCKEGWGGLFC-DQDLNFCTHHKPCVNGATCMNTGQGSYTCICRPGYTGVNCELQVRECDSSPCKNGGLCTDH---DKSYTCTCLPDFEGTHCEHSLLTCADSPCFHKGRCHEKDNGRSYACECPLGYTGLNCERR 395          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: notch3 (notch receptor 3 [Source:ZFIN;Acc:ZDB-GENE-000329-5])

HSP 1 Score: 73.9442 bits (180), Expect = 5.010e-13
Identity = 50/129 (38.76%), Postives = 59/129 (45.74%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C  GW+G  CN   + C    C   G C    G   C C  G  GP+C  + N C  NPC N G C     G    RC C P F G  C   L  C+ VPC N  TC  D   +  C C PG+TG+LC+
Sbjct:  812 CQPGWQGHLCNNDINECTSNPCKNRGTCTNTLGGYVCSCRAGYTGPNCETDINDCSPNPCLNGGSCT---DGVNSFRCSCLPGFTGARCATELNECQSVPCKNGGTCT-DYVNSYTCTCKPGFTGLLCE 936          

HSP 2 Score: 65.855 bits (159), Expect = 1.463e-10
Identity = 54/149 (36.24%), Postives = 73/149 (48.99%), Query Frame = 3
Query:  753 NGKKLCN--EGWKGEQCNE-QDLCLYQS--CVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            NG+ +C    G+ G  CN+  D C   +  C   GKC+  +G  QC C  G  GP C  + N C S PC+N+  C+ ++ GE    C C P + G  CE  +  CE  PC N+  C  D      C C PG+TG +C Q  I    +TP
Sbjct:  348 NGRAICTCPAGFVGGACNQDMDECSIGANPCEHFGKCVNTEGSFQCQCGRGYTGPRCEIDINECLSMPCQNDATCL-DRIGE--FTCICMPGYQGKYCEVDIDECESNPCVNDGICR-DMVNGFTCTCQPGFTGTMC-QIDIDECASTP 491          

HSP 3 Score: 63.1586 bits (152), Expect = 9.144e-10
Identity = 52/155 (33.55%), Postives = 73/155 (47.10%), Query Frame = 3
Query:  726 PSNLYKCSRNGKKL---------CNEGWKGEQCNEQDL--CLYQSC----VLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL-CEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            P  + KC  NG  +         C  G+ GE+C E D+  CL   C     LD  CI++    QC+C  G  G  C   ++ C S PCKN G C  + +   G  C C   + G  CE+S+ C+ +PC+N  +C       R C C+ G+ G LC
Sbjct: 1187 PRGMPKCQNNGTCVDRVGGYRCNCPPGFTGERC-EGDINECLSNPCNPSNSLD--CIQLPNDYQCVCKPGFTGRGCQSRFSVCESQPCKNGGVCSLSGSSPPGYSCTCQLGYAGSNCERSMNCKELPCYNGGSCTLTTRGAR-CTCIQGFGGPLC 1337          

HSP 4 Score: 62.7734 bits (151), Expect = 1.388e-9
Identity = 48/144 (33.33%), Postives = 68/144 (47.22%), Query Frame = 3
Query:  732 NLYKCSRNGKKLCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDF-NRKCICLPGYTGILCDQE 1148
            N Y+C       C  GW G+ C+ +++ CL   C   G C +      C C  G  G  C  N N C S+PC N+G C+    G     C C P + G  C + L  C   PC N+A+C +  D+   +C C PG+ G LC+ +
Sbjct:  690 NGYRCD------CEPGWVGKNCDLDRNDCLPSPCQNAGTCFDQLNGFTCKCRQGFRGNLCQVNINECASSPCLNQGTCV---DGVASFTCLCEPPYSGPTCAELLTPCSPNPCANHASCVHTPDYLGYQCNCQPGWQGHLCNND 824          

HSP 5 Score: 60.077 bits (144), Expect = 8.235e-9
Identity = 57/176 (32.39%), Postives = 76/176 (43.18%), Query Frame = 3
Query:  666 SMSAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCI--PNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            S   QC     G +CEI         C  +   L         C  G++G+ C  + D C    CV DG C ++     C C  G  G  C  + + C S PC+N  +CI  PN     G  C C   F G LCE ++  C+  PCH + TC  D   +  C C PGYTG  C+ +
Sbjct:  390 SFQCQCGRGYTGPRCEIDINECLSMPCQNDATCLDRIGEFTCICMPGYQGKYCEVDIDECESNPCVNDGICRDMVNGFTCTCQPGFTGTMCQIDIDECASTPCQNGAKCIDRPN-----GYECRCAEGFEGRLCESNIDNCKPDPCH-HGTC-VDGIASYTCNCEPGYTGYRCENQ 558          

HSP 6 Score: 51.2174 bits (121), Expect = 4.948e-6
Identity = 40/130 (30.77%), Postives = 55/130 (42.31%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRS-NPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +C  G++G+ C+  D C    C    +C   +    C C  G  G +C  + + CR    C N G C+ N  G    RC C   + G  CE     C    C N  TC    D   +C CLPG+ G  C+
Sbjct:   84 VCQRGFRGQDCSLVDACATSPCANGARCTNWNNHYNCSCPPGYQGKNCRNDIDECRKPGKCLNGGICM-NTHGS--FRCECLTGYSGRTCEVPTQPCAPSQCLNGGTCHQTGDHTYECACLPGFRGHNCE 210          

HSP 7 Score: 50.8322 bits (120), Expect = 6.894e-6
Identity = 38/96 (39.58%), Postives = 45/96 (46.88%), Query Frame = 3
Query:  870 QCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            QC C  G  G  C  + N C SNPCKN G C     G V   C C   + G  CE  +  C   PC N  +C  D   + +C CLPG+TG  C  E
Sbjct:  809 QCNCQPGWQGHLCNNDINECTSNPCKNRGTCTNTLGGYV---CSCRAGYTGPNCETDINDCSPNPCLNGGSCT-DGVNSFRCSCLPGFTGARCATE 900          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: dll4 (delta-like 4 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-041014-73])

HSP 1 Score: 72.7886 bits (177), Expect = 6.303e-13
Identity = 85/352 (24.15%), Postives = 138/352 (39.20%), Query Frame = 3
Query:  138 VFITLLFIFYHIYIDRGVSSERVGYLYFKFLCYENFEHLDRNGAECDSVPSKNCDPIFTICI-NHQYISGIDKDNCQIYYTETSSYDNHE----TVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALFGYQFTQSPSANYSNPIYDNITMYRQDRSIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPSN----LYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKP-QCMCN-GRIGPHCFPNYNPCRSNPCKNEGRC-IPNKTGEVGIRCHCNPNFFGVLCEQSL---CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
             ++T L  F+   + +   S   G        ++NF+ L  NG  C    + +C   F +C+ N+Q +  +   +C      T     +        +  T  R P +         I + W    + +  D ++    I+ F  Q      A +S  +                + ++  S    C+ N YG+ C   C P +     Y C+ +G+  C  GWKGE C E+ +CL      +G C     KP +C+C  G  G  C      C++ P    G C +P +       C+C   + G+ C+Q L       PC N ATC      +  CIC PGYTG+ C+ +
Sbjct:    3 AWLTFLIAFFTTVLTQIFGS---GVFELDLHEFKNFKGLLANGNSC----TPDCRTFFRVCLKNYQVV--VSPGDCIFGSALTPVLGTNSFRIMGGGSFSTPIRLPFNFGWPGSFSLIIEAWHSPYSDLPVDAYNPNMQISFFAIQRKLEVGAEWSQDVQSG------------KQTELRYSYRFICNENYYGDSCSKKCTPRDDRFGHYTCNPDGQLSCLPGWKGEYC-EEPICLEGCSEANGNC----SKPGECVCREGWQGKFC----TECKTYPACKHGTCHLPGQ-------CNCKEGWGGLFCDQDLNFCTHHKPCVNGATCMNTGQGSYTCICRPGYTGVNCELQ 317          

HSP 2 Score: 62.7734 bits (151), Expect = 9.140e-10
Identity = 47/143 (32.87%), Postives = 59/143 (41.26%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPR 1190
            C  G+ G  C  + D C    C  DG C+ + GK  C C  G  G  C  N N C +NPC N G C       V   C C P + G  C++  C   PC N  +C         C C  G+TG LC+   +    T   T  R
Sbjct:  383 CPLGYTGLNCERRMDKCTSMLCANDGLCLILGGKRICSCRAGFTGQRCEININDCANNPCANGGTCYDRINEYV---CSCPPGYKGRNCDRPSCLSTPCLNGGSCVGITGNPPACFCPSGFTGPLCEYYAVTAPVTRGETQDR 522          

HSP 3 Score: 58.5362 bits (140), Expect = 2.213e-8
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 3
Query:  744 CSRNGKKLCNEGWKGEQCNEQDLCL---YQSCVLDGKCIEI-DGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATC-EYDKDFNRKCICLPGYTGILCDQ 1145
            C   G+  C EGW G  C +QDL     ++ CV    C+    G   C+C  G  G +C      C S+PCKN G C  +   +    C C P+F G  CE SL  C   PC +   C E D   +  C C  GYTG+ C++
Sbjct:  257 CHLPGQCNCKEGWGGLFC-DQDLNFCTHHKPCVNGATCMNTGQGSYTCICRPGYTGVNCELQVRECDSSPCKNGGLCTDH---DKSYTCTCLPDFEGTHCEHSLLTCADSPCFHKGRCHEKDNGRSYACECPLGYTGLNCER 394          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 80.4925 bits (197), Expect = 6.242e-15
Identity = 62/203 (30.54%), Postives = 92/203 (45.32%), Query Frame = 3
Query:  693 RYGEKCEIFCKPSNLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQLGSTQTILFFSFGILFCIL 1292
            R G  CE+    S+ Y+C       C  GW G+ C + D C    C   GKC+  + +  C C +G  G  C  + N C  NPC+N G+C+ N+ G    RC+C   F G  CE+    C   PC N  TC    D + +C CLPG++G  C++     ++  P+   R G +    +   N Q     T  + +  +  C L
Sbjct:   71 RNGGTCELLSSVSD-YRCR------CPPGWTGDSCQQADPCASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCL-NEFGS--YRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEEN----IDDCPSNNCRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQL 259          

HSP 2 Score: 72.0182 bits (175), Expect = 2.825e-12
Identity = 50/142 (35.21%), Postives = 67/142 (47.18%), Query Frame = 3
Query:  732 NLYKCSRNGKKLCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNR-KCICLPGYTGILCD 1142
            N YKC       C+ GW G  C+   + C    C+  G C ++ G   C C  G  GP+C  N N C SNPC N G CI +     G +C+C   + G +CE  L  C   PC N   C+  +D+    C C PG+ G  C+
Sbjct:  682 NGYKCD------CDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDV---AGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCE 814          

HSP 3 Score: 59.3066 bits (142), Expect = 2.148e-8
Identity = 61/199 (30.65%), Postives = 79/199 (39.70%), Query Frame = 3
Query:  651 VKMFISMSAQCDHNRYGEKCEIF---CKP-----SNLYKCSRNGKKL---------CNEGWKGEQCNEQDL--CLYQSCVLDGK--CIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            + +  +    C     G  CEI    C P     S   KC  NGK +         C  G+ GE+C E D+  CL   C   G   CI++    +C C  G  G  C    + C+  PC+N G C      E G  C C P F G  CE     C  + C N  TC      + KC+C  GYTG  C    + P  + P
Sbjct: 1146 IDLINTYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGGYNCICPPGFVGERC-EGDVNECLSNPCDPRGTQNCIQLVNDYRCECRQGFTGRRCDSVVDGCKGLPCRNGGTCAVASNTERGFICKCPPGFDGATCEYDARTCGNLRCQNGGTC-ISVLKSSKCVCSEGYTGATCQYPVVSPCASRP 1342          

HSP 4 Score: 58.151 bits (139), Expect = 4.990e-8
Identity = 43/117 (36.75%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  807 DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVP--CHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            D C    C+ +GKC++   +  C C  G  G  C  + + C S PCKN  +C+    G     C C   F G  CEQ + E +P  CH   TC+ D      C+C PGYTG LCD +
Sbjct:  439 DECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCL---DGPNSYTCQCTEGFTGRHCEQDINECIPDPCHY-GTCK-DGIATFTCLCRPGYTGRLCDND 550          

HSP 5 Score: 53.1434 bits (126), Expect = 1.565e-6
Identity = 62/185 (33.51%), Postives = 80/185 (43.24%), Query Frame = 3
Query:  660 FISMSAQCDHNRYGEKCEI--FC------KPSNLYKCSRNGKKLCN--EGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
              S   +C H R G  C +   C      + SN      NGK +C    G+ G  CN         C L GKC    G  QC C  G  GP C  + N C SNPC+N+  C+ ++ GE   +C C P   GVL   ++  C   PC +N  C  DK     C C  G+ G LC Q  +    +TP
Sbjct:  312 VASFFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNND----VDECSL-GKCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCL-DQIGE--FQCICMP---GVLSATNIDECASNPCLHNGKC-VDKINEFHCECPTGFNGNLC-QHDVDECASTP 483          

HSP 6 Score: 51.6026 bits (122), Expect = 5.417e-6
Identity = 44/142 (30.99%), Postives = 60/142 (42.25%), Query Frame = 3
Query:  729 SNLYKCSRNGKKLCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +N   C  +    C  G+ G  C N    C   SC   G CI+      C C  G  G +C  + N C S PC N G C   +      +C C   + G+ C+  +  C+  PC N   C    +F R C C  G+TG+ CD
Sbjct:  905 ANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTC---QDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYR-CECKSGWTGVYCD 1042          

HSP 7 Score: 51.2174 bits (121), Expect = 7.111e-6
Identity = 57/184 (30.98%), Postives = 71/184 (38.59%), Query Frame = 3
Query:  660 FISMSAQCDHNRYGEKCEI--------------FCKPSN-LYKCSRNGKKLCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMCN---GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            + + S +C     G+ CEI               C+ +N  YKC+      C  G+ G  C  + D C    C   G C   DG     CN   G  GP C  + N C SNPCKN   C           C C P F G+ CE +   C    C N  TC  D      C C PG+TG  C  +
Sbjct:  797 YETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNTNGSYKCN------CKPGYAGRHCETDIDDCQPNPCHNGGSCS--DGINMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVN---SYTCTCQPGFSGIHCENNTPDCTESSCFNGGTC-IDGINTFSCQCPPGFTGNYCQHD 968          

HSP 8 Score: 50.8322 bits (120), Expect = 8.721e-6
Identity = 46/132 (34.85%), Postives = 60/132 (45.45%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDLCLYQSCVLD----GKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C EG+ G  C EQD+     C+ D    G C +      C+C  G  G  C  + N C S PC+N G+C   + G +   C C     GV CE +L  C   PC        DK    +C C PGYTG +C+
Sbjct:  501 CTEGFTGRHC-EQDI---NECIPDPCHYGTCKDGIATFTCLCRPGYTGRLCDNDINECLSQPCQNGGQCTDRENGYI---CTCPKGTTGVNCETNLDDCASNPCDYGKC--IDKIDGYECTCEPGYTGKMCN 623          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 80.4925 bits (197), Expect = 7.398e-15
Identity = 59/184 (32.07%), Postives = 86/184 (46.74%), Query Frame = 3
Query:  693 RYGEKCEIFCKPSNLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQ 1235
            R G  CE+    S+ Y+C       C  GW G+ C + D C    C   GKC+  + +  C C +G  G  C  + N C  NPC+N G+C+ N+ G    RC+C   F G  CE+    C   PC N  TC    D + +C CLPG++G  C++     ++  P+   R G +    +   N Q
Sbjct:  112 RNGGTCELLSSVSD-YRCR------CPPGWTGDSCQQADPCASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCL-NEFGS--YRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEEN----IDDCPSNNCRNGGTCVDGVNTYNCQ 281          

HSP 2 Score: 72.0182 bits (175), Expect = 2.420e-12
Identity = 65/179 (36.31%), Postives = 85/179 (47.49%), Query Frame = 3
Query:  660 FISMSAQCDHNRYGEKCEI--FC------KPSNLYKCSRNGKKLCN--EGWKGEQCN-EQDLCLYQS--CVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV--PCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
              S   +C H R G  C +   C      + SN      NGK +C    G+ G  CN + D C   +  C   G+C    G  QC C  G  GP C  + N C SNPC+N+  C+ ++ GE   +C C P F G  CEQ + E +  PCH   TC+ D      C+C PGYTG LCD +
Sbjct:  353 VASFFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCL-DQIGE--FQCICMPGFTGRHCEQDINECIPDPCH-YGTCK-DGIATFTCLCRPGYTGRLCDND 526          

HSP 3 Score: 71.633 bits (174), Expect = 3.100e-12
Identity = 50/142 (35.21%), Postives = 67/142 (47.18%), Query Frame = 3
Query:  732 NLYKCSRNGKKLCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNR-KCICLPGYTGILCD 1142
            N YKC       C+ GW G  C+   + C    C+  G C ++ G   C C  G  GP+C  N N C SNPC N G CI +     G +C+C   + G +CE  L  C   PC N   C+  +D+    C C PG+ G  C+
Sbjct:  658 NGYKCD------CDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDV---AGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCE 790          

HSP 4 Score: 59.3066 bits (142), Expect = 2.459e-8
Identity = 61/199 (30.65%), Postives = 79/199 (39.70%), Query Frame = 3
Query:  651 VKMFISMSAQCDHNRYGEKCEIF---CKP-----SNLYKCSRNGKKL---------CNEGWKGEQCNEQDL--CLYQSCVLDGK--CIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            + +  +    C     G  CEI    C P     S   KC  NGK +         C  G+ GE+C E D+  CL   C   G   CI++    +C C  G  G  C    + C+  PC+N G C      E G  C C P F G  CE     C  + C N  TC      + KC+C  GYTG  C    + P  + P
Sbjct: 1122 IDLINTYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGGYNCICPPGFVGERC-EGDVNECLSNPCDPRGTQNCIQLVNDYRCECRQGFTGRRCDSVVDGCKGLPCRNGGTCAVASNTERGFICKCPPGFDGATCEYDARTCGNLRCQNGGTC-ISVLKSSKCVCSEGYTGATCQYPVVSPCASRP 1318          

HSP 5 Score: 55.4546 bits (132), Expect = 3.055e-7
Identity = 53/173 (30.64%), Postives = 75/173 (43.35%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQS--------------------------CVLDGKCIE-------------IDGKPQCMC-NGRIGPHCFPNYNPCR--SNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV--PCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C  GW GE C+E  D C   +                          C LD  CI              ++GK  C C  G  GP C  + + C   +NPC++ GRC  N  G    +C+C   + G  CE  + E +  PC N+ATC  D+    +CIC+PG+TG  C+Q+
Sbjct:  321 VCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCT-NTLGS--FQCNCPQGYAGPRCEIDVNECLSNPCQNDATC-LDQIGEFQCICMPGFTGRHCEQD 489          

HSP 6 Score: 51.2174 bits (121), Expect = 6.362e-6
Identity = 44/142 (30.99%), Postives = 60/142 (42.25%), Query Frame = 3
Query:  729 SNLYKCSRNGKKLCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +N   C  +    C  G+ G  C N    C   SC   G CI+      C C  G  G +C  + N C S PC N G C   +      +C C   + G+ C+  +  C+  PC N   C    +F R C C  G+TG+ CD
Sbjct:  881 ANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTC---QDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYR-CECKSGWTGVYCD 1018          

HSP 7 Score: 50.8322 bits (120), Expect = 8.211e-6
Identity = 57/184 (30.98%), Postives = 71/184 (38.59%), Query Frame = 3
Query:  660 FISMSAQCDHNRYGEKCEI--------------FCKPSN-LYKCSRNGKKLCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMCN---GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            + + S +C     G+ CEI               C+ +N  YKC+      C  G+ G  C  + D C    C   G C   DG     CN   G  GP C  + N C SNPCKN   C           C C P F G+ CE +   C    C N  TC  D      C C PG+TG  C  +
Sbjct:  773 YETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNTNGSYKCN------CKPGYAGRHCETDIDDCQPNPCHNGGSCS--DGINMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVN---SYTCTCQPGFSGIHCENNTPDCTESSCFNGGTC-IDGINTFSCQCPPGFTGNYCQHD 944          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 80.1073 bits (196), Expect = 7.541e-15
Identity = 62/203 (30.54%), Postives = 92/203 (45.32%), Query Frame = 3
Query:  693 RYGEKCEIFCKPSNLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQLGSTQTILFFSFGILFCIL 1292
            R G  CE+    S+ Y+C       C  GW G+ C + D C    C   GKC+  + +  C C +G  G  C  + N C  NPC+N G+C+ N+ G    RC+C   F G  CE+    C   PC N  TC    D + +C CLPG++G  C++     ++  P+   R G +    +   N Q     T  + +  +  C L
Sbjct:   71 RNGGTCELLSSVSD-YRCR------CPPGWTGDSCQQADPCASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCL-NEFGS--YRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEEN----IDDCPSNNCRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQL 259          

HSP 2 Score: 71.633 bits (174), Expect = 3.268e-12
Identity = 50/142 (35.21%), Postives = 67/142 (47.18%), Query Frame = 3
Query:  732 NLYKCSRNGKKLCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNR-KCICLPGYTGILCD 1142
            N YKC       C+ GW G  C+   + C    C+  G C ++ G   C C  G  GP+C  N N C SNPC N G CI +     G +C+C   + G +CE  L  C   PC N   C+  +D+    C C PG+ G  C+
Sbjct:  693 NGYKCD------CDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDV---AGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCE 825          

HSP 3 Score: 61.2326 bits (147), Expect = 5.317e-9
Identity = 62/188 (32.98%), Postives = 85/188 (45.21%), Query Frame = 3
Query:  660 FISMSAQCDHNRYGEKCEI--FC------KPSNLYKCSRNGKKLCN--EGWKGEQCN-EQDLCLYQS--CVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
              S   +C H R G  C +   C      + SN      NGK +C    G+ G  CN + D C   +  C   G+C    G  QC C  G  GP C  + N C SNPC+N+  C+ ++ GE   +C C P + G+ CE ++  C   PC +N  C  DK     C C  G+ G LC Q  +    +TP
Sbjct:  312 VASFFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCL-DQIGE--FQCICMPGYEGLYCETNIDECASNPCLHNGKC-VDKINEFHCECPTGFNGNLC-QHDVDECASTP 494          

HSP 4 Score: 60.4622 bits (145), Expect = 8.494e-9
Identity = 47/132 (35.61%), Postives = 64/132 (48.48%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVP--CHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C  G++G  C    D C    C+ +GKC++   +  C C  G  G  C  + + C S PCKN  +C+    G     C C   F G  CEQ + E +P  CH   TC+ D      C+C PGYTG LCD +
Sbjct:  435 ICMPGYEGLYCETNIDECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCL---DGPNSYTCQCTEGFTGRHCEQDINECIPDPCHY-GTCK-DGIATFTCLCRPGYTGRLCDND 561          

HSP 5 Score: 58.9214 bits (141), Expect = 2.727e-8
Identity = 48/144 (33.33%), Postives = 63/144 (43.75%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQDL--CLYQSCVLDGK--CIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            +C  G+ GE+C E D+  CL   C   G   CI++    +C C  G  G  C    + C+  PC+N G C      E G  C C P F G  CE     C  + C N  TC      + KC+C  GYTG  C    + P  + P
Sbjct: 1212 ICPPGFVGERC-EGDVNECLSNPCDPRGTQNCIQLVNDYRCECRQGFTGRRCDSVVDGCKGLPCRNGGTCAVASNTERGFICKCPPGFDGATCEYDARTCGNLRCQNGGTC-ISVLKSSKCVCSEGYTGATCQYPVVSPCASRP 1353          

HSP 6 Score: 54.299 bits (129), Expect = 8.561e-7
Identity = 52/171 (30.41%), Postives = 73/171 (42.69%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQS--------------------------CVLDGKCIE-------------IDGKPQCMC-NGRIGPHCFPNYNPCR--SNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV--PCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +C  GW GE C+E  D C   +                          C LD  CI              ++GK  C C  G  GP C  + + C   +NPC++ GRC  N  G    +C+C   + G  CE  + E +  PC N+ATC  D+    +CIC+PGY G+ C+
Sbjct:  280 VCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCT-NTLGS--FQCNCPQGYAGPRCEIDVNECLSNPCQNDATC-LDQIGEFQCICMPGYEGLYCE 446          

HSP 7 Score: 51.2174 bits (121), Expect = 6.590e-6
Identity = 44/142 (30.99%), Postives = 60/142 (42.25%), Query Frame = 3
Query:  729 SNLYKCSRNGKKLCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +N   C  +    C  G+ G  C N    C   SC   G CI+      C C  G  G +C  + N C S PC N G C   +      +C C   + G+ C+  +  C+  PC N   C    +F R C C  G+TG+ CD
Sbjct:  916 ANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTC---QDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYR-CECKSGWTGVYCD 1053          

HSP 8 Score: 50.8322 bits (120), Expect = 8.220e-6
Identity = 57/184 (30.98%), Postives = 71/184 (38.59%), Query Frame = 3
Query:  660 FISMSAQCDHNRYGEKCEI--------------FCKPSN-LYKCSRNGKKLCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMCN---GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            + + S +C     G+ CEI               C+ +N  YKC+      C  G+ G  C  + D C    C   G C   DG     CN   G  GP C  + N C SNPCKN   C           C C P F G+ CE +   C    C N  TC  D      C C PG+TG  C  +
Sbjct:  808 YETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNTNGSYKCN------CKPGYAGRHCETDIDDCQPNPCHNGGSCS--DGINMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVN---SYTCTCQPGFSGIHCENNTPDCTESSCFNGGTC-IDGINTFSCQCPPGFTGNYCQHD 979          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 80.1073 bits (196), Expect = 8.000e-15
Identity = 62/203 (30.54%), Postives = 92/203 (45.32%), Query Frame = 3
Query:  693 RYGEKCEIFCKPSNLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQLGSTQTILFFSFGILFCIL 1292
            R G  CE+    S+ Y+C       C  GW G+ C + D C    C   GKC+  + +  C C +G  G  C  + N C  NPC+N G+C+ N+ G    RC+C   F G  CE+    C   PC N  TC    D + +C CLPG++G  C++     ++  P+   R G +    +   N Q     T  + +  +  C L
Sbjct:   76 RNGGTCELLSSVSD-YRCR------CPPGWTGDSCQQADPCASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCL-NEFGS--YRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEEN----IDDCPSNNCRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQL 264          

HSP 2 Score: 71.633 bits (174), Expect = 3.527e-12
Identity = 50/142 (35.21%), Postives = 67/142 (47.18%), Query Frame = 3
Query:  732 NLYKCSRNGKKLCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNR-KCICLPGYTGILCD 1142
            N YKC       C+ GW G  C+   + C    C+  G C ++ G   C C  G  GP+C  N N C SNPC N G CI +     G +C+C   + G +CE  L  C   PC N   C+  +D+    C C PG+ G  C+
Sbjct:  698 NGYKCD------CDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDV---AGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCE 830          

HSP 3 Score: 61.2326 bits (147), Expect = 5.786e-9
Identity = 62/188 (32.98%), Postives = 85/188 (45.21%), Query Frame = 3
Query:  660 FISMSAQCDHNRYGEKCEI--FC------KPSNLYKCSRNGKKLCN--EGWKGEQCN-EQDLCLYQS--CVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
              S   +C H R G  C +   C      + SN      NGK +C    G+ G  CN + D C   +  C   G+C    G  QC C  G  GP C  + N C SNPC+N+  C+ ++ GE   +C C P + G+ CE ++  C   PC +N  C  DK     C C  G+ G LC Q  +    +TP
Sbjct:  317 VASFFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCL-DQIGE--FQCICMPGYEGLYCETNIDECASNPCLHNGKC-VDKINEFHCECPTGFNGNLC-QHDVDECASTP 499          

HSP 4 Score: 60.4622 bits (145), Expect = 9.088e-9
Identity = 47/132 (35.61%), Postives = 64/132 (48.48%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVP--CHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C  G++G  C    D C    C+ +GKC++   +  C C  G  G  C  + + C S PCKN  +C+    G     C C   F G  CEQ + E +P  CH   TC+ D      C+C PGYTG LCD +
Sbjct:  440 ICMPGYEGLYCETNIDECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCL---DGPNSYTCQCTEGFTGRHCEQDINECIPDPCHY-GTCK-DGIATFTCLCRPGYTGRLCDND 566          

HSP 5 Score: 58.9214 bits (141), Expect = 2.943e-8
Identity = 48/144 (33.33%), Postives = 63/144 (43.75%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQDL--CLYQSCVLDGK--CIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            +C  G+ GE+C E D+  CL   C   G   CI++    +C C  G  G  C    + C+  PC+N G C      E G  C C P F G  CE     C  + C N  TC      + KC+C  GYTG  C    + P  + P
Sbjct: 1217 ICPPGFVGERC-EGDVNECLSNPCDPRGTQNCIQLVNDYRCECRQGFTGRRCDSVVDGCKGLPCRNGGTCAVASNTERGFICKCPPGFDGATCEYDARTCGNLRCQNGGTC-ISVLKSSKCVCSEGYTGATCQYPVVSPCASRP 1358          

HSP 6 Score: 53.9138 bits (128), Expect = 9.005e-7
Identity = 52/171 (30.41%), Postives = 73/171 (42.69%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQS--------------------------CVLDGKCIE-------------IDGKPQCMC-NGRIGPHCFPNYNPCR--SNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV--PCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +C  GW GE C+E  D C   +                          C LD  CI              ++GK  C C  G  GP C  + + C   +NPC++ GRC  N  G    +C+C   + G  CE  + E +  PC N+ATC  D+    +CIC+PGY G+ C+
Sbjct:  285 VCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCT-NTLGS--FQCNCPQGYAGPRCEIDVNECLSNPCQNDATC-LDQIGEFQCICMPGYEGLYCE 451          

HSP 7 Score: 51.2174 bits (121), Expect = 7.232e-6
Identity = 44/142 (30.99%), Postives = 60/142 (42.25%), Query Frame = 3
Query:  729 SNLYKCSRNGKKLCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +N   C  +    C  G+ G  C N    C   SC   G CI+      C C  G  G +C  + N C S PC N G C   +      +C C   + G+ C+  +  C+  PC N   C    +F R C C  G+TG+ CD
Sbjct:  921 ANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTC---QDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYR-CECKSGWTGVYCD 1058          

HSP 8 Score: 50.8322 bits (120), Expect = 9.022e-6
Identity = 57/184 (30.98%), Postives = 71/184 (38.59%), Query Frame = 3
Query:  660 FISMSAQCDHNRYGEKCEI--------------FCKPSN-LYKCSRNGKKLCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMCN---GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            + + S +C     G+ CEI               C+ +N  YKC+      C  G+ G  C  + D C    C   G C   DG     CN   G  GP C  + N C SNPCKN   C           C C P F G+ CE +   C    C N  TC  D      C C PG+TG  C  +
Sbjct:  813 YETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNTNGSYKCN------CKPGYAGRHCETDIDDCQPNPCHNGGSCS--DGINMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVN---SYTCTCQPGFSGIHCENNTPDCTESSCFNGGTC-IDGINTFSCQCPPGFTGNYCQHD 984          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 80.1073 bits (196), Expect = 8.530e-15
Identity = 59/184 (32.07%), Postives = 86/184 (46.74%), Query Frame = 3
Query:  693 RYGEKCEIFCKPSNLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQ 1235
            R G  CE+    S+ Y+C       C  GW G+ C + D C    C   GKC+  + +  C C +G  G  C  + N C  NPC+N G+C+ N+ G    RC+C   F G  CE+    C   PC N  TC    D + +C CLPG++G  C++     ++  P+   R G +    +   N Q
Sbjct:  125 RNGGTCELLSSVSD-YRCR------CPPGWTGDSCQQADPCASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCL-NEFGS--YRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEEN----IDDCPSNNCRNGGTCVDGVNTYNCQ 294          

HSP 2 Score: 71.633 bits (174), Expect = 3.480e-12
Identity = 50/142 (35.21%), Postives = 67/142 (47.18%), Query Frame = 3
Query:  732 NLYKCSRNGKKLCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNR-KCICLPGYTGILCD 1142
            N YKC       C+ GW G  C+   + C    C+  G C ++ G   C C  G  GP+C  N N C SNPC N G CI +     G +C+C   + G +CE  L  C   PC N   C+  +D+    C C PG+ G  C+
Sbjct:  747 NGYKCD------CDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDV---AGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCE 879          

HSP 3 Score: 61.2326 bits (147), Expect = 5.657e-9
Identity = 62/188 (32.98%), Postives = 85/188 (45.21%), Query Frame = 3
Query:  660 FISMSAQCDHNRYGEKCEI--FC------KPSNLYKCSRNGKKLCN--EGWKGEQCN-EQDLCLYQS--CVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
              S   +C H R G  C +   C      + SN      NGK +C    G+ G  CN + D C   +  C   G+C    G  QC C  G  GP C  + N C SNPC+N+  C+ ++ GE   +C C P + G+ CE ++  C   PC +N  C  DK     C C  G+ G LC Q  +    +TP
Sbjct:  366 VASFFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCL-DQIGE--FQCICMPGYEGLYCETNIDECASNPCLHNGKC-VDKINEFHCECPTGFNGNLC-QHDVDECASTP 548          

HSP 4 Score: 60.4622 bits (145), Expect = 9.114e-9
Identity = 47/132 (35.61%), Postives = 64/132 (48.48%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVP--CHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C  G++G  C    D C    C+ +GKC++   +  C C  G  G  C  + + C S PCKN  +C+    G     C C   F G  CEQ + E +P  CH   TC+ D      C+C PGYTG LCD +
Sbjct:  489 ICMPGYEGLYCETNIDECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCL---DGPNSYTCQCTEGFTGRHCEQDINECIPDPCHY-GTCK-DGIATFTCLCRPGYTGRLCDND 615          

HSP 5 Score: 58.9214 bits (141), Expect = 2.781e-8
Identity = 48/144 (33.33%), Postives = 63/144 (43.75%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQDL--CLYQSCVLDGK--CIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            +C  G+ GE+C E D+  CL   C   G   CI++    +C C  G  G  C    + C+  PC+N G C      E G  C C P F G  CE     C  + C N  TC      + KC+C  GYTG  C    + P  + P
Sbjct: 1266 ICPPGFVGERC-EGDVNECLSNPCDPRGTQNCIQLVNDYRCECRQGFTGRRCDSVVDGCKGLPCRNGGTCAVASNTERGFICKCPPGFDGATCEYDARTCGNLRCQNGGTC-ISVLKSSKCVCSEGYTGATCQYPVVSPCASRP 1407          

HSP 6 Score: 54.299 bits (129), Expect = 8.579e-7
Identity = 52/171 (30.41%), Postives = 73/171 (42.69%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQS--------------------------CVLDGKCIE-------------IDGKPQCMC-NGRIGPHCFPNYNPCR--SNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV--PCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +C  GW GE C+E  D C   +                          C LD  CI              ++GK  C C  G  GP C  + + C   +NPC++ GRC  N  G    +C+C   + G  CE  + E +  PC N+ATC  D+    +CIC+PGY G+ C+
Sbjct:  334 VCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCT-NTLGS--FQCNCPQGYAGPRCEIDVNECLSNPCQNDATC-LDQIGEFQCICMPGYEGLYCE 500          

HSP 7 Score: 51.2174 bits (121), Expect = 6.831e-6
Identity = 44/142 (30.99%), Postives = 60/142 (42.25%), Query Frame = 3
Query:  729 SNLYKCSRNGKKLCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +N   C  +    C  G+ G  C N    C   SC   G CI+      C C  G  G +C  + N C S PC N G C   +      +C C   + G+ C+  +  C+  PC N   C    +F R C C  G+TG+ CD
Sbjct:  970 ANCTDCVNSYTCTCQPGFSGIHCENNTPDCTESSCFNGGTCIDGINTFSCQCPPGFTGNYCQHDINECDSKPCLNGGTC---QDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYR-CECKSGWTGVYCD 1107          

HSP 8 Score: 50.8322 bits (120), Expect = 9.198e-6
Identity = 57/184 (30.98%), Postives = 71/184 (38.59%), Query Frame = 3
Query:  660 FISMSAQCDHNRYGEKCEI--------------FCKPSN-LYKCSRNGKKLCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMCN---GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            + + S +C     G+ CEI               C+ +N  YKC+      C  G+ G  C  + D C    C   G C   DG     CN   G  GP C  + N C SNPCKN   C           C C P F G+ CE +   C    C N  TC  D      C C PG+TG  C  +
Sbjct:  862 YETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNTNGSYKCN------CKPGYAGRHCETDIDDCQPNPCHNGGSCS--DGINMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVN---SYTCTCQPGFSGIHCENNTPDCTESSCFNGGTC-IDGINTFSCQCPPGFTGNYCQHD 1033          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Notch3 (notch 3 [Source:MGI Symbol;Acc:MGI:99460])

HSP 1 Score: 74.3294 bits (181), Expect = 3.711e-13
Identity = 45/130 (34.62%), Postives = 63/130 (48.46%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDLCLYQSCVLDGKC-IEIDGKPQCMCN-GRIGPHCFPNYNPCRS-NPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C  G++G  C++ D C+ + CV    C +  DG+  C C  G  G  C  + + CRS   C++ G C+ N  G    RC C   + G+LCE  +  C   PC N  TC    D    C CLPG+ G  C+
Sbjct:  109 CLRGFQGPDCSQPDPCVSRPCVHGAPCSVGPDGRFACACPPGYQGQSCQSDIDECRSGTTCRHGGTCL-NTPGS--FRCQCPLGYTGLLCENPVVPCAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCE 235          

HSP 2 Score: 71.633 bits (174), Expect = 2.391e-12
Identity = 57/184 (30.98%), Postives = 78/184 (42.39%), Query Frame = 3
Query:  681 CDHNRYGEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEG-RCIPNKTGE---VGIRCHCNPNFFGVLCEQSLCEIVP--CHNNAT--CEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            C   R G  CE    P     C   G            C  G+ G+ C +  D C  Q C   G CI++  +  C C  G +G  C  N + C   P  + G +C+ N T      G RC+C P + G+ CE  + E  P  CH   T  C  D   + +C+C PG+TG  C Q  + P E+ P
Sbjct: 1073 CPEGRTGSHCEHEVDPCTAQPCQHGGTCRGYMGGYVCECPAGYAGDSCEDNIDECASQPCQNGGSCIDLVARYLCSCPPGTLGVLCEINEDDCDLGPSLDSGVQCLHNGTCVDLVGGFRCNCPPGYTGLHCEADINECRPGACHAAHTRDCLQDPGGHFRCVCHPGFTGPRC-QIALSPCESQP 1255          

HSP 3 Score: 70.4774 bits (171), Expect = 5.428e-12
Identity = 50/149 (33.56%), Postives = 66/149 (44.30%), Query Frame = 3
Query:  741 KCSRNGKK-LCNEGWKGEQCNEQDL-C----------LYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +C + G   +C  GW G  C+ Q L C          L Q C   GKCI+      C+C  GR G HC    +PC + PC++ G C     G V   C C   + G  CE ++  C   PC N  +C  D      C C PG  G+LC+
Sbjct: 1015 RCVQTGAYCICPPGWSGRLCDIQSLPCTEAAAQMGVRLEQLCQEGGKCIDKGRSHYCVCPEGRTGSHCEHEVDPCTAQPCQHGGTCRGYMGGYV---CECPAGYAGDSCEDNIDECASQPCQNGGSC-IDLVARYLCSCPPGTLGVLCE 1159          

HSP 4 Score: 69.707 bits (169), Expect = 1.004e-11
Identity = 48/146 (32.88%), Postives = 61/146 (41.78%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDL--CLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPR 1190
            C  G+ G  C E DL  C   SC   G C++      C+C  G  G HC    +PC S PC + G C P      G  C C   F G  C+  +  C   PC N   C     +   CIC PG++G LCD + +   E       R
Sbjct:  913 CPPGYGGFHC-EIDLPDCSPSSCFNGGTCVDGVSSFSCLCRPGYTGTHCQYEADPCFSRPCLHGGICNPTHP---GFECTCREGFTGSQCQNPVDWCSQAPCQNGGRCVQTGAY---CICPPGWSGRLCDIQSLPCTEAAAQMGVR 1051          

HSP 5 Score: 67.781 bits (164), Expect = 3.866e-11
Identity = 43/132 (32.58%), Postives = 61/132 (46.21%), Query Frame = 3
Query:  765 LCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C  G+ G  C  + D C    CV  G C +      C C +G  G  C  + + C S PC+N  +C+    G     C C   F G LCE+++  C   PCH+    +    F+  C C PGYTGI C+ +
Sbjct:  457 ICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFSGSMCQLDVDECASTPCRNGAKCVDQPDG---YECRCAEGFEGTLCERNVDDCSPDPCHHGRCVDGIASFS--CACAPGYTGIRCESQ 583          

HSP 6 Score: 64.3142 bits (155), Expect = 5.303e-10
Identity = 41/130 (31.54%), Postives = 61/130 (46.92%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQS--CVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            C  G+ G  C++  D C   +  C   G+C+   G   C C  G  GP C  + N C S PC+N+  C+ ++ G+    C C   F G  CE  +  C+  PC N   C+ D+     C C  G++G +C
Sbjct:  380 CPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCL-DRIGQ--FTCICMAGFTGTYCEVDIDECQSSPCVNGGVCK-DRVNGFSCTCPSGFSGSMC 505          

HSP 7 Score: 63.929 bits (154), Expect = 5.629e-10
Identity = 45/136 (33.09%), Postives = 61/136 (44.85%), Query Frame = 3
Query:  753 NGKKLCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            N + +C+ G+ G  C++  D C    C+  G C +  G   C C +G  GP C  + + C S+PC   G C  +        C C P + G  CE  L  C    C N  TC  D   +  C+C PGYTG  C  E
Sbjct:  833 NFRCICHRGYTGPFCDQDIDDCDPNPCLHGGSCQDGVGSFSCSCLDGFAGPRCARDVDECLSSPC-GPGTCTDHVAS---FTCACPPGYGGFHCEIDLPDCSPSSCFNGGTC-VDGVSSFSCLCRPGYTGTHCQYE 963          

HSP 8 Score: 63.5438 bits (153), Expect = 8.548e-10
Identity = 51/174 (29.31%), Postives = 72/174 (41.38%), Query Frame = 3
Query:  663 ISMSAQCDHNRYGEKCEIF--CKPS---NLYKCSRNGKKL----CNEGWKGEQCNEQ-DLCLYQS-CVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            I     C     G +CE+   C PS   +   C  +  +L    C  GW+G +C +  D C   S C   G C  + G  +C+C+ G  GP C  + + C  NPC + G C   + G     C C   F G  C + +  C   PC      ++   F   C C PGY G  C+
Sbjct:  755 IGFRCTCAPGFQGHQCEVLSPCTPSLCEHGGHCESDPDRLTVCSCPPGWQGPRCQQDVDECAGASPCGPHGTCTNLPGNFRCICHRGYTGPFCDQDIDDCDPNPCLHGGSC---QDGVGSFSCSCLDGFAGPRCARDVDECLSSPCGPGTCTDHVASFT--CACPPGYGGFHCE 923          

HSP 9 Score: 62.7734 bits (151), Expect = 1.244e-9
Identity = 45/147 (30.61%), Postives = 64/147 (43.54%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQDLCLYQSCVLDGKC----IEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHNNATCEY-----DKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            LC  GW GE+C  +D C    C   G C    +    +  C C  G  GP C    +PC S PC +   C     G     C C P + G  C+  + E   C +  TC +     +   + +C C  GYTG+LC + P++P   +P
Sbjct:   67 LCLPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCLRGFQGPDC-SQPDPCVSRPCVHGAPCSVGPDGRFA--CACPPGYQGQSCQSDIDE---CRSGTTCRHGGTCLNTPGSFRCQCPLGYTGLLC-ENPVVPCAPSP 206          

HSP 10 Score: 62.003 bits (149), Expect = 2.258e-9
Identity = 41/116 (35.34%), Postives = 53/116 (45.69%), Query Frame = 3
Query:  813 CLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNP--CRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE-QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            C ++ C   G C +  G  +C+C  G  GP C  +  P  C S PC+  G C  +    +G RC C P F G  CE  S C    C +   CE D D    C C PG+ G  C Q+
Sbjct:  700 CAHKPCS-HGVCHDAPGGFRCVCEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDG---IGFRCTCAPGFQGHQCEVLSPCTPSLCEHGGHCESDPDRLTVCSCPPGWQGPRCQQD 811          

HSP 11 Score: 60.8474 bits (146), Expect = 5.525e-9
Identity = 41/134 (30.60%), Postives = 58/134 (43.28%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ---DLCLYQSCVLDGKCIEIDGKPQCMCNGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV---PCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C  GW G +C++    D C  Q C   G C       +C C      H     +PC  + C++ G C      +    C C P + G  C+Q + E     PC  + TC  +   N +CIC  GYTG  CDQ+
Sbjct:  720 VCEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFRCTCAPGFQGHQCEVLSPCTPSLCEHGGHC--ESDPDRLTVCSCPPGWQGPRCQQDVDECAGASPCGPHGTCT-NLPGNFRCICHRGYTGPFCDQD 850          

HSP 12 Score: 59.6918 bits (143), Expect = 1.120e-8
Identity = 48/165 (29.09%), Postives = 66/165 (40.00%), Query Frame = 3
Query:  699 GEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQ--SCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE-QSLCEIVPCHNNATCEYDKDFNRK-CICLPGYTGILCDQE 1148
            G+ CE+       ++C   G  +         C   W G+ C E  D C  Q  +C   G C  + G   C+C NG  G  C  N + C +  C +   C           C C     G+LC     C   PCH +A C+ +    R  C C PG+TG  CDQ+
Sbjct:  231 GQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATC---HDRVASFYCACPMGKTGLLCHLDDACVSNPCHEDAICDTNPVSGRAICTCPPGFTGGACDQD 392          

HSP 13 Score: 57.7658 bits (138), Expect = 4.376e-8
Identity = 56/208 (26.92%), Postives = 67/208 (32.21%), Query Frame = 3
Query:  666 SMSAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTG----------------------------------EVGIRCHCNPNFFGVLCEQSL----CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            S S  C     G +CE          C   GK L         C  G  G  C    D C    C   G C +   +  C+C  G  GP C    N C S+PC   G C+  + G                                    G RC C P + G  C QSL    CE  PC    TC  D     +C C PG+ G  C+
Sbjct:  566 SFSCACAPGYTGIRCESQVDECRSQPCRYGGKCLDLVDKYLCRCPPGTTGVNCEVNIDDCASNPCTF-GVCRDGINRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENGFHCLCPPGSLPPLCLPANHPCAHKPCSHGVCHDAPGGFRCVCEPGWSGPRCSQSLAPDACESQPCQAGGTCTSD-GIGFRCTCAPGFQGHQCE 771          

HSP 14 Score: 57.3806 bits (137), Expect = 7.356e-8
Identity = 52/173 (30.06%), Postives = 69/173 (39.88%), Query Frame = 3
Query:  672 SAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKL----------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            S  C     G  C++         C RNG K           C EG++G  C    D C    C   G+C++      C C  G  G  C    + CRS PC+  G+C+      +   C C P   GV CE ++  C   PC     C  D      C+C PG+TG LC+ E
Sbjct:  493 SCTCPSGFSGSMCQLDVDECASTPC-RNGAKCVDQPDGYECRCAEGFEGTLCERNVDDCSPDPC-HHGRCVDGIASFSCACAPGYTGIRCESQVDECRSQPCRYGGKCLDLVDKYL---CRCPPGTTGVNCEVNIDDCASNPC-TFGVCR-DGINRYDCVCQPGFTGPLCNVE 658          

HSP 15 Score: 54.299 bits (129), Expect = 6.498e-7
Identity = 33/98 (33.67%), Postives = 49/98 (50.00%), Query Frame = 3
Query:  861 GKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPN--KTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            G  +C+C+ G  GP C    +PC S PC++ G+C  +  + G +   CHC P F+G+ CE+    C  + C     C+      R C C PG +G  C
Sbjct: 1229 GHFRCVCHPGFTGPRCQIALSPCESQPCQHGGQCRHSLGRGGGLTFTCHCVPPFWGLRCERVARSCRELQCPVGIPCQQTARGPR-CACPPGLSGPSC 1325          

HSP 16 Score: 52.373 bits (124), Expect = 2.429e-6
Identity = 41/134 (30.60%), Postives = 56/134 (41.79%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV----PCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C  GW GE C++  D C    C     C +      C C  G+ G  C  + + C SNPC  +  C  N      I C C P F G  C+Q + E      PC +   C  +   +  C C  GYTG  C+ +
Sbjct:  302 VCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLD-DACVSNPCHEDAICDTNPVSGRAI-CTCPPGFTGGACDQDVDECSIGANPCEHLGRC-VNTQGSFLCQCGRGYTGPRCETD 432          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Notch4 (notch 4 [Source:MGI Symbol;Acc:MGI:107471])

HSP 1 Score: 73.9442 bits (180), Expect = 5.264e-13
Identity = 48/150 (32.00%), Postives = 67/150 (44.67%), Query Frame = 3
Query:  741 KCSRNGKK---LCNEGWKGEQCN----------EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +C ++G     LC +GW G  C+           Q + +   C   G CI+      C C  G  G  C  N NPC  NPC +   C+P  +G V   C C P + G  C + L  C+  PCHN+ TC   +     C C PG+ G+ C+
Sbjct:  855 RCLQSGPSFQCLCLQGWTGALCDFPLSCQKAAMSQGIEISGLCQNGGLCIDTGSSYFCRCPPGFQGKLCQDNVNPCEPNPCHHGSTCVPQPSGYV---CQCAPGYEGQNCSKVLDACQSQPCHNHGTCT-SRPGGFHCACPPGFVGLRCE 1000          

HSP 2 Score: 70.4774 bits (171), Expect = 5.865e-12
Identity = 45/132 (34.09%), Postives = 61/132 (46.21%), Query Frame = 3
Query:  765 LCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            LC  G+ G +C  + + CL Q C     C+++     C+C  G  G  C    N C SNPC N+  C     G    +C C P F G  CE+ +  C   PC N   C  D+     C CLPG+ G  C++E
Sbjct:  459 LCLPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNG---FQCLCLPGFTGARCEKDMDECSSTPCANGGRCR-DQPGAFYCECLPGFEGPHCEKE 586          

HSP 3 Score: 65.855 bits (159), Expect = 1.394e-10
Identity = 56/180 (31.11%), Postives = 76/180 (42.22%), Query Frame = 3
Query:  666 SMSAQCDHNRYGEKCEI----FCKPSNL-YKCSRN---GKKLC--NEGWKGEQCNEQ-DLCLYQS-----CVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            S S  C   R G  C +      +P ++  +CS N   G  LC    G+ G  C++  D C         C   G CI   G   C+C  G  G  C  ++N C S PC     C+          C C P   G LCE  +  C   PC N A C +D     +C+CLPG+TG  C+++
Sbjct:  373 SFSCLCPPGRTGLLCHLEDMCLSQPCHVNAQCSTNPLTGSTLCICQPGYSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQPCHPGSTCLDLLAT---FHCLCPPGLEGRLCEVEVNECTSNPCLNQAAC-HDLLNGFQCLCLPGFTGARCEKD 548          

HSP 4 Score: 62.7734 bits (151), Expect = 1.443e-9
Identity = 46/135 (34.07%), Postives = 62/135 (45.93%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQS---CVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE-QSLCEIVPCHNNATCEYDK-DFNRKCICLPGYTGILCDQE 1148
            LC + WKG  C+E  D C  +    C   G C    G   C+C +G  G  C  N + C +  C     CI ++ G     C C P   G+LC  + +C   PCH NA C  +    +  CIC PGY+G  C Q+
Sbjct:  298 LCPKTWKGWDCSEDIDECEARGPPRCRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDCAAATCAPGSTCI-DRVGS--FSCLCPPGRTGLLCHLEDMCLSQPCHVNAQCSTNPLTGSTLCICQPGYSGSTCHQD 429          

HSP 5 Score: 61.6178 bits (148), Expect = 3.386e-9
Identity = 52/167 (31.14%), Postives = 65/167 (38.92%), Query Frame = 3
Query:  681 CDHNRYGEKCEIFCKPSNLYKCSRNG---------KKLCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL---CEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            CD    G +CE          C+  G            C  G+ G  C+E+   C    C+  G C        C C     G HC    + C S  C N G C+ NK G     C C   F G+ CE+     C   PC N ATC+ D     +C+C PGYTG  C
Sbjct:  676 CDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMGLTCSEEVTACHSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDHCVSASCLNGGTCV-NKPGT--FFCLCATGFQGLHCEEKTNPSCADSPCRNKATCQ-DTPRGARCLCSPGYTGSSC 838          

HSP 6 Score: 59.6918 bits (143), Expect = 1.206e-8
Identity = 40/132 (30.30%), Postives = 56/132 (42.42%), Query Frame = 3
Query:  765 LCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C+EGW G +C  E   C+   C   G C        C C  G +G  C      C S PC N G C        G  C C P+  G  C+ ++  C    C N  TC  +K     C+C  G+ G+ C+++
Sbjct:  675 VCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMGLTCSEEVTACHSGPCLNGGSC---SIRPEGYSCTCLPSHTGRHCQTAVDHCVSASCLNGGTC-VNKPGTFFCLCATGFQGLHCEEK 802          

HSP 7 Score: 57.3806 bits (137), Expect = 6.916e-8
Identity = 53/182 (29.12%), Postives = 71/182 (39.01%), Query Frame = 3
Query:  672 SAQCDHNRYGEKC----EIFCKPSNLYKCSRNG----------KKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPC--RSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRK---CICLPGYTGILCDQEP 1151
            S  C     G++C    E  C PS    CS  G          +  C  GW GEQC  +D C    C   G C+    + QC C  G  G  C  + N C     PC  +G    N  G    +C C     G  C+  +  C    C N  TC+   + +     C+C PG+TG+ C+  P
Sbjct:   99 SCTCPSGFTGDRCQTHLEELCPPSF---CSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDFCSANPCANGGVCLATYPQIQCRCPPGFEGHTCERDINECFLEPGPCP-QGTSCHNTLGSY--QCLCPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNP 274          

HSP 8 Score: 56.9954 bits (136), Expect = 9.397e-8
Identity = 44/157 (28.03%), Postives = 57/157 (36.31%), Query Frame = 3
Query:  765 LCNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCE---------------------------IVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            LC  G+ G +C  + D C    C   G+C +  G   C C  G  GPHC    + C S+PC     C+          C C P F G LCE  LC                             VP  +N  C +       C+C  G+TG  C+ E
Sbjct:  535 LCLPGFTGARCEKDMDECSSTPCANGGRCRDQPGAFYCECLPGFEGPHCEKEVDECLSDPCPVGASCLDLPGA---FFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHGHCQRSLCVCDEGWTGPECETE 688          

HSP 9 Score: 53.1434 bits (126), Expect = 1.305e-6
Identity = 31/92 (33.70%), Postives = 41/92 (44.57%), Query Frame = 3
Query:  873 CMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLC--EQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            C+C+ G  GP C      C S PC + G C P  +   G  C C   + G+ C  E + C   PC N  +C    +    C CLP +TG  C
Sbjct:  674 CVCDEGWTGPECETELGGCISTPCAHGGTCHPQPS---GYNCTCPAGYMGLTCSEEVTACHSGPCLNGGSCSIRPE-GYSCTCLPSHTGRHC 761          

HSP 10 Score: 51.6026 bits (122), Expect = 3.912e-6
Identity = 41/132 (31.06%), Postives = 49/132 (37.12%), Query Frame = 3
Query:  768 CNEGWKGEQCN-EQDLCLYQSCVLDGK--CIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRK--CICLPGYTGILC 1139
            C  G+ G +C  + D CL + C   G   C  +     C C  G  G  C    + C+S PC N G C        G  CHC   F G  C      C I  CHN   C           C CL G+ G  C
Sbjct:  990 CPPGFVGLRCEGDVDECLDRPCHPSGTAACHSLANAFYCQCLPGHTGQRCEVEMDLCQSQPCSNGGSCEITTGPPPGFTCHCPKGFEGPTCSHKALSCGIHHCHNGGLCLPSPKPGSPPLCACLSGFGGPDC 1121          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Vcan (versican [Source:MGI Symbol;Acc:MGI:102889])

HSP 1 Score: 69.707 bits (169), Expect = 1.110e-11
Identity = 35/84 (41.67%), Postives = 44/84 (52.38%), Query Frame = 3
Query:  906 FPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNR-KCICLPGYTGILCDQE 1148
             P  + C++NPC N G C P +T  V   C C P + G  CE     C   PC N ATC     FN  +C+CLP Y G LC+Q+
Sbjct: 3045 LPGPDLCKTNPCLNGGTCYPTETSYV---CTCAPGYSGDQCELDFDECHSNPCRNGATCV--DGFNTFRCLCLPSYVGALCEQD 3123          

HSP 2 Score: 58.151 bits (139), Expect = 4.117e-8
Identity = 31/93 (33.33%), Postives = 42/93 (45.16%), Query Frame = 3
Query:  807 DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHNNATCEY 1082
            DLC    C+  G C   +    C C  G  G  C  +++ C SNPC+N   C+    G    RC C P++ G LCEQ         +  TC+Y
Sbjct: 3049 DLCKTNPCLNGGTCYPTETSYVCTCAPGYSGDQCELDFDECHSNPCRNGATCV---DGFNTFRCLCLPSYVGALCEQ---------DTETCDY 3129          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Vcan (versican [Source:MGI Symbol;Acc:MGI:102889])

HSP 1 Score: 68.9366 bits (167), Expect = 1.654e-11
Identity = 35/84 (41.67%), Postives = 44/84 (52.38%), Query Frame = 3
Query:  906 FPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNR-KCICLPGYTGILCDQE 1148
             P  + C++NPC N G C P +T  V   C C P + G  CE     C   PC N ATC     FN  +C+CLP Y G LC+Q+
Sbjct: 2085 LPGPDLCKTNPCLNGGTCYPTETSYV---CTCAPGYSGDQCELDFDECHSNPCRNGATCV--DGFNTFRCLCLPSYVGALCEQD 2163          

HSP 2 Score: 57.7658 bits (138), Expect = 5.573e-8
Identity = 31/93 (33.33%), Postives = 42/93 (45.16%), Query Frame = 3
Query:  807 DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHNNATCEY 1082
            DLC    C+  G C   +    C C  G  G  C  +++ C SNPC+N   C+    G    RC C P++ G LCEQ         +  TC+Y
Sbjct: 2089 DLCKTNPCLNGGTCYPTETSYVCTCAPGYSGDQCELDFDECHSNPCRNGATCV---DGFNTFRCLCLPSYVGALCEQ---------DTETCDY 2169          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Svep1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:MGI Symbol;Acc:MGI:1928849])

HSP 1 Score: 68.9366 bits (167), Expect = 1.846e-11
Identity = 45/129 (34.88%), Postives = 65/129 (50.39%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C+ G+ G+ C E  + C+   C+  G C +     +C C  G +G HC  + N C+S+PC N   C   K    G  C C P F G  CE+++  C   PC N ATC+ D   + +C C  G+TG  C+
Sbjct: 1256 CSLGYSGQICEENINECISSPCLNKGTCTDGLASYRCTCVKGYMGVHCETDVNECQSSPCLNNAVC---KDQVGGFSCKCPPGFLGTRCEKNVDECLSQPCQNGATCK-DGANSFRCQCPAGFTGTHCE 1380          

HSP 2 Score: 61.2326 bits (147), Expect = 4.451e-9
Identity = 46/132 (34.85%), Postives = 63/132 (47.73%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDL--CLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            C +G+ G  C E D+  C    C+ +  C +  G   C C  G +G  C  N + C S PC+N   C   K G    RC C   F G  CE ++  C+  PC N ATC  D+  +  C C PG++G  C+ E
Sbjct: 1294 CVKGYMGVHC-ETDVNECQSSPCLNNAVCKDQVGGFSCKCPPGFLGTRCEKNVDECLSQPCQNGATC---KDGANSFRCQCPAGFTGTHCELNINECQSNPCRNQATC-VDELNSYSCKCQPGFSGHRCETE 1420          

HSP 3 Score: 51.2174 bits (121), Expect = 5.527e-6
Identity = 36/115 (31.30%), Postives = 56/115 (48.70%), Query Frame = 3
Query:  813 CLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV--PCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            C    C   G C ++     C+C  G  G  C  + + C S PC N G C  ++ G  G  C C+  + G +CE+++ E +  PC N  TC  D   + +C C+ GY G+ C+ +
Sbjct: 1196 CFLNPCHNSGTCQQLGRGYVCLCPPGYTGLKCETDIDECSSLPCLNGGICR-DQVG--GFTCECSLGYSGQICEENINECISSPCLNKGTCT-DGLASYRCTCVKGYMGVHCETD 1306          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|A2RUV0|NOTC1_XENTR (Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis OX=8364 GN=notch1 PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 4.593e-14
Identity = 59/184 (32.07%), Postives = 86/184 (46.74%), Query Frame = 3
Query:  693 RYGEKCEIFCKPSNLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQ 1235
            R G  CE+    S+ Y+C       C  GW G+ C + D C    C   GKC+  + +  C C +G  G  C  + N C  NPC+N G+C+ N+ G    RC+C   F G  CE+    C   PC N  TC    D + +C CLPG++G  C++     ++  P+   R G +    +   N Q
Sbjct:  112 RNGGTCELLSSVSD-YRCR------CPPGWTGDSCQQADPCASNPCANGGKCLPFETQYICKCPSGFHGATCKQDINECSQNPCRNGGQCL-NEFGS--YRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEEN----IDDCPSNNCRNGGTCVDGVNTYNCQ 281          

HSP 2 Score: 71.633 bits (174), Expect = 1.858e-11
Identity = 50/142 (35.21%), Postives = 67/142 (47.18%), Query Frame = 3
Query:  732 NLYKCSRNGKKLCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNR-KCICLPGYTGILCD 1142
            N YKC       C+ GW G  C+   + C    C+  G C ++ G   C C  G  GP+C  N N C SNPC N G CI +     G +C+C   + G +CE  L  C   PC N   C+  +D+    C C PG+ G  C+
Sbjct:  734 NGYKCD------CDAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDV---AGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCE 866          

HSP 3 Score: 61.2326 bits (147), Expect = 3.047e-8
Identity = 62/188 (32.98%), Postives = 85/188 (45.21%), Query Frame = 3
Query:  660 FISMSAQCDHNRYGEKCEI--FC------KPSNLYKCSRNGKKLCN--EGWKGEQCN-EQDLCLYQS--CVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
              S   +C H R G  C +   C      + SN      NGK +C    G+ G  CN + D C   +  C   G+C    G  QC C  G  GP C  + N C SNPC+N+  C+ ++ GE   +C C P + G+ CE ++  C   PC +N  C  DK     C C  G+ G LC Q  +    +TP
Sbjct:  353 VASFFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCL-DQIGE--FQCICMPGYEGLYCETNIDECASNPCLHNGKC-VDKINEFHCECPTGFNGNLC-QHDVDECASTP 535          

HSP 4 Score: 60.4622 bits (145), Expect = 5.079e-8
Identity = 47/132 (35.61%), Postives = 64/132 (48.48%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVP--CHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C  G++G  C    D C    C+ +GKC++   +  C C  G  G  C  + + C S PCKN  +C+    G     C C   F G  CEQ + E +P  CH   TC+ D      C+C PGYTG LCD +
Sbjct:  476 ICMPGYEGLYCETNIDECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCL---DGPNSYTCQCTEGFTGRHCEQDINECIPDPCHY-GTCK-DGIATFTCLCRPGYTGRLCDND 602          

HSP 5 Score: 58.9214 bits (141), Expect = 1.435e-7
Identity = 48/144 (33.33%), Postives = 63/144 (43.75%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQDL--CLYQSCVLDGK--CIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            +C  G+ GE+C E D+  CL   C   G   CI++    +C C  G  G  C    + C+  PC+N G C      E G  C C P F G  CE     C  + C N  TC      + KC+C  GYTG  C    + P  + P
Sbjct: 1253 ICPPGFVGERC-EGDVNECLSNPCDPRGTQNCIQLVNDYRCECRQGFTGRRCDSVVDGCKGLPCRNGGTCAVASNTERGFICKCPPGFDGATCEYDARTCGNLRCQNGGTC-ISVLKSSKCVCSEGYTGATCQYPVVSPCASRP 1394          

HSP 6 Score: 53.9138 bits (128), Expect = 4.740e-6
Identity = 52/171 (30.41%), Postives = 73/171 (42.69%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQS--------------------------CVLDGKCIE-------------IDGKPQCMC-NGRIGPHCFPNYNPCR--SNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV--PCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +C  GW GE C+E  D C   +                          C LD  CI              ++GK  C C  G  GP C  + + C   +NPC++ GRC  N  G    +C+C   + G  CE  + E +  PC N+ATC  D+    +CIC+PGY G+ C+
Sbjct:  321 VCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCT-NTLGS--FQCNCPQGYAGPRCEIDVNECLSNPCQNDATC-LDQIGEFQCICMPGYEGLYCE 487          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|Q9R172|NOTC3_RAT (Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus OX=10116 GN=Notch3 PE=2 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 1.895e-13
Identity = 60/184 (32.61%), Postives = 78/184 (42.39%), Query Frame = 3
Query:  681 CDHNRYGEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEG-RCIPNKTGEV---GIRCHCNPNFFGVLCEQSLCEIVP--CHNNAT--CEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            C   R G  CE    P     C   G            C  G+ G+ C +  D C  Q C   G CI++     C C  G +G  C  N + C   P  + G RC+ N T      G RC+C P + G+ CE  + E  P  CH   T  C  D   + +CICLPG+TG  C Q  + P E+ P
Sbjct: 1074 CPEGRMGSHCEQEVDPCTAQPCQHGGTCRGYMGGYVCECPTGYSGDSCEDDVDECASQPCQNGGSCIDLVAHYLCSCPPGTLGVLCEINEDDCGPGPSLDSGLRCLHNGTCVDLVGGFRCNCPPGYTGLHCEADINECRPGTCHAAHTRDCLQDPGGHFRCICLPGFTGPRC-QTALFPCESQP 1256          

HSP 2 Score: 68.5514 bits (166), Expect = 1.842e-10
Identity = 43/130 (33.08%), Postives = 59/130 (45.38%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDLCLYQSCVLDGKC-IEIDGKPQCMCN-GRIGPHCFPNYNPCRSNP-CKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C  G++G  C+  D C    C     C +  DG+  C C  G  G +C  + + CR+   C++ G CI N  G     C C   + G+LCE  +  C   PC N  TC    D    C CLPG+ G  C+
Sbjct:  110 CLRGFRGPDCSLPDPCFSSPCAHGAPCSVGSDGRYACACPPGYQGRNCRSDIDECRAGASCRHGGTCI-NTPGS--FHCLCPLGYTGLLCENPIVPCAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCE 236          

HSP 3 Score: 68.1662 bits (165), Expect = 2.223e-10
Identity = 45/130 (34.62%), Postives = 57/130 (43.85%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDL--CLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C  G+ G  C E DL  C   SC   G C++      C+C  G  G HC    +PC S PC + G C P  +   G  C C   F G  C+  +  C   PC N   C     +   CIC P ++G LCD
Sbjct:  914 CPPGYGGFHC-ETDLLDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGTHCQYKVDPCFSRPCLHGGICNPTHS---GFECTCREGFTGNQCQNPVDWCSQAPCQNGGRCVQTGAY---CICPPEWSGPLCD 1036          

HSP 4 Score: 67.781 bits (164), Expect = 3.208e-10
Identity = 48/149 (32.21%), Postives = 66/149 (44.30%), Query Frame = 3
Query:  741 KCSRNGKK-LCNEGWKGEQCNEQDL-C----------LYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +C + G   +C   W G  C+   L C          L Q C   G+CI+ D    C+C  GR+G HC    +PC + PC++ G C     G V   C C   + G  CE  +  C   PC N  +C  D   +  C C PG  G+LC+
Sbjct: 1016 RCVQTGAYCICPPEWSGPLCDIPSLPCTEAAAHMGVRLEQLCQAGGQCIDKDHSHYCVCPEGRMGSHCEQEVDPCTAQPCQHGGTCRGYMGGYV---CECPTGYSGDSCEDDVDECASQPCQNGGSC-IDLVAHYLCSCPPGTLGVLCE 1160          

HSP 5 Score: 67.0106 bits (162), Expect = 4.475e-10
Identity = 43/132 (32.58%), Postives = 61/132 (46.21%), Query Frame = 3
Query:  765 LCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C  G+ G  C  + D C    CV  G C +      C C +G  G  C  + + C S PC+N  +C+    G     C C   F G LCE+++  C   PCH+    +    F+  C C PGYTGI C+ +
Sbjct:  458 ICMAGFTGTFCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDG---YECRCAEGFEGTLCERNVDDCSPDPCHHGRCVDGIASFS--CACAPGYTGIRCESQ 584          

HSP 6 Score: 66.2402 bits (160), Expect = 8.061e-10
Identity = 51/161 (31.68%), Postives = 68/161 (42.24%), Query Frame = 3
Query:  681 CDHNRYGEKCEIFCKPSNLYKCSRNGKKLCNEGWKGEQCNEQ-DLCLYQS-CVLDGKCIEIDGKPQCMCNG-RIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            C+H   G  CE    P  L  CS      C  GW+G +C +  D C   S C   G C  + G  +C+C+G   GP C  + + C  NPC N G C   + G     C C   F G  C + +  C   PC      ++   F   C C PGY G  C+ +
Sbjct:  782 CEH---GGHCE--SDPDQLTVCS------CPPGWQGPRCQQDVDECAGASPCGPHGTCTNLPGSFRCICHGGYTGPFCDQDIDDCDPNPCLNGGSC---QDGVGSFSCSCLSGFAGPRCARDVDECLSSPCGPGTCTDHVASFT--CTCPPGYGGFHCETD 926          

HSP 7 Score: 64.3142 bits (155), Expect = 3.806e-9
Identity = 49/152 (32.24%), Postives = 66/152 (43.42%), Query Frame = 3
Query:  747 SRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKC----IEIDGKPQCMC-NGRIGPHC-FPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEI---VPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            SR    LC  GW GE+C  +D C    C   G C    +    +  C C  G  GP C  P  +PC S+PC +   C     G     C C P + G  C   + E      C +  TC  +   +  C+C  GYTG+LC + PI+P   +P
Sbjct:   62 SREAACLCLPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGVARFSCRCLRGFRGPDCSLP--DPCFSSPCAHGAPCSVGSDGRYA--CACPPGYQGRNCRSDIDECRAGASCRHGGTC-INTPGSFHCLCPLGYTGLLC-ENPIVPCAPSP 207          

HSP 8 Score: 63.5438 bits (153), Expect = 5.878e-9
Identity = 41/130 (31.54%), Postives = 60/130 (46.15%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQS--CVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            C  G+ G  C++  D C   +  C   G+C+   G   C C  G  GP C  + N C S PC+N+  C+ ++ G+    C C   F G  CE  +  C+  PC N   C+ D+     C C  G++G  C
Sbjct:  381 CPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCL-DRIGQ--FTCICMAGFTGTFCEVDIDECQSSPCVNGGVCK-DRVNGFSCTCPSGFSGSTC 506          

HSP 9 Score: 62.003 bits (149), Expect = 1.720e-8
Identity = 41/116 (35.34%), Postives = 53/116 (45.69%), Query Frame = 3
Query:  813 CLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNP--CRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE-QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            C ++ C   G C +  G  QC+C+ G  GP C  +  P  C S PC+  G C  +    +G  C C P F G  CE  S C    C +   CE D D    C C PG+ G  C Q+
Sbjct:  701 CAHKPCS-HGVCHDAPGGFQCVCDPGWSGPRCSQSLAPDACESQPCQAGGTCTSDG---IGFHCTCAPGFQGHQCEVLSPCTPSLCEHGGHCESDPDQLTVCSCPPGWQGPRCQQD 812          

HSP 10 Score: 59.6918 bits (143), Expect = 7.705e-8
Identity = 48/165 (29.09%), Postives = 66/165 (40.00%), Query Frame = 3
Query:  699 GEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQ--SCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE-QSLCEIVPCHNNATCEYDKDFNRK-CICLPGYTGILCDQE 1148
            G+ CE+       ++C   G  +         C   W G+ C E  D C  Q  +C   G C  + G   C+C NG  G  C  N + C +  C +   C           C C     G+LC     C   PCH +A C+ +    R  C C PG+TG  CDQ+
Sbjct:  232 GQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATC---HDRVASFYCACPMGKTGLLCHLDDACVSNPCHEDAICDTNPVSGRAICTCPPGFTGGACDQD 393          

HSP 11 Score: 59.3066 bits (142), Expect = 1.056e-7
Identity = 40/134 (29.85%), Postives = 61/134 (45.52%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ---DLCLYQSCVLDGKCIEIDGKPQCMCNGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV---PCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C+ GW G +C++    D C  Q C   G C        C C      H     +PC  + C++ G C  +   ++ + C C P + G  C+Q + E     PC  + TC  +   + +CIC  GYTG  CDQ+
Sbjct:  721 VCDPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFHCTCAPGFQGHQCEVLSPCTPSLCEHGGHC-ESDPDQLTV-CSCPPGWQGPRCQQDVDECAGASPCGPHGTCT-NLPGSFRCICHGGYTGPFCDQD 851          

HSP 12 Score: 58.151 bits (139), Expect = 2.582e-7
Identity = 43/144 (29.86%), Postives = 59/144 (40.97%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHNNAT---------CE-----YDKDFNRKCICLPGYTGILCDQE 1148
            LC  G+ G  C  + D C  + C+  G C       +C C  G  G  C    + C   PC+N GRC+     + G  C C P + G LC+      +PC   A          C+      DKD +  C+C  G  G  C+QE
Sbjct:  951 LCRPGYTGTHCQYKVDPCFSRPCLHGGICNPTHSGFECTCREGFTGNQCQNPVDWCSQAPCQNGGRCV-----QTGAYCICPPEWSGPLCD---IPSLPCTEAAAHMGVRLEQLCQAGGQCIDKDHSHYCVCPEGRMGSHCEQE 1086          

HSP 13 Score: 57.3806 bits (137), Expect = 4.231e-7
Identity = 52/173 (30.06%), Postives = 69/173 (39.88%), Query Frame = 3
Query:  672 SAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKL----------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            S  C     G  C++         C RNG K           C EG++G  C    D C    C   G+C++      C C  G  G  C    + CRS PC+  G+C+      +   C C P   GV CE ++  C   PC     C  D      C+C PG+TG LC+ E
Sbjct:  494 SCTCPSGFSGSTCQLDVDECASTPC-RNGAKCVDQPDGYECRCAEGFEGTLCERNVDDCSPDPC-HHGRCVDGIASFSCACAPGYTGIRCESQVDECRSQPCRYGGKCLDLVDKYL---CRCPPGTTGVNCEVNIDDCASNPC-TFGVCR-DGINRYDCVCQPGFTGPLCNVE 659          

HSP 14 Score: 57.3806 bits (137), Expect = 5.102e-7
Identity = 52/173 (30.06%), Postives = 65/173 (37.57%), Query Frame = 3
Query:  666 SMSAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLC--EQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            S S  C     G +CE          C   GK L         C  G  G  C    D C    C   G C +   +  C+C  G  GP C    N C S+PC   G C+    GE G  C C P     LC      C   PC ++  C +D     +C+C PG++G  C Q
Sbjct:  567 SFSCACAPGYTGIRCESQVDECRSQPCRYGGKCLDLVDKYLCRCPPGTTGVNCEVNIDDCASNPCTF-GVCRDGINRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCV---DGENGFHCLCPPGSLPPLCLPANHPCAHKPC-SHGVC-HDAPGGFQCVCDPGWSGPRCSQ 733          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|P21783|NOTC1_XENLA (Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3)

HSP 1 Score: 77.411 bits (189), Expect = 3.522e-13
Identity = 60/184 (32.61%), Postives = 81/184 (44.02%), Query Frame = 3
Query:  693 RYGEKCEIFCKPSNLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQ 1235
            R G  CE+       YKC       C  GW G+ C + D C    C   GKC+  + +  C C  G  G  C  + N C  NPCKN G+CI N+ G    RC C   F G  C++    C   PC N  TC    D +  C CLPG++G  C++     ++  P+   R G +    +   N Q
Sbjct:  112 RNGGTCELL-NSVTEYKCR------CPPGWTGDSCQQADPCASNPCANGGKCLPFEIQYICKCPPGFHGATCKQDINECSQNPCKNGGQCI-NEFGSY--RCTCQNRFTGRNCDEPYVPCNPSPCLNGGTCRQTDDTSYDCTCLPGFSGQNCEEN----IDDCPSNNCRNGGTCVDGVNTYNCQ 281          

HSP 2 Score: 72.7886 bits (177), Expect = 7.579e-12
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 3
Query:  732 NLYKCSRNGKKLCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNR-KCICLPGYTGILCD 1142
            N YKC       C  GW G  C+   + C    C+  G C ++ G   C C  G  GP+C  N N C SNPC N G CI +     G +C+C   + G +CE  L  C   PC N   C+  +DF    C C PG+ G  C+
Sbjct:  734 NGYKCD------CEAGWSGSNCDINNNECESNPCMNGGTCKDMTGAYICTCKAGFSGPNCQTNINECSSNPCLNHGTCIDDV---AGYKCNCMLPYTGAICEAVLAPCAGSPCKNGGRCKESEDFETFSCECPPGWQGQTCE 866          

HSP 3 Score: 63.5438 bits (153), Expect = 6.354e-9
Identity = 48/132 (36.36%), Postives = 66/132 (50.00%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVP--CHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C  G++G  C    D C    C+ +GKCI+   + +C C  G  G  C  +++ C S PCKN  +C+    G     C C   F G  CEQ + E +P  CH   TC+ D      C+C PGYTG LCD +
Sbjct:  476 ICMPGYEGLYCETNIDECASNPCLHNGKCIDKINEFRCDCPTGFSGNLCQHDFDECTSTPCKNGAKCL---DGPNSYTCQCTEGFTGRHCEQDINECIPDPCHY-GTCK-DGIATFTCLCRPGYTGRLCDND 602          

HSP 4 Score: 63.1586 bits (152), Expect = 7.863e-9
Identity = 59/179 (32.96%), Postives = 83/179 (46.37%), Query Frame = 3
Query:  660 FISMSAQCDHNRYGEKCEI--FC------KPSNLYKCSRNGKKLCN--EGWKGEQCN-EQDLCLYQS--CVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
              S   +C H R G  C +   C      + SN      NGK +C    G+ G  CN + D C   +  C   G+C    G  QC C  G  GP C  + N C SNPC+N+  C+ ++ GE   +C C P + G+ CE ++  C   PC +N  C  DK    +C C  G++G LC  +
Sbjct:  353 VASFYCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDSTCL-DQIGE--FQCICMPGYEGLYCETNIDECASNPCLHNGKC-IDKINEFRCDCPTGFSGNLCQHD 527          

HSP 5 Score: 61.6178 bits (148), Expect = 2.186e-8
Identity = 54/161 (33.54%), Postives = 68/161 (42.24%), Query Frame = 3
Query:  741 KCSRNGKKL---------CNEGWKGEQCNEQDL--CLYQSCVLDGK--CIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            KC  NGK +         C  G+ GE+C E D+  CL   C   G   CI++    +C C  G  G  C    + C+  PC+N G C      E G  C C P F G  CE     C  + C N  TC      + KC+C  GYTG  C    I P  + P
Sbjct: 1236 KCFNNGKCIDRVGGYNCICPPGFVGERC-EGDVNECLSNPCDSRGTQNCIQLVNDYRCECRQGFTGRRCESVVDGCKGMPCRNGGTCAVASNTERGFICKCPPGFDGATCEYDSRTCSNLRCQNGGTC-ISVLTSSKCVCSEGYTGATCQYPVISPCASHP 1394          

HSP 6 Score: 53.9138 bits (128), Expect = 6.015e-6
Identity = 43/128 (33.59%), Postives = 54/128 (42.19%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            C  G++G +C E  + C    C     C +      C C  G  G HC  N   C  + C N G CI    G     C C P F G  C+  +  C+  PC N  TC+ D     KC C  GYTG+ C
Sbjct:  932 CPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQPGFSGIHCESNTPDCTESSCFNGGTCI---DGINTFTCQCPPGFTGSYCQHDINECDSKPCLNGGTCQ-DSYGTYKCTCPQGYTGLNC 1055          

HSP 7 Score: 53.1434 bits (126), Expect = 8.032e-6
Identity = 51/171 (29.82%), Postives = 73/171 (42.69%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQS--------------------------CVLDGKCIE-------------IDGKPQCMC-NGRIGPHCFPNYNPCR--SNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV--PCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +C  GW GE C+E  D C   +                          C LD  CI              ++GK  C C  G  GP C  + + C   +NPC++ GRC  N  G    +C+C   + G  CE  + E +  PC N++TC  D+    +CIC+PGY G+ C+
Sbjct:  321 VCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFYCECPHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCT-NTLGS--FQCNCPQGYAGPRCEIDVNECLSNPCQNDSTC-LDQIGEFQCICMPGYEGLYCE 487          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|Q90Y57|JAG1A_DANRE (Protein jagged-1a OS=Danio rerio OX=7955 GN=jag1a PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 5.224e-13
Identity = 80/333 (24.02%), Postives = 140/333 (42.04%), Query Frame = 3
Query:  198 ERVGYLYFKFLCYENFEHLDRNGAECD--------SVPSKNCDPIFTICINHQYISGIDKDNCQIYYTETSSYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALFGYQFTQSPSANYSNPIYDNITMYRQDRSIRN--PKVKMFISMSAQCDHNRYGEKCEIFCKPSN----LYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMCNGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL---CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            E  G+   + L  +N     ++GA CD        S  +  CD  F +C+  +Y S +       Y + ++      T   KP D     +++V+      P+ + + +  +D +  ++ S  ++ G    ++  +   NP        RQ + +++  P  +    +   CD + +G  C  FC+P +     Y C  NG K C EGW G +CN   +C  Q C ++    ++ G  +C+  G  G +C    + C  +P    G CI         +C C+ N+ G LC++ L     + PC N  TC         C C  GY+G  C++
Sbjct:   27 EASGHFEMQVLSMQNVNGELQSGACCDGARDPAERSCAADQCDTFFRVCLK-EYQSRVSSGGPCSYGSGSTPVIGGNTFSVKPLDQTNDKTRIVLPFSFAWPRSYTLIVEALDFN--NDSSTGSINGQVIEKAVQSGMINP-------NRQWQVLKHNGPVAQFQYQIRVTCDEHYFGFGCNKFCRPRDDFFGHYTCDHNGNKTCLEGWAGPECNTA-IC-KQGCSIEHGSCKVPGNCRCL-YGWQGEYC----DQCIPHPGCVHGTCIEP------WQCLCDTNWGGQLCDKDLNTCGTLQPCLNGGTCSNTGPDKYHCACPDGYSGQNCER 336          

HSP 2 Score: 63.1586 bits (152), Expect = 6.141e-9
Identity = 56/174 (32.18%), Postives = 74/174 (42.53%), Query Frame = 3
Query:  648 KVKMFISMSAQCDHNRYGEKCEIFCKPSNLYKCSRNG---KKLCNEGWKGEQCN--EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQ 1145
            K K   S  +QCD +            +N   CS  G   K LC+ GW+G  CN  +   CL   C     C+       C+C  G  GP C  N N C   PC N G C+    G+   RC C   F G  C  ++  C+  PC   +TC  D+    +C+C PG TG  C +
Sbjct:  701 KGKTCHSRESQCDEDTC----------NNGGTCSDEGDSFKCLCSPGWEGATCNIAKNSSCLPNPCENGATCVVTGDGFTCVCKEGWEGPTCSQNSNDCNPQPCYNSGTCV---DGDNWYRCECASGFAGPDCRININECQSSPCAFGSTC-VDEINGYRCLCPPGRTGPRCQE 860          

HSP 3 Score: 59.6918 bits (143), Expect = 7.912e-8
Identity = 43/129 (33.33%), Postives = 66/129 (51.16%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLC--EQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C +G+ G  C+E  + C    C+  G CI+     QC+C +G  GP+C  N + CR+NPC++ G C   +       C C   + G  C   +S C+   C+N  TC  + D + KC+C PG+ G  C+
Sbjct:  620 CQDGFTGTYCHENINDCESSPCLSGGTCIDKINAYQCICADGWEGPNCETNIDDCRTNPCRDRGVC---RDLVNDFYCECENGWKGKTCHSRESQCDEDTCNNGGTCSDEGD-SFKCLCSPGWEGATCN 744          

HSP 4 Score: 56.6102 bits (135), Expect = 6.252e-7
Identity = 44/129 (34.11%), Postives = 61/129 (47.29%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQD-LCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLC--EQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C +G+ G+ C   D  CL + C+  G C+E     +C C  G  GP C  N + C  NPC + G C+       G +C C   + G  C  + + CE  PC N  +C  +      C CLPG+TG  CD
Sbjct:  325 CPDGYSGQNCERADNACLSEPCLNGGLCVESSLGFECQCAAGWTGPSCNINEDDCSPNPCNHSGVCVDLVD---GFKCICPVQWTGKTCLIDANECEESPCVNAHSCR-NLIGGYFCECLPGWTGQNCD 449          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|Q61982|NOTC3_MOUSE (Neurogenic locus notch homolog protein 3 OS=Mus musculus OX=10090 GN=Notch3 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.596e-12
Identity = 45/130 (34.62%), Postives = 63/130 (48.46%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDLCLYQSCVLDGKC-IEIDGKPQCMCN-GRIGPHCFPNYNPCRS-NPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C  G++G  C++ D C+ + CV    C +  DG+  C C  G  G  C  + + CRS   C++ G C+ N  G    RC C   + G+LCE  +  C   PC N  TC    D    C CLPG+ G  C+
Sbjct:  109 CLRGFQGPDCSQPDPCVSRPCVHGAPCSVGPDGRFACACPPGYQGQSCQSDIDECRSGTTCRHGGTCL-NTPGS--FRCQCPLGYTGLLCENPVVPCAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCE 235          

HSP 2 Score: 71.633 bits (174), Expect = 1.672e-11
Identity = 57/184 (30.98%), Postives = 78/184 (42.39%), Query Frame = 3
Query:  681 CDHNRYGEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEG-RCIPNKTGE---VGIRCHCNPNFFGVLCEQSLCEIVP--CHNNAT--CEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            C   R G  CE    P     C   G            C  G+ G+ C +  D C  Q C   G CI++  +  C C  G +G  C  N + C   P  + G +C+ N T      G RC+C P + G+ CE  + E  P  CH   T  C  D   + +C+C PG+TG  C Q  + P E+ P
Sbjct: 1073 CPEGRTGSHCEHEVDPCTAQPCQHGGTCRGYMGGYVCECPAGYAGDSCEDNIDECASQPCQNGGSCIDLVARYLCSCPPGTLGVLCEINEDDCDLGPSLDSGVQCLHNGTCVDLVGGFRCNCPPGYTGLHCEADINECRPGACHAAHTRDCLQDPGGHFRCVCHPGFTGPRC-QIALSPCESQP 1255          

HSP 3 Score: 70.4774 bits (171), Expect = 3.797e-11
Identity = 50/149 (33.56%), Postives = 66/149 (44.30%), Query Frame = 3
Query:  741 KCSRNGKK-LCNEGWKGEQCNEQDL-C----------LYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +C + G   +C  GW G  C+ Q L C          L Q C   GKCI+      C+C  GR G HC    +PC + PC++ G C     G V   C C   + G  CE ++  C   PC N  +C  D      C C PG  G+LC+
Sbjct: 1015 RCVQTGAYCICPPGWSGRLCDIQSLPCTEAAAQMGVRLEQLCQEGGKCIDKGRSHYCVCPEGRTGSHCEHEVDPCTAQPCQHGGTCRGYMGGYV---CECPAGYAGDSCEDNIDECASQPCQNGGSC-IDLVARYLCSCPPGTLGVLCE 1159          

HSP 4 Score: 69.707 bits (169), Expect = 7.021e-11
Identity = 48/146 (32.88%), Postives = 61/146 (41.78%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDL--CLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPR 1190
            C  G+ G  C E DL  C   SC   G C++      C+C  G  G HC    +PC S PC + G C P      G  C C   F G  C+  +  C   PC N   C     +   CIC PG++G LCD + +   E       R
Sbjct:  913 CPPGYGGFHC-EIDLPDCSPSSCFNGGTCVDGVSSFSCLCRPGYTGTHCQYEADPCFSRPCLHGGICNPTHP---GFECTCREGFTGSQCQNPVDWCSQAPCQNGGRCVQTGAY---CICPPGWSGRLCDIQSLPCTEAAAQMGVR 1051          

HSP 5 Score: 67.781 bits (164), Expect = 2.705e-10
Identity = 43/132 (32.58%), Postives = 61/132 (46.21%), Query Frame = 3
Query:  765 LCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C  G+ G  C  + D C    CV  G C +      C C +G  G  C  + + C S PC+N  +C+    G     C C   F G LCE+++  C   PCH+    +    F+  C C PGYTGI C+ +
Sbjct:  457 ICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFSGSMCQLDVDECASTPCRNGAKCVDQPDG---YECRCAEGFEGTLCERNVDDCSPDPCHHGRCVDGIASFS--CACAPGYTGIRCESQ 583          

HSP 6 Score: 64.3142 bits (155), Expect = 3.709e-9
Identity = 41/130 (31.54%), Postives = 61/130 (46.92%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQS--CVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            C  G+ G  C++  D C   +  C   G+C+   G   C C  G  GP C  + N C S PC+N+  C+ ++ G+    C C   F G  CE  +  C+  PC N   C+ D+     C C  G++G +C
Sbjct:  380 CPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCL-DRIGQ--FTCICMAGFTGTYCEVDIDECQSSPCVNGGVCK-DRVNGFSCTCPSGFSGSMC 505          

HSP 7 Score: 63.929 bits (154), Expect = 3.937e-9
Identity = 45/136 (33.09%), Postives = 61/136 (44.85%), Query Frame = 3
Query:  753 NGKKLCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            N + +C+ G+ G  C++  D C    C+  G C +  G   C C +G  GP C  + + C S+PC   G C  +        C C P + G  CE  L  C    C N  TC  D   +  C+C PGYTG  C  E
Sbjct:  833 NFRCICHRGYTGPFCDQDIDDCDPNPCLHGGSCQDGVGSFSCSCLDGFAGPRCARDVDECLSSPC-GPGTCTDHVAS---FTCACPPGYGGFHCEIDLPDCSPSSCFNGGTC-VDGVSSFSCLCRPGYTGTHCQYE 963          

HSP 8 Score: 63.5438 bits (153), Expect = 5.979e-9
Identity = 51/174 (29.31%), Postives = 72/174 (41.38%), Query Frame = 3
Query:  663 ISMSAQCDHNRYGEKCEIF--CKPS---NLYKCSRNGKKL----CNEGWKGEQCNEQ-DLCLYQS-CVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            I     C     G +CE+   C PS   +   C  +  +L    C  GW+G +C +  D C   S C   G C  + G  +C+C+ G  GP C  + + C  NPC + G C   + G     C C   F G  C + +  C   PC      ++   F   C C PGY G  C+
Sbjct:  755 IGFRCTCAPGFQGHQCEVLSPCTPSLCEHGGHCESDPDRLTVCSCPPGWQGPRCQQDVDECAGASPCGPHGTCTNLPGNFRCICHRGYTGPFCDQDIDDCDPNPCLHGGSC---QDGVGSFSCSCLDGFAGPRCARDVDECLSSPCGPGTCTDHVASFT--CACPPGYGGFHCE 923          

HSP 9 Score: 62.7734 bits (151), Expect = 8.700e-9
Identity = 45/147 (30.61%), Postives = 64/147 (43.54%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQDLCLYQSCVLDGKC----IEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHNNATCEY-----DKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            LC  GW GE+C  +D C    C   G C    +    +  C C  G  GP C    +PC S PC +   C     G     C C P + G  C+  + E   C +  TC +     +   + +C C  GYTG+LC + P++P   +P
Sbjct:   67 LCLPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCLRGFQGPDC-SQPDPCVSRPCVHGAPCSVGPDGRFA--CACPPGYQGQSCQSDIDE---CRSGTTCRHGGTCLNTPGSFRCQCPLGYTGLLC-ENPVVPCAPSP 206          

HSP 10 Score: 62.003 bits (149), Expect = 1.580e-8
Identity = 41/116 (35.34%), Postives = 53/116 (45.69%), Query Frame = 3
Query:  813 CLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNP--CRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE-QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            C ++ C   G C +  G  +C+C  G  GP C  +  P  C S PC+  G C  +    +G RC C P F G  CE  S C    C +   CE D D    C C PG+ G  C Q+
Sbjct:  700 CAHKPCS-HGVCHDAPGGFRCVCEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDG---IGFRCTCAPGFQGHQCEVLSPCTPSLCEHGGHCESDPDRLTVCSCPPGWQGPRCQQD 811          

HSP 11 Score: 60.8474 bits (146), Expect = 3.865e-8
Identity = 41/134 (30.60%), Postives = 58/134 (43.28%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ---DLCLYQSCVLDGKCIEIDGKPQCMCNGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV---PCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +C  GW G +C++    D C  Q C   G C       +C C      H     +PC  + C++ G C      +    C C P + G  C+Q + E     PC  + TC  +   N +CIC  GYTG  CDQ+
Sbjct:  720 VCEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFRCTCAPGFQGHQCEVLSPCTPSLCEHGGHC--ESDPDRLTVCSCPPGWQGPRCQQDVDECAGASPCGPHGTCT-NLPGNFRCICHRGYTGPFCDQD 850          

HSP 12 Score: 59.6918 bits (143), Expect = 7.837e-8
Identity = 48/165 (29.09%), Postives = 66/165 (40.00%), Query Frame = 3
Query:  699 GEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQ--SCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE-QSLCEIVPCHNNATCEYDKDFNRK-CICLPGYTGILCDQE 1148
            G+ CE+       ++C   G  +         C   W G+ C E  D C  Q  +C   G C  + G   C+C NG  G  C  N + C +  C +   C           C C     G+LC     C   PCH +A C+ +    R  C C PG+TG  CDQ+
Sbjct:  231 GQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATC---HDRVASFYCACPMGKTGLLCHLDDACVSNPCHEDAICDTNPVSGRAICTCPPGFTGGACDQD 392          

HSP 13 Score: 57.7658 bits (138), Expect = 3.061e-7
Identity = 56/208 (26.92%), Postives = 67/208 (32.21%), Query Frame = 3
Query:  666 SMSAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTG----------------------------------EVGIRCHCNPNFFGVLCEQSL----CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            S S  C     G +CE          C   GK L         C  G  G  C    D C    C   G C +   +  C+C  G  GP C    N C S+PC   G C+  + G                                    G RC C P + G  C QSL    CE  PC    TC  D     +C C PG+ G  C+
Sbjct:  566 SFSCACAPGYTGIRCESQVDECRSQPCRYGGKCLDLVDKYLCRCPPGTTGVNCEVNIDDCASNPCTF-GVCRDGINRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENGFHCLCPPGSLPPLCLPANHPCAHKPCSHGVCHDAPGGFRCVCEPGWSGPRCSQSLAPDACESQPCQAGGTCTSD-GIGFRCTCAPGFQGHQCE 771          

HSP 14 Score: 57.3806 bits (137), Expect = 5.146e-7
Identity = 52/173 (30.06%), Postives = 69/173 (39.88%), Query Frame = 3
Query:  672 SAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKL----------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            S  C     G  C++         C RNG K           C EG++G  C    D C    C   G+C++      C C  G  G  C    + CRS PC+  G+C+      +   C C P   GV CE ++  C   PC     C  D      C+C PG+TG LC+ E
Sbjct:  493 SCTCPSGFSGSMCQLDVDECASTPC-RNGAKCVDQPDGYECRCAEGFEGTLCERNVDDCSPDPC-HHGRCVDGIASFSCACAPGYTGIRCESQVDECRSQPCRYGGKCLDLVDKYL---CRCPPGTTGVNCEVNIDDCASNPC-TFGVCR-DGINRYDCVCQPGFTGPLCNVE 658          

HSP 15 Score: 54.299 bits (129), Expect = 4.545e-6
Identity = 33/98 (33.67%), Postives = 49/98 (50.00%), Query Frame = 3
Query:  861 GKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPN--KTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            G  +C+C+ G  GP C    +PC S PC++ G+C  +  + G +   CHC P F+G+ CE+    C  + C     C+      R C C PG +G  C
Sbjct: 1229 GHFRCVCHPGFTGPRCQIALSPCESQPCQHGGQCRHSLGRGGGLTFTCHCVPPFWGLRCERVARSCRELQCPVGIPCQQTARGPR-CACPPGLSGPSC 1325          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A095C150 (Delta-like protein OS=Schistosoma haematobium OX=6185 GN=MS3_03509 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.611e-34
Identity = 122/434 (28.11%), Postives = 192/434 (44.24%), Query Frame = 3
Query:  135 YVFITLLFIFYHIYI-DRGVSSERVGYLYFKFLC---YENFEHLDRNGAECDSVPSKNCDPIFTICINHQYISGIDKDNCQIYYTETSSYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIA-LFGYQFTQSPSANYSNPIYDNITMYRQDRSIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPS-NLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQ--CMCNGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLC--EQSLC----------------------EIVP-CHNNATC-EYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQLGSTQTILFFSFGILFCILGVVVSILLYRRKMR 1334
            Y  I LL+ F++I I    + S+   Y   +      Y N   L  NG  CD V  K CD  FT+C+ +      D D C +    T  +DN   +  + +D       + +     +P E+   + + + D + +   I  L    F+  P+ N++N     I M R++   +N  + + + M   C  + YG  C IFCKP  + Y CS +G  +C  G +G +C+++D C Y+ C     C+  D +    C+CNG+  P C+PNYNPC S PC+N G C           CHC   + G  C   +S C                      E+   C N  TC ++   F  +C+CLPG+ G+ C+    IPVE    TA      S+  L    I L S   +LF +  ++   +GV+    + +RK++
Sbjct:    5 YFLIILLYKFFYIGILSSQIHSDNQPYGGAQLKIEWDYNNPASLLENGQICDRVGGKECDVYFTLCLKNAASVTDDIDKCHLLQHTTRIFDNAGYLEFRESDG------IEIFVPQPVPNEYTFTLGIFEQDIFGSVEVIGTLVANHFSLLPTNNWTN-----IRMSRENDQYKN-TIYVNVRMRLSCVKDYYGNHCHIFCKPEPSRYTCSSDGSYICLPGLRGPKCDKEDSCFYEPCADHATCVNKDDESGRICLCNGQEKPECYPNYNPCDSKPCQNGGECQLAGHYNESYICHCTEQWTGHKCNERRSACLEEAAKVQRNNNLSTDHYNNSTEVTSVCLNGGTCFDHPIRFEVRCVCLPGWIGVRCE----IPVEI--ETA-----KSNWIL----ITLISVGVVLFIT--VVLLTIGVIWKCFIRKRKVQ 409          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A3Q0KLB5 (Delta-like protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 4.124e-34
Identity = 124/437 (28.38%), Postives = 193/437 (44.16%), Query Frame = 3
Query:  129 NQYVFITLLFIFYHIYI---DRGVSSERVGYLYFKF-LCYENFEHLDRNGAECDSVPSKNCDPIFTICINHQYISGIDKDNCQIYYTETSSYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIA-LFGYQFTQSPSANYSNPIYDNITMYRQDRSIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPS-NLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQ--CMCNGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLC--EQSLC----------------------EIVP-CHNNATC-EYDKDFNRKCICLPGYTGILCDQEPIIPVET-TPNTAPRRGNSSHGALADKNIQLGSTQTILFFSFGILFCILGVVVSILLYRRKMR 1334
            + Y  I LL   Y+I I        S+  G    K    Y+N   L  NG  CD V  K CD  FT+C+ +      D D C +    T  +DN   +  +  D+      + +     +P E+   + + + D + +   I  L    F+  P+ N++N     I M R++   +N  + + + M   C  + YG  C+IFCKP  + Y CS +G  +C  G +G +C+++D C Y+ C     C+  D +    C+CNG+  P C+PNYNPC S PC+N G+C           CHC   + G  C   +S C                      E+   C N  TC ++   F  +C+CLPG+ G  C+    IPVE  TPN        S+  L    I L S   ILF +  ++   +G++    + +RK++
Sbjct:    5 SSYCLIILLNKLYYIEILLNQVYSDSQPYGGAQLKIEWDYDNPASLLENGQICDRVGGKECDVYFTLCLKNAASVADDIDKCHLLQHTTRVFDNAGYLEFREGDS------IEIFVPQPVPNEYTFTLGIFEQDIFGSVEVIGTLVANHFSLIPTNNWTN-----IKMSRENDQYKN-IIYVNVRMRLSCVKDYYGNHCQIFCKPEPSRYTCSSDGSYICLPGLRGPKCDKEDSCYYEPCADHATCVNKDDETGRICLCNGQEKPECYPNYNPCDSKPCQNGGQCRLAGHYNESFICHCTEQWTGHKCNERRSACLEEAAKVQRHNNLSTDHYNNSTEVTSVCLNGGTCFDHPIRFEVRCVCLPGWIGARCE----IPVEVETPN--------SNWIL----ITLISVGGILFIT--VVLLTIGIIWKCFIRKRKVQ 411          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A183JWE3 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS7038 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.711e-30
Identity = 114/408 (27.94%), Postives = 178/408 (43.63%), Query Frame = 3
Query:  234 YENFEHLDRNGAECDSVPSKNCDPIFTICINHQYISGIDKDNCQIYYTETSSYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIA-LFGYQFTQSPSANYSNPIYDNITMYRQDRSIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPS-NLYKCSRNGKKLCNE-----------GWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQ--CMCNGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLC--EQSLC----------------------EIVP-CHNNATC-EYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQLGSTQTILFFSFGILFCILGVVVSILLYRRKMR 1334
            Y N   L  NG  CD V  K CD  FT+C+ +      D D C +    T  +DN   +  + +D       + +     +P E+   + + + D + +   I  L    F+  P+ N++N     I M R++   +N  + + + M   C  + YG  C IFCKP  + Y CS +G  +C             G +G +C+++D C Y+ C     C+  D +    C+CNG+  P C+PNYNPC S PC+N G C           CHC   + G  C   +S C                      E+   C N  TC ++   F  +C+CLPG+ G+ C+    IPVE    TA      S+  L    I L S   +LF +  ++F  +GV+    + +RK++
Sbjct:   72 YNNPASLLENGQICDRVGGKECDVYFTLCLKNAASVTDDIDKCHLLQHTTRIFDNAGYLEFRESDG------IEIFVPQPVPNEYTFALGIFEQDIFGSVEVIGTLVANHFSLLPTNNWTN-----IRMSRENDQYKN-TIYVNVRMRLSCVKDYYGNHCHIFCKPEPSRYTCSSDGSYICLPVNLQQVCFPILGLRGPKCDKEDSCFYEPCADHATCVNKDDESGRICLCNGQEKPECYPNYNPCDSKPCQNGGECQLAGHYNESYICHCPEQWTGHKCNERRSACLEEAAKVQRNNNLSTDHYNNSTEVTSVCLNGGTCFDHPIRFEVRCVCLPGWIGLRCE----IPVEI--ETA-----KSNWIL----ITLISVGVVLFIT--VVFLTIGVIWKCFIRKRKVQ 450          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A504Z334 (Delta-like protein OS=Fasciola gigantica OX=46835 GN=FGIG_03953 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.522e-29
Identity = 139/558 (24.91%), Postives = 227/558 (40.68%), Query Frame = 3
Query:  207 GYLYFKFLCYENFEHLDRNGAECDSVPSKNCDPIFTICINH--QYISGIDKDNCQIYYTETSSYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALF---GYQFTQSPSANYSNPIYDNITMYRQDRSIRNPKVKMFISMSAQCDHNRYGEKCEIFCKP-SNLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCI-EIDGKPQ-CMCNGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFG-------VLCEQSL-----------CEIVPCHNNATC-EYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQLGSTQTILFFSFGILFCILGVV-VSILLYR-RKMRKEWNNKNKF---------EISMKELES-KSNPRVLSNEYF-------------SKVRDECIYETVKDENTYAYLHDKNDEYLIPSRPNTPGFPNSQNNDESDYLEMSNNFEVNTLTNNRLYEKEDELPPLPTREIKRKLSLSK---FCMS*SG 1715
             YL  +++ Y N   L  +G  CD + + +CD  FT+C+ +  +  +  D + C ++ + T  YDN E +  +     G   ++ +   + +P  +  +I++ D D  H    I  F   G+  +       +N I  ++ M R+++   N ++++ + M+ +C  N YGE C   C P + +YKC   G ++C  G+ GE C+++D CLY+ C     C+ + DG  + C CNG  GP C+P Y+PC S PC++ G C           C C   + G       + C + L             I  C N   C EY      +C+C  G+TG  C++           T  R              Q G    IL    G +  IL VV ++I ++R R  R+      K            S   + S   +P +  N+ +             S VR++     V DE     L  KN+ Y      + P  P+ +               + T ++      E E PPLP R     L LS+    C + SG
Sbjct:   31 AYLLIEWV-YRNPGSLLEDGRICDRLGNPHCDVFFTLCLRNAAEKRTRRDAEQCLLHQSTTQYYDNVEYLEFRD----GNAVRVFIP--NPVPVLYTFEISISDIDLLHRTQPIGSFIAEGFYLS-------NNGIITSVPMRRKNQQYSNIRLELRVMMTLKCVDNFYGEHCTKECVPNTAVYKCDDEGNRVCMPGYFGELCDKEDSCLYEPCAEHATCVNKADGHGRICQCNGNEGPECYPGYDPCSSAPCQHGGECQRMGQYNESFDCICAGVWTGYRCTDRRLACAEELERLHLESNNTDGAISVCLNGGECLEYTDQLAFRCVCEEGWTGARCEES---------QTEAR--------------QTGMLSLILTTFIGAVLLILTVVLIAIFIWRYRTSRRRAKMLEKHGGIVYFHANSTSSGTMNSLMGSPGLFVNQIYGTGLEAQPVFVAGSNVRNKKNLHDVYDECDPLGLSMKNNVYGTAFGADVPSSPDGR-------------MTITTRSSLHSTNAEHEAPPLPERPKNLSLGLSRHSSICFTESG 538          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A4Z2DN50 (Delta-like protein OS=Schistosoma japonicum OX=6182 GN=EWB00_010805 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 3.060e-29
Identity = 109/398 (27.39%), Postives = 172/398 (43.22%), Query Frame = 3
Query:  234 YENFEHLDRNGAECDSVPSKNCDPIFTICINHQYISGIDKDNCQIYYTETSSYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIA-LFGYQFTQSPSANYSNPIYDNITMYRQDRSIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPS-NLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQ--CMCNGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQ--SLC-----------------------EIVP-CHNNATC-EYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQLGSTQTILFFSFGILFCILGVVVSILLYRRKMR 1334
            Y N + L  NG  CD V  K CD  FT+C+ +      D + C +    T  +DN   +  +  D       + +     +P E+   + + + D + +   I  L   +F   P+ N+++     I M+R++   +N ++ + + M   C    YG  C +FCKP  + Y CS +G  +C  G +G +C+++D C ++ C     CI  D +    C+CNG   P C+ +YNPC S PC+N G C           CHC   + G  C +  S C                       E+   C N  TC E+   F  +C+CLPG+ G  C+    IPVE            S+  L    I L     +LFF   ++   +GVV   +L +RK +
Sbjct:   47 YNNPDSLLENGQICDRVGGKECDVYFTLCLKNAASVTNDIEKCHLLQHTTRVFDNAGYLEFREGDG------IEIFVPQPVPNEYTFTLGIFEQDIFGSVEVIGTLVAEKFYLLPTNNWTD-----IRMFRENDQYKN-RIYVNVRMQLSCLKYYYGNHCHVFCKPEPSRYTCSSDGSYICLPGLRGPKCDKEDSCYFEPCADHALCINKDDETGRICICNGEERPECYLDYNPCDSTPCQNGGECQLTGHYNKSFVCHCTEQWTGHKCTERRSACLEEAEKIRRNNINVSDDYYSNSTEVTSVCLNGGTCFEHPIRFEVRCVCLPGWIGNRCE----IPVEL-------EEQKSNWIL----ITLIGVGVVLFFI--VVALTIGVVWKYVLKKRKSQ 415          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: DLK1 (delta like non-canonical Notch ligand 1 [Source:HGNC Symbol;Acc:HGNC:2907])

HSP 1 Score: 72.7886 bits (177), Expect = 2.519e-13
Identity = 51/141 (36.17%), Postives = 70/141 (49.65%), Query Frame = 3
Query:  744 CSRNGKKLCNEGWKGEQCNEQDL--CLYQSCVLDGKCIEI-DGKPQCMCN-GRIGPHCFPNYNPCRSN--PCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C +  + +C +GW G QC +QD+  C  + C  +  CIE  DG   C+C  G  G +C     PC++N  PC+N G C+ N        C C P F G  CE    +CE  PC N  TC  D      C+CL G++G  C+
Sbjct:   48 CEKAWQCICEQGWVGSQC-DQDVQQCSLKPCTGNSACIETGDGGYLCICPPGYTGKNCQLKKGPCQTNSSPCQNGGSCVDNSGFGGHSSCVCPPGFTGDFCEIQADICEPNPCLNGGTCR-DNGLGYTCVCLSGFSGPTCN 186          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: dll4 (delta like canonical Notch ligand 4 [Source:NCBI gene;Acc:103028783])

HSP 1 Score: 73.9442 bits (180), Expect = 2.877e-13
Identity = 87/350 (24.86%), Postives = 136/350 (38.86%), Query Frame = 3
Query:  144 ITLLFIFYHIYIDRGVSSERVGYLYFKFLCYENFEHLDRNGAECDSVPSKNCDPIFTICINHQYISGIDKDNCQIYYTETS------SYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALFGYQFTQSPSANYSNPIYDNITMYRQDRSIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPSN----LYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKP-QCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL---CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +T L       I + + S   G        ++NF+ L  NG  C       C   F +C+ + Y + +   +C I+ T  +      S+       + P   R P S         I + W+  ++  +SD       I+ F  Q      A +S  +                + ++  S    C+ N YG+ C   C P +     Y C+ +G+  C  GWKGE C E+ +CL      +G C     KP +C+C  G  G  C      C+ +P    G C          +C+C   + G+ C+Q L       PC N ATC      +  C C+PGYTG+ C+ E
Sbjct:    5 LTFLLSMLSSLITQMLGS---GVFELDLHEFKNFKGLLANGEPC----RPECRTFFRVCLKN-YQAVVSPGDC-IFGTAVTPVLGSNSFRAEGAPLSTPV--RLPFSFGWPGSFSLIIEAWYSPVDSNNSDL-----KISTFAIQRQLDVGAEWSQDVQSG------------QQTELRYSYRFICNENYYGDSCSKICAPRDDRFGHYTCNPDGQLSCLPGWKGEYC-EEPICLKGCSEANGNC----SKPGECVCREGWQGTFC----TECKKHPVCKHGTC------NQPWQCNCKEGWGGLFCDQDLNFCTHHKPCKNGATCMNTGQGSYTCTCMPGYTGVNCELE 311          

HSP 2 Score: 56.6102 bits (135), Expect = 6.800e-8
Identity = 48/134 (35.82%), Postives = 60/134 (44.78%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDLCL---YQSCVLDGKCIEI-DGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATC-EYDKDFNRKCICLPGYTGILCDQ 1145
            C EGW G  C +QDL     ++ C     C+    G   C C  G  G +C      C SNPC+N G C     G +   C C P F G  CE SL  C  +PC     C E D   +  C C  GYTG+ C++
Sbjct:  259 CKEGWGGLFC-DQDLNFCTHHKPCKNGATCMNTGQGSYTCTCMPGYTGVNCELEVRQCDSNPCRNRGHCTELDNGYM---CTCLPGFEGSHCEHSLLTCADMPCFQGGKCHEKDNGRSYSCDCPRGYTGLNCEK 388          

HSP 3 Score: 53.9138 bits (128), Expect = 4.709e-7
Identity = 43/145 (29.66%), Postives = 59/145 (40.69%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPR 1190
            C  G+ G  C ++ D C    C   G C+ + G   C C  G  G  C  N N C SNPC N G C    +  +   C C P + G  C    + C    C N  +C         C C  G+TG  C+   +  + + P T P+
Sbjct:  377 CPRGYTGLNCEKRVDKCTTLPCANGGACVVLGGVRMCSCRAGFTGQRCEININDCASNPCANGGTCHDRISDYI---CSCPPGYGGRNCNLLTTACPAQLCLNGGSCATIPGGPPACFCPSGFTGPRCEYFALT-LPSLPATEPK 517          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: dll4 (delta like canonical Notch ligand 4 [Source:NCBI gene;Acc:103028783])

HSP 1 Score: 73.559 bits (179), Expect = 4.032e-13
Identity = 82/320 (25.62%), Postives = 128/320 (40.00%), Query Frame = 3
Query:  234 YENFEHLDRNGAECDSVPSKNCDPIFTICINHQYISGIDKDNCQIYYTETS------SYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALFGYQFTQSPSANYSNPIYDNITMYRQDRSIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPSN----LYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKP-QCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL---CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            ++NF+ L  NG  C       C   F +C+ + Y + +   +C I+ T  +      S+       + P   R P S         I + W+  ++  +SD       I+ F  Q      A +S  +                + ++  S    C+ N YG+ C   C P +     Y C+ +G+  C  GWKGE C E+ +CL      +G C     KP +C+C  G  G  C      C+ +P    G C          +C+C   + G+ C+Q L       PC N ATC      +  C C+PGYTG+ C+ E
Sbjct:   16 FKNFKGLLANGEPC----RPECRTFFRVCLKN-YQAVVSPGDC-IFGTAVTPVLGSNSFRAEGAPLSTPV--RLPFSFGWPGSFSLIIEAWYSPVDSNNSDL-----KISTFAIQRQLDVGAEWSQDVQSG------------QQTELRYSYRFICNENYYGDSCSKICAPRDDRFGHYTCNPDGQLSCLPGWKGEYC-EEPICLKGCSEANGNC----SKPGECVCREGWQGTFC----TECKKHPVCKHGTC------NQPWQCNCKEGWGGLFCDQDLNFCTHHKPCKNGATCMNTGQGSYTCTCMPGYTGVNCELE 295          

HSP 2 Score: 56.6102 bits (135), Expect = 6.815e-8
Identity = 48/135 (35.56%), Postives = 60/135 (44.44%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDLCL---YQSCVLDGKCIEI-DGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATC-EYDKDFNRKCICLPGYTGILCDQE 1148
            C EGW G  C +QDL     ++ C     C+    G   C C  G  G +C      C SNPC+N G C     G +   C C P F G  CE SL  C  +PC     C E D   +  C C  GYTG+ C++ 
Sbjct:  243 CKEGWGGLFC-DQDLNFCTHHKPCKNGATCMNTGQGSYTCTCMPGYTGVNCELEVRQCDSNPCRNRGHCTELDNGYM---CTCLPGFEGSHCEHSLLTCADMPCFQGGKCHEKDNGRSYSCDCPRGYTGLNCEKR 373          

HSP 3 Score: 53.9138 bits (128), Expect = 4.675e-7
Identity = 43/145 (29.66%), Postives = 59/145 (40.69%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPR 1190
            C  G+ G  C ++ D C    C   G C+ + G   C C  G  G  C  N N C SNPC N G C    +  +   C C P + G  C    + C    C N  +C         C C  G+TG  C+   +  + + P T P+
Sbjct:  361 CPRGYTGLNCEKRVDKCTTLPCANGGACVVLGGVRMCSCRAGFTGQRCEININDCASNPCANGGTCHDRISDYI---CSCPPGYGGRNCNLLTTACPAQLCLNGGSCATIPGGPPACFCPSGFTGPRCEYFALT-LPSLPATEPK 501          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: fat1b (protocadherin Fat 1 [Source:NCBI gene;Acc:103029763])

HSP 1 Score: 73.1738 bits (178), Expect = 6.554e-13
Identity = 47/148 (31.76%), Postives = 67/148 (45.27%), Query Frame = 3
Query:  723 KPSNLYKCSRNGKKLCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCNGR-IGPHCFPNYNP-CRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATC-EYDKDFNRKCICLPGYTGILCDQE 1148
            +P+  Y C+      C+  + G  C      C+   C+  G CI+ + +  C C G+  G  C     P C+ NPC+N G CI +  G     C C P F G  C+  +  C  +PC N   C      FN  C C PG++G LC+ E
Sbjct: 4094 RPNGDYHCT------CSGLFTGAHCELSISPCVSNPCLYGGTCIQNNERYYCRCRGQYTGQRC--ETGPYCKQNPCRNGGHCIDSLDGPA---CECEPGFRGERCQLDVDECLHLPCLNGGWCVNTFGSFN--CSCSPGFSGSLCEME 4228          

HSP 2 Score: 61.6178 bits (148), Expect = 2.523e-9
Identity = 38/112 (33.93%), Postives = 48/112 (42.86%), Query Frame = 3
Query:  813 CLYQSCVLDGKCIE-IDGKPQCMCNGRI-GPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQS-LCEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            C  + C+  G C +  +G   C C+G   G HC  + +PC SNPC   G CI N        C C   + G  CE    C+  PC N   C  D      C C PG+ G  C
Sbjct: 4080 CANKPCLNGGSCSQRPNGDYHCTCSGLFTGAHCELSISPCVSNPCLYGGTCIQNNE---RYYCRCRGQYTGQRCETGPYCKQNPCRNGGHC-IDSLDGPACECEPGFRGERC 4187          

HSP 3 Score: 55.8398 bits (133), Expect = 1.612e-7
Identity = 40/121 (33.06%), Postives = 52/121 (42.98%), Query Frame = 3
Query:  699 GEKCEIFCKP--SN--LY--KCSRNGKKL---CNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE 1031
            G  CE+   P  SN  LY   C +N ++    C   + G++C     C    C   G CI+    P C C  G  G  C  + + C   PC N G C+ N  G     C C+P F G LCE
Sbjct: 4109 GAHCELSISPCVSNPCLYGGTCIQNNERYYCRCRGQYTGQRCETGPYCKQNPCRNGGHCIDSLDGPACECEPGFRGERCQLDVDECLHLPCLNGGWCV-NTFGS--FNCSCSPGFSGSLCE 4226          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: fat1b (protocadherin Fat 1 [Source:NCBI gene;Acc:103029763])

HSP 1 Score: 73.1738 bits (178), Expect = 6.554e-13
Identity = 47/148 (31.76%), Postives = 67/148 (45.27%), Query Frame = 3
Query:  723 KPSNLYKCSRNGKKLCNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCNGR-IGPHCFPNYNP-CRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATC-EYDKDFNRKCICLPGYTGILCDQE 1148
            +P+  Y C+      C+  + G  C      C+   C+  G CI+ + +  C C G+  G  C     P C+ NPC+N G CI +  G     C C P F G  C+  +  C  +PC N   C      FN  C C PG++G LC+ E
Sbjct: 4094 RPNGDYHCT------CSGLFTGAHCELSISPCVSNPCLYGGTCIQNNERYYCRCRGQYTGQRC--ETGPYCKQNPCRNGGHCIDSLDGPA---CECEPGFRGERCQLDVDECLHLPCLNGGWCVNTFGSFN--CSCSPGFSGSLCEME 4228          

HSP 2 Score: 61.6178 bits (148), Expect = 2.523e-9
Identity = 38/112 (33.93%), Postives = 48/112 (42.86%), Query Frame = 3
Query:  813 CLYQSCVLDGKCIE-IDGKPQCMCNGRI-GPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQS-LCEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            C  + C+  G C +  +G   C C+G   G HC  + +PC SNPC   G CI N        C C   + G  CE    C+  PC N   C  D      C C PG+ G  C
Sbjct: 4080 CANKPCLNGGSCSQRPNGDYHCTCSGLFTGAHCELSISPCVSNPCLYGGTCIQNNE---RYYCRCRGQYTGQRCETGPYCKQNPCRNGGHC-IDSLDGPACECEPGFRGERC 4187          

HSP 3 Score: 55.8398 bits (133), Expect = 1.612e-7
Identity = 40/121 (33.06%), Postives = 52/121 (42.98%), Query Frame = 3
Query:  699 GEKCEIFCKP--SN--LY--KCSRNGKKL---CNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE 1031
            G  CE+   P  SN  LY   C +N ++    C   + G++C     C    C   G CI+    P C C  G  G  C  + + C   PC N G C+ N  G     C C+P F G LCE
Sbjct: 4109 GAHCELSISPCVSNPCLYGGTCIQNNERYYCRCRGQYTGQRCETGPYCKQNPCRNGGHCIDSLDGPACECEPGFRGERCQLDVDECLHLPCLNGGWCV-NTFGS--FNCSCSPGFSGSLCE 4226          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 8.453e-12
Identity = 41/129 (31.78%), Postives = 57/129 (44.19%), Query Frame = 3
Query:  768 CNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C  G+ G  C  + D CL   C   G C  + G   C C  G  G  C  + + C   PC+N G C  N  G  G  C C+  F G +C+ ++  C   PC+NN +C  +      C C  G +G  C+
Sbjct: 1519 CTAGYAGTWCEADMDECLSTPCRHGGSCQNLPGGFACRCLPGFSGTACETDVDECLEGPCQNGGLC-HNTQG--GFACDCSAGFSGKICDVTVDNCASSPCYNNGSC-VNTATGYSCRCPFGMSGARCE 1643          

HSP 2 Score: 56.9954 bits (136), Expect = 1.548e-8
Identity = 32/93 (34.41%), Postives = 43/93 (46.24%), Query Frame = 3
Query:  873 CMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV--PCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C C  G  G  C  + + C S PC++ G C  N  G  G  C C P F G  CE  + E +  PC N   C ++      C C  G++G +CD
Sbjct: 1517 CTCTAGYAGTWCEADMDECLSTPCRHGGSC-QNLPG--GFACRCLPGFSGTACETDVDECLEGPCQNGGLC-HNTQGGFACDCSAGFSGKICD 1605          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 1.021e-11
Identity = 41/129 (31.78%), Postives = 57/129 (44.19%), Query Frame = 3
Query:  768 CNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C  G+ G  C  + D CL   C   G C  + G   C C  G  G  C  + + C   PC+N G C  N  G  G  C C+  F G +C+ ++  C   PC+NN +C  +      C C  G +G  C+
Sbjct: 1519 CTAGYAGTWCEADMDECLSTPCRHGGSCQNLPGGFACRCLPGFSGTACETDVDECLEGPCQNGGLC-HNTQG--GFACDCSAGFSGKICDVTVDNCASSPCYNNGSC-VNTATGYSCRCPFGMSGARCE 1643          

HSP 2 Score: 56.6102 bits (135), Expect = 1.775e-8
Identity = 32/93 (34.41%), Postives = 43/93 (46.24%), Query Frame = 3
Query:  873 CMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV--PCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C C  G  G  C  + + C S PC++ G C  N  G  G  C C P F G  CE  + E +  PC N   C ++      C C  G++G +CD
Sbjct: 1517 CTCTAGYAGTWCEADMDECLSTPCRHGGSC-QNLPG--GFACRCLPGFSGTACETDVDECLEGPCQNGGLC-HNTQGGFACDCSAGFSGKICD 1605          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002014.1 (pep scaffold:Pmarinus_7.0:GL482490:2146:12219:-1 gene:ENSPMAG00000001825.1 transcript:ENSPMAT00000002014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 2.137e-10
Identity = 52/177 (29.38%), Postives = 68/177 (38.42%), Query Frame = 3
Query:  651 VKMFISMSAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            +    S +  C     G++CE          C   G+ +         C  G+ G  C+   D C    C   G+C+   G   C C  G  G  C  + N C S+PC N GRC   + G     C C P F G  CE  +  C   PC N   C  D      C C PG+TG  C+
Sbjct:   27 IDGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDVNECASSPCLNGGRC---RDGVAAFTCECAPGFTGTRCETDVNECASSPCLNGGRCR-DGVAAFTCECAPGFTGTRCE 199          

HSP 2 Score: 55.8398 bits (133), Expect = 3.390e-9
Identity = 41/131 (31.30%), Postives = 60/131 (45.80%), Query Frame = 3
Query:  768 CNEGWKGEQC-NEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            C +G+ G++C  + D C    C   G+C+   G   C C  G  G  C  + + C S+PC+N G+C+    G     C C   + G LC+  +  C   PC N   C  D      C C PG+TG  C+ +
Sbjct:   37 CAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQCV---NGAGSFTCSCLAGYTGTLCDSDVNECASSPCLNGGRCR-DGVAAFTCECAPGFTGTRCETD 163          

HSP 3 Score: 54.299 bits (129), Expect = 1.333e-8
Identity = 39/117 (33.33%), Postives = 53/117 (45.30%), Query Frame = 3
Query:  807 DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            D C    C   G+CI+      C C  G  G  C  + + C S+PC+N G+C+    G     C C   + G LC+  +  C   PC N   C  +   +  C CL GYTG LCD +
Sbjct:   13 DECSPNPCQNGGRCIDGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCV---NGAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQC-VNGAGSFTCSCLAGYTGTLCDSD 125          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002017.1 (pep scaffold:Pmarinus_7.0:GL482490:2146:11907:-1 gene:ENSPMAG00000001825.1 transcript:ENSPMAT00000002017.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 5.513e-9
Identity = 39/117 (33.33%), Postives = 53/117 (45.30%), Query Frame = 3
Query:  807 DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            D C    C   G+CI+      C C  G  G  C  + + C S+PC+N G+C+    G     C C   + G LC+  +  C   PC N   C  +   +  C CL GYTG LCD +
Sbjct:    1 DECSPNPCQNGGRCIDGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCV---NGAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQC-VNGAGSFTCSCLAGYTGTLCDSD 113          

HSP 2 Score: 48.521 bits (114), Expect = 1.414e-6
Identity = 30/79 (37.97%), Postives = 36/79 (45.57%), Query Frame = 3
Query:  912 NYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            + N C S+PC N GRC   + G     C C P F G  CE  +  C   PC N   C  D      C C PG+TG  C+
Sbjct:  153 DVNECASSPCLNGGRC---RDGVAAFTCECAPGFTGTRCETDVNECASSPCLNGGRCR-DGVAAFTCECAPGFTGTRCE 227          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002643.1 (pep scaffold:Pmarinus_7.0:GL478752:33855:40482:1 gene:ENSPMAG00000002413.1 transcript:ENSPMAT00000002643.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 6.252e-9
Identity = 46/131 (35.11%), Postives = 59/131 (45.04%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            C  G+ G+ C      C    C+ D  C++  G  +C C  G  G HC  + N C S PC + G C     G     C C   F G  C+     C   PCHN ATC  D D   +C+C  GYTG +C+ E
Sbjct:   24 CAPGYSGDNCEASVGGCASGPCLNDAVCVDEPGGYKCYCVPGFQGRHCEIDINECASEPCLHGGTCT---NGRDRYSCACPDGFAGERCQLDTNECASQPCHNGATC-VDLDGKFECVCPRGYTGAMCETE 150          

HSP 2 Score: 54.6842 bits (130), Expect = 2.418e-8
Identity = 44/132 (33.33%), Postives = 65/132 (49.24%), Query Frame = 3
Query:  768 CNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHC-NPNFFGVLCEQSLCEIV--PCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            C +G+ GE+C  + + C  Q C     C+++DGK +C+C  G  G  C    + C S PC+N G CI          C C    + G  CE  + E    PC +N+TC  +   N  CIC PG+ G  C+++
Sbjct:  100 CPDGFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECESGPCQNGGVCIDLVD---SYTCDCLETGYEGKDCELEILECASNPCRHNSTC-IEGILNFTCICWPGFAGDACEED 227          

HSP 3 Score: 51.2174 bits (121), Expect = 3.774e-7
Identity = 38/114 (33.33%), Postives = 50/114 (43.86%), Query Frame = 3
Query:  924 CRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD-------QEPIIPVETTPNTAPRRGNSSHGALADKNIQL 1238
            C S PC + G C+P   G  G  C C P + G  CE S+  C   PC N+A C  D+    KC C+PG+ G  C+        EP +   T  N   R   +     A +  QL
Sbjct:    1 CASGPCLHGGTCLPAADG--GFSCRCAPGYSGDNCEASVGGCASGPCLNDAVC-VDEPGGYKCYCVPGFQGRHCEIDINECASEPCLHGGTCTNGRDRYSCACPDGFAGERCQL 111          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO28379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6M6])

HSP 1 Score: 69.707 bits (169), Expect = 5.483e-13
Identity = 49/127 (38.58%), Postives = 67/127 (52.76%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQ-SLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILC 1139
            +C + ++G+ C E++ C    C+  G C+EI G  +C C  G +G  C    + C  NPCKN G C  + T E G  C C   F G  CE  + C+  PC N ATC+  KD   +C+C P Y G LC
Sbjct:   85 ICPKDYRGKDCQERNYCSSMPCLNGGSCVEIPGAFKCGCPFGFLGTVC-EERDACHPNPCKNGGTCTRSDT-ESGFVCVCKEGFTGEHCEGFNRCDPNPCKNGATCQQIKDDKYECLCPPPYKGTLC 209          

HSP 2 Score: 54.6842 bits (130), Expect = 5.383e-8
Identity = 46/131 (35.11%), Postives = 59/131 (45.04%), Query Frame = 3
Query:  759 KKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQ--CMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            K  C  G+ G  C E+D C    C   G C   D +    C+C  G  G HC   +N C  NPCKN   C   K  +    C C P + G LC   +C   PCH+   CE +   + KC+C P Y G  C+
Sbjct:  120 KCGCPFGFLGTVCEERDACHPNPCKNGGTCTRSDTESGFVCVCKEGFTGEHC-EGFNRCDPNPCKNGATCQQIKDDKY--ECLCPPPYKGTLCAVHVCHPNPCHHGGRCEVESG-HFKCVCPPLYKGYQCE 246          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO27617 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8R8])

HSP 1 Score: 63.5438 bits (153), Expect = 2.703e-12
Identity = 47/119 (39.50%), Postives = 58/119 (48.74%), Query Frame = 3
Query:  795 CNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C + D C    C   G C++      C+C  G  G  C  N N C SNPC+N G C+    G  G  C C   + G  CE  +  C+  PC NNATC  ++D    CIC PGYTG  CD
Sbjct:    2 CVDPDDCHPNPCQYGGTCVDGLDDFTCLCVPGTTGKICHININECNSNPCRNNGTCV---DGINGFTCRCLEGYIGAHCEVDVNYCDSEPCMNNATCVDEQD-GFTCICAPGYTGPTCD 116          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO35413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL0])

HSP 1 Score: 67.781 bits (164), Expect = 1.047e-11
Identity = 36/96 (37.50%), Postives = 45/96 (46.88%), Query Frame = 3
Query:  864 KPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            K  C C  G  G  C  + N C  NPC+NEG C  N       +C C P + G LCE  +  C   PC + + C+ +      C C PGYTG  CD
Sbjct: 1391 KITCSCKPGFTGSQCEESVNDCNPNPCRNEGTCTDNNG---SFKCSCIPGYTGRLCESDIDECLTNPCKHASACD-NTPGGYTCTCKPGYTGQNCD 1482          

HSP 2 Score: 66.6254 bits (161), Expect = 2.438e-11
Identity = 42/129 (32.56%), Postives = 62/129 (48.06%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C  G+ G QC E  + C    C  +G C + +G  +C C  G  G  C  + + C +NPCK+   C  N  G  G  C C P + G  C+  +  C+  PC  N+TC+ D   + +C+C  G  G  C+
Sbjct: 1396 CKPGFTGSQCEESVNDCNPNPCRNEGTCTDNNGSFKCSCIPGYTGRLCESDIDECLTNPCKHASAC-DNTPG--GYTCTCKPGYTGQNCDVDINYCQSSPCMYNSTCK-DLPTSFECVCDFGGRGERCE 1520          

HSP 3 Score: 62.003 bits (149), Expect = 5.935e-10
Identity = 37/101 (36.63%), Postives = 48/101 (47.52%), Query Frame = 3
Query:  912 NYNPCRS-NPCKNEGRCIP----NKTGEV---------------GIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +YNPC + N C N G C      ++ G V                I C C P F G  CE+S+  C   PC N  TC  D + + KC C+PGYTG LC+ +
Sbjct: 1347 DYNPCTTGNQCLNGGECSSAIQASRRGHVVSSTPVVMVTAGYTWKITCSCKPGFTGSQCEESVNDCNPNPCRNEGTCT-DNNGSFKCSCIPGYTGRLCESD 1446          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO34151 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ46])

HSP 1 Score: 66.6254 bits (161), Expect = 2.084e-11
Identity = 47/132 (35.61%), Postives = 62/132 (46.97%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            LC  G+ G QC+    +C  Q+  + G C+E  G   C C  G  G  C  N + C SNPC+N   C+    G    +C C P F G LC+     C   PC N  +C  ++ F   C C  GYTG  C+ E
Sbjct:  251 LCPPGFVGTQCDTPVKVCSTQNPCVRGTCVEQSGGAHCSCPLGFEGAFCELNVDECASNPCQNNAVCV---GGVDKFQCICRPGFSGTLCQFNDDDCSAKPCRNGGSCIDNERF-YTCACPAGYTGKNCETE 378          

HSP 2 Score: 52.373 bits (124), Expect = 5.504e-7
Identity = 45/131 (34.35%), Postives = 60/131 (45.80%), Query Frame = 3
Query:  768 CNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNR-KCICLPGYTGILCDQ 1145
            C  G++G  C    D C    C  +  C+    K QC+C  G  G  C  N + C + PC+N G CI N   E    C C   + G  CE  +  C+  PC +  TC   K FN  +C C P YTG  C++
Sbjct:  290 CPLGFEGAFCELNVDECASNPCQNNAVCVGGVDKFQCICRPGFSGTLCQFNDDDCSAKPCRNGGSCIDN---ERFYTCACPAGYTGKNCETEVQECQSEPCQHGGTCT--KRFNGYECSCAPTYTGANCEK 415          

HSP 3 Score: 50.0618 bits (118), Expect = 2.486e-6
Identity = 29/77 (37.66%), Postives = 39/77 (50.65%), Query Frame = 3
Query:  918 NPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            N C S+PC N  +CI  K      RC C P F G  C++ +  C+  PC   ATC  ++     C+C PG+ G  CD
Sbjct:  190 NDCASSPCNNNAKCIDTKE---SYRCECLPGFQGANCDKEVDECDKQPCFGAATC-VNRVNGYSCLCPPGFVGTQCD 262          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO39420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA29])

HSP 1 Score: 62.003 bits (149), Expect = 2.255e-11
Identity = 37/90 (41.11%), Postives = 49/90 (54.44%), Query Frame = 3
Query:  885 GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            G  G HC  + N C+SNPC N  +C  +     G  C C P + G++C+Q +  C+  PC N ATC  D      C C PGYTGI+C Q+
Sbjct:   28 GYTGRHCETDINECQSNPCLNGAKCNDHVN---GYTCKCAPGYTGIVCQQDINECQSNPCLNGATCN-DHVNGYTCKCAPGYTGIVCQQD 113          

HSP 2 Score: 60.077 bits (144), Expect = 9.718e-11
Identity = 49/135 (36.30%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDL--CLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPII 1157
            C +G+ G  C E D+  C    C+   KC +      C C  G  G  C  + N C+SNPC N   C  +  G     C C P + G++C+Q +  C+  PC N ATC  D      C C PGYTGI+C Q   I
Sbjct:   25 CLQGYTGRHC-ETDINECQSNPCLNGAKCNDHVNGYTCKCAPGYTGIVCQQDINECQSNPCLNGATCNDHVNG---YTCKCAPGYTGIVCQQDINECQSNPCLNGATCN-DHVNGYTCKCAPGYTGIVCQQGKCI 154          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: ENSORLT00000041634.1 (crumbs cell polarity complex component 2 [Source:NCBI gene;Acc:101175660])

HSP 1 Score: 75.8702 bits (185), Expect = 8.472e-14
Identity = 71/225 (31.56%), Postives = 98/225 (43.56%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNP--CRSNP-CKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQLGSTQTILFFSFGILFCILGVVVSILLYRRKMRKEWN-NKNKFEISMKELESKSNPRVLSNE 1418
            C  G+KG+ C E+ D CL  SC+  G+C E  G   C C  G  G  C   + P  C +N  C NEG C+    G+ G  C C P F G  CE  +  C   PC N ATC+ D+  + KC+C+PG+ G  C+       E  P  A                      TI   +  +L  IL V   I+  R+K + E   + +  E++   LE  S  +V   E
Sbjct: 1262 CEPGYKGKNCEEEVDNCLEFSCINGGRCEETVGTHSCSCPPGFKGKRCQWRFPPVACDANTKCFNEGVCV---GGDSGGNCSCKPGFSGARCEAEIDECSSNPCLNGATCQ-DQLNHFKCVCVPGFHGKFCENNKEEHRERVPWLA---------------------VTIPLTTLCVLLAILIVFFLIMTARKKRQSEGTYSPSSQEVAGARLEMGSVLKVPPEE 1461          

HSP 2 Score: 57.3806 bits (137), Expect = 4.741e-8
Identity = 51/190 (26.84%), Postives = 75/190 (39.47%), Query Frame = 3
Query:  672 SAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCNGRI--GPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATC--------------------EYDKDFNRKCICLPGYTGILC 1139
            + +C     G  CE+      L+ C   G  +         C  G++G+ C    D C    C+ DG+CI+     +C C+G    G HC  N   C S+PC++ G C+    G    +C C P + G  C+  +  CE  PC N  TC                     Y       C+C+ G+TG  C
Sbjct:  247 TCECAPGFEGMNCEVEIDECELHPCQNGGICIDHIAMYSCECTAGFQGQDCEVNIDECASMPCLNDGRCIDGINSYECDCDGTGFEGDHCEDNIQECASDPCQHGGTCL---DGINQYKCVCWPGYEGENCQMDIDECEKGPCDNGGTCFQRSDVRNYKNLPELSVTTFSYGTAAGFICLCMAGFTGHNC 433          

HSP 3 Score: 55.8398 bits (133), Expect = 1.605e-7
Identity = 55/164 (33.54%), Postives = 67/164 (40.85%), Query Frame = 3
Query:  699 GEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFF-GVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            G  CE+  K      C  NG  L         C  G++G  C  E D C    C   G CI+      C C  G  G  C  N + C S PC N+GRCI    G     C C+   F G  CE ++  C   PC +  TC  D     KC+C PGY G  C  +
Sbjct:  218 GSHCELDIKECASQPCQNNGTCLDEVDHYTCECAPGFEGMNCEVEIDECELHPCQNGGICIDHIAMYSCECTAGFQGQDCEVNIDECASMPCLNDGRCI---DGINSYECDCDGTGFEGDHCEDNIQECASDPCQHGGTC-LDGINQYKCVCWPGYEGENCQMD 377          

HSP 4 Score: 54.6842 bits (130), Expect = 2.916e-7
Identity = 54/185 (29.19%), Postives = 72/185 (38.92%), Query Frame = 3
Query:  633 SIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKL----------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVG-IRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
             +R+  V    S +  C     GE C+      +   C   G  +          C  G++GE C E  D C  + C     C +     QC C  G  G HC  +   C S PC+N G C+     EV    C C P F G+ CE  +  CE+ PC N   C  D      C C  G+ G  C+
Sbjct:  119 GVRSYCVDGANSYACHCPIGWAGENCQDSVTTCSTQACQNGGTCVDVPDAGHQCQCVPGYQGENCEENVDECWSEPCQNGAICKDGVNGYQCFCVPGFQGSHCELDIKECASQPCQNNGTCLD----EVDHYTCECAPGFEGMNCEVEIDECELHPCQNGGIC-IDHIAMYSCECTAGFQGQDCE 298          

HSP 5 Score: 50.447 bits (119), Expect = 6.165e-6
Identity = 43/140 (30.71%), Postives = 63/140 (45.00%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHC------NPNFFGVLCEQSL--CEIVPCHNNATC----EYDKDFNRKCICLPGYTGILCD 1142
            LC  G+ G  C+   D C    C   G+C ++     C+C +G  G HC  + N C SNPCKN   C  +       +CHC         + G  C+  L  C    C +  +C    + D   +  C+CLPG++G LC+
Sbjct:  423 LCMAGFTGHNCSVNVDECESAPCQHGGRCQDLVNSYHCLCPDGFTGVHCEEDINECASNPCKNGATCEDSVN---SYKCHCPKAEGSQEPWGGQDCDVRLVGCLQHQCQHEKSCVPVLKDDGAHSYMCMCLPGWSGELCN 559          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: dner (delta/notch like EGF repeat containing [Source:NCBI gene;Acc:101167974])

HSP 1 Score: 75.0998 bits (183), Expect = 1.346e-13
Identity = 44/131 (33.59%), Postives = 61/131 (46.56%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQ--SLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            C  G++GE+C  Q D CL Q C     C      P+C C  G  G  C    +PC S+PC N G C       +G  C C   F G  C Q  + C + PC +         +  +C+C+PGY G+ C++E
Sbjct:  397 CQPGYEGERCQRQVDHCLSQPCRNGATCFSSLAGPRCYCPEGYQGTACKQKVDPCASSPCHNNGTCYAQGPSPLGFGCSCTTGFTGPTCGQLVNFCALNPCAHGVCRSVGNSY--RCLCVPGYHGLYCEEE 525          

HSP 2 Score: 50.8322 bits (120), Expect = 4.319e-6
Identity = 42/129 (32.56%), Postives = 54/129 (41.86%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C  G+ G  C +  + C    C   G C  +    +C+C  G  G +C   YN C S PC+N   C   +       C C P F G  CE  +  C  V C N   CE    FN  C+C  GY G  C+
Sbjct:  476 CTTGFTGPTCGQLVNFCALNPCA-HGVCRSVGNSYRCLCVPGYHGLYCEEEYNECLSAPCQNYATC---RDLINSYECVCTPQFEGKHCEIYKDPCLKVHCENGGRCE-SSAFNTSCVCAAGYLGEKCE 599          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: ENSORLT00000020612.2 (crumbs cell polarity complex component 2 [Source:NCBI gene;Acc:101175660])

HSP 1 Score: 70.8626 bits (172), Expect = 3.671e-12
Identity = 52/132 (39.39%), Postives = 69/132 (52.27%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNP--CRSNP-CKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C  G+KG+ C E+ D CL  SC+  G+C E  G   C C  G  G  C   + P  C +N  C NEG C+    G+ G  C C P F G  CE  +  C   PC N ATC+ D+  + KC+C+PG+ G  C+
Sbjct: 1262 CEPGYKGKNCEEEVDNCLEFSCINGGRCEETVGTHSCSCPPGFKGKRCQWRFPPVACDANTKCFNEGVCV---GGDSGGNCSCKPGFSGARCEAEIDECSSNPCLNGATCQ-DQLNHFKCVCVPGFHGKFCE 1389          

HSP 2 Score: 56.9954 bits (136), Expect = 5.734e-8
Identity = 51/190 (26.84%), Postives = 75/190 (39.47%), Query Frame = 3
Query:  672 SAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMCNGRI--GPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATC--------------------EYDKDFNRKCICLPGYTGILC 1139
            + +C     G  CE+      L+ C   G  +         C  G++G+ C    D C    C+ DG+CI+     +C C+G    G HC  N   C S+PC++ G C+    G    +C C P + G  C+  +  CE  PC N  TC                     Y       C+C+ G+TG  C
Sbjct:  247 TCECAPGFEGMNCEVEIDECELHPCQNGGICIDHIAMYSCECTAGFQGQDCEVNIDECASMPCLNDGRCIDGINSYECDCDGTGFEGDHCEDNIQECASDPCQHGGTCL---DGINQYKCVCWPGYEGENCQMDIDECEKGPCDNGGTCFQRSDVRNYKNLPELSVTTFSYGTAAGFICLCMAGFTGHNC 433          

HSP 3 Score: 55.4546 bits (132), Expect = 1.893e-7
Identity = 55/164 (33.54%), Postives = 67/164 (40.85%), Query Frame = 3
Query:  699 GEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQCN-EQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFF-GVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            G  CE+  K      C  NG  L         C  G++G  C  E D C    C   G CI+      C C  G  G  C  N + C S PC N+GRCI    G     C C+   F G  CE ++  C   PC +  TC  D     KC+C PGY G  C  +
Sbjct:  218 GSHCELDIKECASQPCQNNGTCLDEVDHYTCECAPGFEGMNCEVEIDECELHPCQNGGICIDHIAMYSCECTAGFQGQDCEVNIDECASMPCLNDGRCI---DGINSYECDCDGTGFEGDHCEDNIQECASDPCQHGGTC-LDGINQYKCVCWPGYEGENCQMD 377          

HSP 4 Score: 54.6842 bits (130), Expect = 3.528e-7
Identity = 54/185 (29.19%), Postives = 72/185 (38.92%), Query Frame = 3
Query:  633 SIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKL----------CNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVG-IRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
             +R+  V    S +  C     GE C+      +   C   G  +          C  G++GE C E  D C  + C     C +     QC C  G  G HC  +   C S PC+N G C+     EV    C C P F G+ CE  +  CE+ PC N   C  D      C C  G+ G  C+
Sbjct:  119 GVRSYCVDGANSYACHCPIGWAGENCQDSVTTCSTQACQNGGTCVDVPDAGHQCQCVPGYQGENCEENVDECWSEPCQNGAICKDGVNGYQCFCVPGFQGSHCELDIKECASQPCQNNGTCLD----EVDHYTCECAPGFEGMNCEVEIDECELHPCQNGGIC-IDHIAMYSCECTAGFQGQDCE 298          

HSP 5 Score: 50.447 bits (119), Expect = 7.273e-6
Identity = 43/140 (30.71%), Postives = 63/140 (45.00%), Query Frame = 3
Query:  765 LCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHC------NPNFFGVLCEQSL--CEIVPCHNNATC----EYDKDFNRKCICLPGYTGILCD 1142
            LC  G+ G  C+   D C    C   G+C ++     C+C +G  G HC  + N C SNPCKN   C  +       +CHC         + G  C+  L  C    C +  +C    + D   +  C+CLPG++G LC+
Sbjct:  423 LCMAGFTGHNCSVNVDECESAPCQHGGRCQDLVNSYHCLCPDGFTGVHCEEDINECASNPCKNGATCEDSVN---SYKCHCPKAEGSQEPWGGQDCDVRLVGCLQHQCQHEKSCVPVLKDDGAHSYMCMCLPGWSGELCN 559          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: dlc (delta-like protein C [Source:NCBI gene;Acc:101170775])

HSP 1 Score: 70.0922 bits (170), Expect = 4.292e-12
Identity = 68/281 (24.20%), Postives = 115/281 (40.93%), Query Frame = 3
Query:  345 IDKDNCQIYYTETSSYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALFGYQFTQSPSANYSNPIYDNITMYR-----QDRSIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPSN----LYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV---PCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +   +C++++     +  H +    P       S+++   ++ IP    +++  +   +W  P  +AL    ++ + SA   + +       R     Q+ S    + ++  S    CD   +GE C  FC+P N     + C   G++ C EGW+GE C+ Q +C        G C       QC+C  G  G  C    + C   P    G C      ++  +C+C   + G+LC Q L       PC N A+C      +  C C PGY G  C+ E
Sbjct:   57 LQPGDCRVFFRLCLKHVQHVSNPGTPCTYGNASSEVI--GVNSIPGSATVRVPFLY--KW--PGSVALILEAWSAAESAETPSSLLSWTATRRTLSVGQEWSETENQTELHYSYRVICDRFYHGETCSTFCRPRNDTHGHFVCDEEGRRHCMEGWRGEYCS-QSICAAGCSEEHGFCTSPG---QCLCRQGWRGKLC----DECALYPGCIHGTC------QLPWQCNCKEGWGGLLCNQDLNYCTNHKPCKNGASCTNTGKGSYTCTCRPGYLGKDCETE 317          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: dlc (delta-like protein C [Source:NCBI gene;Acc:101170775])

HSP 1 Score: 70.0922 bits (170), Expect = 4.292e-12
Identity = 68/281 (24.20%), Postives = 115/281 (40.93%), Query Frame = 3
Query:  345 IDKDNCQIYYTETSSYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALFGYQFTQSPSANYSNPIYDNITMYR-----QDRSIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPSN----LYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIV---PCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            +   +C++++     +  H +    P       S+++   ++ IP    +++  +   +W  P  +AL    ++ + SA   + +       R     Q+ S    + ++  S    CD   +GE C  FC+P N     + C   G++ C EGW+GE C+ Q +C        G C       QC+C  G  G  C    + C   P    G C      ++  +C+C   + G+LC Q L       PC N A+C      +  C C PGY G  C+ E
Sbjct:   57 LQPGDCRVFFRLCLKHVQHVSNPGTPCTYGNASSEVI--GVNSIPGSATVRVPFLY--KW--PGSVALILEAWSAAESAETPSSLLSWTATRRTLSVGQEWSETENQTELHYSYRVICDRFYHGETCSTFCRPRNDTHGHFVCDEEGRRHCMEGWRGEYCS-QSICAAGCSEEHGFCTSPG---QCLCRQGWRGKLC----DECALYPGCIHGTC------QLPWQCNCKEGWGGLLCNQDLNYCTNHKPCKNGASCTNTGKGSYTCTCRPGYLGKDCETE 317          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000063934.1 (SMESG000063934.1)

HSP 1 Score: 1092.03 bits (2823), Expect = 0.000e+0
Identity = 529/534 (99.06%), Postives = 531/534 (99.44%), Query Frame = 3
Query:  105 MTIKLTNSNQYVFITLLFIFYHIYIDRGVSSERVGYLYFKFLCYENFEHLDRNGAECDSVPSKNCDPIFTICINHQYISGIDKDNCQIYYTETSSYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALFGYQFTQSPSANYSNPIYDNITMYRQDRSIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMCNGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQLGSTQTILFFSFGILFCILGVVVSILLYRRKMRKEWNNKNKFEISMKELESKSNPRVLSNEYFSKVRDECIYETVKDENTYAYLHDKNDEYLIPSRPNTPGFPNSQNNDESDYLEMSNNFEVNTLTNNRLYEKEDELPPLPTREIKRKLSLSKFCMS 1706
            MTIKLTNSNQYVFITLLFIFYHIYIDRGVSSERVGYLYFKFLCYENFEHLDRNGAECDSVPSKNCDPIFTICINHQYISGIDKDNCQIYYTETSSYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALFGYQFTQSPSANYSNPIYDNITMYRQDRSIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGK QCMCNGRIGPHCFPNYNPC+SNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGN SHGALADKNIQLGSTQTILFFSFGILFCILGVVVSILLYRRKMRKEWNNKNKFEISMKELESKSNPRV+SNEYFSKVRDECIYETVKDENTYAYL DKNDEYLIPSRPNTPGFPNSQNNDESDYLEMSNNFEVNTLTNNRLYEKEDELPPLPTREIKRKLSLSKFCMS
Sbjct:    1 MTIKLTNSNQYVFITLLFIFYHIYIDRGVSSERVGYLYFKFLCYENFEHLDRNGAECDSVPSKNCDPIFTICINHQYISGIDKDNCQIYYTETSSYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALFGYQFTQSPSANYSNPIYDNITMYRQDRSIRNPKVKMFISMSAQCDHNRYGEKCEIFCKPSNLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKAQCMCNGRIGPHCFPNYNPCKSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNFSHGALADKNIQLGSTQTILFFSFGILFCILGVVVSILLYRRKMRKEWNNKNKFEISMKELESKSNPRVISNEYFSKVRDECIYETVKDENTYAYLQDKNDEYLIPSRPNTPGFPNSQNNDESDYLEMSNNFEVNTLTNNRLYEKEDELPPLPTREIKRKLSLSKFCMS 534          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000025423.1 (SMESG000025423.1)

HSP 1 Score: 103.99 bits (258), Expect = 2.880e-23
Identity = 111/423 (26.24%), Postives = 170/423 (40.19%), Query Frame = 3
Query:  141 FITLLFIFYHIYIDRGVSSERVGYLYFKFLCYENFEHLDRNGAECDS----VPSKNCDPIFTICINHQYISGIDKDNCQIYYTETSSYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALFGYQFTQSPSANYSNPIYDNITMYRQDRSIRNPKV--KMFISMSAQCDHNRYGEKCEIFCKPS-----NLYKCSRN-GKKLCNEGWKGEQCNEQDLCLYQS-CVLDGKCIEIDGKPQCMCNGRI-GPHCFPNYNPCRSNPCKNEGRCI--PNKTGEVGIR--CHCNPNFFGVLCEQSL--CEIVPCHNNATC-----EYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQLGSTQTILFFSFGILFCILGVVVSILLYRRKMR 1334
            FI + F+F  I   +   +   G ++   + Y N      NG ECDS         CD +F IC+        +   C +    T +   H T+  +   + G +       L  +P+   I IN+ D D         + G Q           PI  +    R    I    V  +M   +  +C    YG  C  +CKPS       Y C +N G+K C  GW G  C ++D+C+  + C     C   +    C+C   + G +C  +  PC S+PC N G C+  P  + EV  +  C C  NF G  C+     C+  PC N+A C      YD      CICL  + G+ C++ P+  V+   + A    +S+   + +  I L  T   L F  G+L        S+L YR + +
Sbjct:    3 FILIAFLFKLIIQSK---ANGPGSVFVYLVSYVNPSGKTDNGVECDSWFNQFVQDKCDLVFEICLKDVENKNPNSFPCNVGSISTLNNIYHNTLNVRFDSSIGFIPNPFNFTLTSMPENLKIVINITDDD---------ISGQQLISQMQHVIQLPIIGHDEDLRGLNKIVLSSVNSEMVFKVYGRCKEFYYGPGCSQYCKPSFSMKTGFYACDKNSGQKYCLIGWTGTNCTQRDMCVLDNPCHGSASCSMNESVVNCICPDSLEGQYCQTSKRPCGSSPCLNGGLCVLHPIDSNEVSRKTVCVCPRNFTGETCQHDFNECKNSPCKNDANCVNVFGSYD------CICLNNHWGVNCEKPPVFSVKGI-DPAYFIKSSTARFMQNTIIVLLVTVMCLIFIIGLL--------SLLYYRNRSK 398          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000025423.1 (SMESG000025423.1)

HSP 1 Score: 101.679 bits (252), Expect = 1.275e-22
Identity = 112/427 (26.23%), Postives = 172/427 (40.28%), Query Frame = 3
Query:  141 FITLLFIFYHIYIDRGVSSERVGYLYFKFLCYENFEHLDRNGAECDS----VPSKNCDPIFTICINHQYISGIDKDN----CQIYYTETSSYDNHETVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALFGYQFTQSPSANYSNPIYDNITMYRQDRSIRNPKV--KMFISMSAQCDHNRYGEKCEIFCKPS-----NLYKCSRN-GKKLCNEGWKGEQCNEQDLCLYQS-CVLDGKCIEIDGKPQCMCNGRI-GPHCFPNYNPCRSNPCKNEGRCI--PNKTGEVGIR--CHCNPNFFGVLCEQSL--CEIVPCHNNATC-----EYDKDFNRKCICLPGYTGILCDQEPIIPVETTPNTAPRRGNSSHGALADKNIQLGSTQTILFFSFGILFCILGVVVSILLYRRKMR 1334
            FI + F+F  I   +   +   G ++   + Y N      NG ECDS         CD +F IC+       ++  N    C +    T +   H T+  +   + G +       L  +P+   I IN+ D D         + G Q           PI  +    R    I    V  +M   +  +C    YG  C  +CKPS       Y C +N G+K C  GW G  C ++D+C+  + C     C   +    C+C   + G +C  +  PC S+PC N G C+  P  + EV  +  C C  NF G  C+     C+  PC N+A C      YD      CICL  + G+ C++ P+  V+   + A    +S+   + +  I L  T   L F  G+L        S+L YR + +
Sbjct:    3 FILIAFLFKLIIQSK---ANGPGSVFVYLVSYVNPSGKTDNGVECDSWFNQFVQDKCDLVFEICLKD-----VENKNPNFPCNVGSISTLNNIYHNTLNVRFDSSIGFIPNPFNFTLTSMPENLKIVINITDDD---------ISGQQLISQMQHVIQLPIIGHDEDLRGLNKIVLSSVNSEMVFKVYGRCKEFYYGPGCSQYCKPSFSMKTGFYACDKNSGQKYCLIGWTGTNCTQRDMCVLDNPCHGSASCSMNESVVNCICPDSLEGQYCQTSKRPCGSSPCLNGGLCVLHPIDSNEVSRKTVCVCPRNFTGETCQHDFNECKNSPCKNDANCVNVFGSYD------CICLNNHWGVNCEKPPVFSVKGI-DPAYFIKSSTARFMQNTIIVLLVTVMCLIFIIGLL--------SLLYYRNRSK 397          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000063217.1 (SMESG000063217.1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.872e-11
Identity = 62/173 (35.84%), Postives = 86/173 (49.71%), Query Frame = 3
Query:  678 QCDHNRYGEKCEIFCKPSNLYKCSRNGKKL----------CNEGWKGEQC-NEQDLCL-YQS--CVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATC-EYDKDFNRKCICLPGYTGILCD 1142
            QC  N  G  CE+     +   C  NGK +          CN+G+ G+ C N+ D C  Y++  C   G CI   G  QC C  G  G  C  +   C ++ CKN G C+ +K G    RC C  N+FG  CE  ++LCE+ PC N   C ++D+D+  +CIC   +TG  CD
Sbjct:  121 QCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGDTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCL-DKIGSY--RCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDY--QCICGNQWTGKNCD 288          

HSP 2 Score: 61.6178 bits (148), Expect = 1.749e-9
Identity = 56/164 (34.15%), Postives = 75/164 (45.73%), Query Frame = 3
Query:  699 GEKCEIFCKPSNLYKCSRNGKKL---------CNEGWKGEQC--NEQDLCLYQSCVLDGKCIEIDGKPQCMCNGR-IGPHCFPNYNPCRSNPCKNEGRCIPNKTGE--VGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            GE+CEI         CS + K +         C  G+ G+ C  N+ D C   SC+  G+C++     +C CN   IG +C     PC SNPC N+G CI  K  +   G  C+C   F G  CE  +  C   PC +   CE D D + KC C   Y G  C+
Sbjct:  729 GERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDND-CTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLD-SFKCKCNSEYIGERCE 890          

HSP 3 Score: 58.9214 bits (141), Expect = 1.149e-8
Identity = 54/179 (30.17%), Postives = 77/179 (43.02%), Query Frame = 3
Query:  681 CDHNRYGEKCEIFCKPSNLYKCSRNG----------KKLCNEGWKGEQCNEQ-DLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL--CEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPIIPVETTP 1175
            C +   G+ C+    P  +  C  NG          K +C  G++G++C    D C   SC   G CI +    +C C  G  G +C  N N C + PC+N  +CI          C C     G  CE ++  C   PC N A CE D+     C CL G+ G+ C+ +  I  + TP
Sbjct:  278 CGNQWTGKNCDDVKNPCKINPCKNNGFCESVNYQDYKCICQRGFEGKRCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNNDYT---CDCPEGLTGKNCEINIDECTPNPCLNGARCE-DRVGGFTCQCLQGFVGLRCETKSDICKQLTP 452          

HSP 4 Score: 52.7582 bits (125), Expect = 8.527e-7
Identity = 43/130 (33.08%), Postives = 63/130 (48.46%), Query Frame = 3
Query:  768 CNEGWKGEQCNEQDL--CLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            C  G+ GE+C E D+  C   +C   G C++  G  +C+C N   G +C      C   PCKN G C   +  +   +C C   + G  C+  ++ C+I PC NN  CE     + KCIC  G+ G  C+
Sbjct:  202 CKAGFNGERC-ENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGIC---RDFDEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESVNYQDYKCICQRGFEGKRCE 327          

HSP 5 Score: 52.7582 bits (125), Expect = 9.127e-7
Identity = 49/138 (35.51%), Postives = 62/138 (44.93%), Query Frame = 3
Query:  753 NGKKLCN--EGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEV-GIRCHCNPNFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQE 1148
            NGK +C    G+KG  C ++  C    C   G C  I G   C C N  +G  C  + N C S+PC+N G C   K+ E+    C C  N+ G+ CE   S     PC  N  C    D   KC C  GYTG  C  +
Sbjct:   40 NGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNYVCQCLNEWVGEFCEFSSN-CASSPCRNGGIC---KSLEIHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCILANDGEVKCHCNKGYTGDTCSND 173          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000022173.1 (SMESG000022173.1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.830e-10
Identity = 65/241 (26.97%), Postives = 97/241 (40.25%), Query Frame = 3
Query:  630 RSIRNPK--VKMFISMSAQCDHNRYGEKCEIFCKPS----NLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIEIDGKPQCMC-NGRIGPHC-----FP----------------------------------NYNPCRSNP--CKNEGRCI--PNKTGEVGIRCHCNP------------------NFFGVLCE--QSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCD 1142
            + +  PK   ++ +S    C  N +GE+C+  CKPS      Y CS NG ++C+ G+ G  C ++ +CL +   ++G C+   G  QC C  G  G  C     +P                                  + N C +NP  C+N G C+   N       RC C P                  +F+G  C+  Q+ C+  PC  N+ C  DK    KC C PG+TG  C+
Sbjct:  160 KQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYC-DKVVCLKK--CINGACV---GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENGGECLNFGNIKTNQQYRCICKPGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFTGRNCE 394          

HSP 2 Score: 50.8322 bits (120), Expect = 3.545e-6
Identity = 52/173 (30.06%), Postives = 67/173 (38.73%), Query Frame = 3
Query:  765 LCNEGWKGEQC--NEQDLCLYQSCVLDGKCIEIDGKPQCMCN-GRIGPHCFPNYNPCRSN-PCKNEGRCIPNKTGEVGIRCHCNPNFFGVLCEQSL-----------CEIVPCHNNATC--------------EYDKDFNR--KCICLPGYTGILCDQEPIIPVETTPNTAPR 1190
            +C  G+ G++C  N+ D C   SC+   KC++   +  C C  G  G  C  N N C  N PC N G CI         RC C   + G  C   +           C I PC NN  C              EY K       C C PG+TG LC++  I        + PR
Sbjct:  421 VCPVGFSGDRCQVNKND-CQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGS---YRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANGSIVMYSEPR 589          
The following BLAST results are available for this feature:
BLAST of Delta-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NOTCH31.349e-1234.62notch receptor 3 [Source:HGNC Symbol;Acc:HGNC:7883... [more]
SVEP11.043e-1137.40sushi, von Willebrand factor type A, EGF and pentr... [more]
SVEP11.061e-1137.40sushi, von Willebrand factor type A, EGF and pentr... [more]
NOTCH21.365e-1138.06notch receptor 2 [Source:HGNC Symbol;Acc:HGNC:7882... [more]
CRB12.397e-1139.69crumbs cell polarity complex component 1 [Source:H... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slt-17.794e-1331.82Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
clec-782.917e-1134.04C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531... [more]
ten-13.070e-1028.49Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
ten-13.201e-1028.49Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
ten-13.496e-1028.49Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
N6.428e-1338.19gene:FBgn0004647 transcript:FBtr0304659[more]
N6.428e-1338.19gene:FBgn0004647 transcript:FBtr0070507[more]
wry7.859e-1335.56gene:FBgn0051665 transcript:FBtr0334823[more]
wry7.925e-1335.56gene:FBgn0051665 transcript:FBtr0304911[more]
wry8.000e-1335.56gene:FBgn0051665 transcript:FBtr0089786[more]
back to top
BLAST of Delta-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jag1a2.062e-1424.32jagged canonical Notch ligand 1a [Source:NCBI gene... [more]
jag1a2.542e-1424.32jagged canonical Notch ligand 1a [Source:NCBI gene... [more]
dll44.857e-1324.15delta-like 4 (Drosophila) [Source:ZFIN;Acc:ZDB-GEN... [more]
notch35.010e-1338.76notch receptor 3 [Source:ZFIN;Acc:ZDB-GENE-000329-... [more]
dll46.303e-1324.15delta-like 4 (Drosophila) [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
notch16.242e-1530.54notch 1 receptor [Source:NCBI gene;Acc:100037842][more]
notch17.398e-1532.07notch 1 receptor [Source:NCBI gene;Acc:100037842][more]
notch17.541e-1530.54notch 1 receptor [Source:NCBI gene;Acc:100037842][more]
notch18.000e-1530.54notch 1 receptor [Source:NCBI gene;Acc:100037842][more]
notch18.530e-1532.07notch 1 receptor [Source:NCBI gene;Acc:100037842][more]
back to top
BLAST of Delta-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Notch33.711e-1334.62notch 3 [Source:MGI Symbol;Acc:MGI:99460][more]
Notch45.264e-1332.00notch 4 [Source:MGI Symbol;Acc:MGI:107471][more]
Vcan1.110e-1141.67versican [Source:MGI Symbol;Acc:MGI:102889][more]
Vcan1.654e-1141.67versican [Source:MGI Symbol;Acc:MGI:102889][more]
Svep11.846e-1134.88sushi, von Willebrand factor type A, EGF and pentr... [more]
back to top
BLAST of Delta-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2RUV0|NOTC1_XENTR4.593e-1432.07Neurogenic locus notch homolog protein 1 OS=Xenopu... [more]
sp|Q9R172|NOTC3_RAT1.895e-1332.61Neurogenic locus notch homolog protein 3 OS=Rattus... [more]
sp|P21783|NOTC1_XENLA3.522e-1332.61Neurogenic locus notch homolog protein 1 OS=Xenopu... [more]
sp|Q90Y57|JAG1A_DANRE5.224e-1324.02Protein jagged-1a OS=Danio rerio OX=7955 GN=jag1a ... [more]
sp|Q61982|NOTC3_MOUSE2.596e-1234.62Neurogenic locus notch homolog protein 3 OS=Mus mu... [more]
back to top
BLAST of Delta-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A095C1501.611e-3428.11Delta-like protein OS=Schistosoma haematobium OX=6... [more]
A0A3Q0KLB54.124e-3428.38Delta-like protein OS=Schistosoma mansoni OX=6183 ... [more]
A0A183JWE31.711e-3027.94Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A504Z3341.522e-2924.91Delta-like protein OS=Fasciola gigantica OX=46835 ... [more]
A0A4Z2DN503.060e-2927.39Delta-like protein OS=Schistosoma japonicum OX=618... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DLK12.519e-1336.17delta like non-canonical Notch ligand 1 [Source:HG... [more]
dll42.877e-1324.86delta like canonical Notch ligand 4 [Source:NCBI g... [more]
dll44.032e-1325.63delta like canonical Notch ligand 4 [Source:NCBI g... [more]
fat1b6.554e-1331.76protocadherin Fat 1 [Source:NCBI gene;Acc:10302976... [more]
fat1b6.554e-1331.76protocadherin Fat 1 [Source:NCBI gene;Acc:10302976... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004043.18.453e-1231.78pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004042.11.021e-1131.78pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000002014.12.137e-1029.38pep scaffold:Pmarinus_7.0:GL482490:2146:12219:-1 g... [more]
ENSPMAT00000002017.15.513e-933.33pep scaffold:Pmarinus_7.0:GL482490:2146:11907:-1 g... [more]
ENSPMAT00000002643.16.252e-935.11pep scaffold:Pmarinus_7.0:GL478752:33855:40482:1 g... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Delta-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO283795.483e-1338.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO276172.703e-1239.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354131.047e-1137.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341512.084e-1135.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394202.255e-1141.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000041634.18.472e-1431.56crumbs cell polarity complex component 2 [Source:N... [more]
dner1.346e-1333.59delta/notch like EGF repeat containing [Source:NCB... [more]
ENSORLT00000020612.23.671e-1239.39crumbs cell polarity complex component 2 [Source:N... [more]
dlc4.292e-1224.20delta-like protein C [Source:NCBI gene;Acc:1011707... [more]
dlc4.292e-1224.20delta-like protein C [Source:NCBI gene;Acc:1011707... [more]
back to top
BLAST of Delta-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063934.10.000e+099.06SMESG000063934.1[more]
SMESG000025423.12.880e-2326.24SMESG000025423.1[more]
SMESG000025423.11.275e-2226.23SMESG000025423.1[more]
SMESG000063217.11.872e-1135.84SMESG000063217.1[more]
SMESG000022173.13.830e-1026.97SMESG000022173.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025285 ID=SMED30025285|Name=Delta-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1946bp
ATTGCGCACACAATGACCTATCTTGCAAACGGTAGTCGAAATCGAAACTA
CCATTACATTAATTACAAAATTAATGAAAACTTGTATTAATTATCATACA
AGTAATGACAATAAAATTAACTAATTCCAATCAATATGTTTTTATTACTT
TGCTTTTTATTTTTTACCATATTTATATCGATCGTGGAGTAAGCTCGGAG
CGAGTTGGTTATTTGTACTTTAAATTTTTATGCTATGAAAACTTTGAGCA
TTTGGATCGAAATGGAGCTGAATGTGATTCTGTGCCTTCAAAAAACTGTG
ATCCTATATTCACTATTTGTATAAATCATCAATATATAAGTGGAATTGAT
AAAGATAATTGTCAAATTTATTACACGGAAACAAGTAGCTATGATAACCA
TGAGACCGTGTGCAATAAACCAACTGATAACCGTGGACCTCTTTCAAAAT
TAGTTGTCAAAGAATTGCATTTTATCCCAAAAGAATGGTTTATAAAAATA
AATGTGATTGATTCTGACCAGTGGCACAATCCATCAGATATAGCCTTATT
TGGATACCAGTTTACGCAGTCGCCATCGGCGAATTATTCCAATCCTATTT
ATGATAATATTACAATGTATAGACAAGATCGGAGCATACGTAATCCGAAA
GTCAAAATGTTTATATCAATGAGTGCTCAGTGTGATCATAATCGCTACGG
TGAAAAATGTGAAATTTTTTGCAAACCTTCGAATTTATATAAATGTTCAC
GAAATGGCAAAAAACTTTGTAATGAAGGTTGGAAAGGTGAGCAATGTAAT
GAGCAAGATTTATGTTTGTATCAATCGTGTGTGCTCGATGGTAAATGTAT
AGAAATAGATGGAAAACCCCAGTGTATGTGCAACGGAAGGATAGGACCAC
ATTGCTTTCCAAATTATAATCCATGCAGATCAAATCCTTGTAAAAATGAA
GGCCGTTGCATACCAAATAAAACCGGAGAAGTCGGTATTCGATGCCATTG
TAATCCAAATTTTTTCGGAGTTCTGTGTGAACAAAGTCTTTGTGAAATAG
TGCCTTGCCATAATAACGCCACCTGTGAATATGATAAGGATTTCAATAGA
AAATGCATTTGTTTACCAGGTTATACTGGCATACTATGTGATCAAGAACC
AATTATACCGGTTGAAACCACACCGAATACAGCACCCAGGCGTGGAAATT
CCAGTCATGGAGCCCTTGCAGACAAAAATATTCAGTTGGGGAGCACGCAA
ACGATCCTATTTTTCAGTTTTGGAATATTGTTTTGCATATTGGGCGTTGT
AGTCTCAATATTATTATACAGAAGAAAAATGAGGAAAGAGTGGAATAATA
AAAACAAATTCGAAATTTCAATGAAAGAATTAGAAAGCAAATCGAATCCA
AGAGTACTTTCCAATGAATATTTCAGTAAAGTTCGCGATGAATGCATATA
CGAAACAGTGAAAGATGAAAATACTTACGCATATTTACATGATAAAAATG
ATGAATATTTAATTCCTTCGAGACCAAATACTCCTGGATTTCCCAATTCT
CAGAATAATGATGAATCAGATTATCTGGAAATGTCCAACAATTTCGAAGT
CAATACTTTGACAAATAATAGATTATATGAAAAAGAGGATGAATTACCTC
CTTTACCAACAAGAGAAATTAAGAGAAAATTAAGTTTATCGAAATTTTGT
ATGTCTTAATCTGGTGCAATAATCTCTAATATTTTAGAAAAATATTGATT
TTTGATTTCTTTCAAATATAAATAACCATATTTCATTATTTTTTAATCAC
TTTTTATTCACTTCTGTAGTGTACTATGTCCGGTTTAGTCAAATACTCCC
TGTCATTATTTATTATTTATCACAATGGTGCATGTGCTTTAGACACACAT
GTAGTATATATACTGTCTGCATTTCAATAATAAAGCTTCTTACGCG
back to top

protein sequence of SMED30025285-orf-1

>SMED30025285-orf-1 ID=SMED30025285-orf-1|Name=SMED30025285-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=535bp
MTIKLTNSNQYVFITLLFIFYHIYIDRGVSSERVGYLYFKFLCYENFEHL
DRNGAECDSVPSKNCDPIFTICINHQYISGIDKDNCQIYYTETSSYDNHE
TVCNKPTDNRGPLSKLVVKELHFIPKEWFIKINVIDSDQWHNPSDIALFG
YQFTQSPSANYSNPIYDNITMYRQDRSIRNPKVKMFISMSAQCDHNRYGE
KCEIFCKPSNLYKCSRNGKKLCNEGWKGEQCNEQDLCLYQSCVLDGKCIE
IDGKPQCMCNGRIGPHCFPNYNPCRSNPCKNEGRCIPNKTGEVGIRCHCN
PNFFGVLCEQSLCEIVPCHNNATCEYDKDFNRKCICLPGYTGILCDQEPI
IPVETTPNTAPRRGNSSHGALADKNIQLGSTQTILFFSFGILFCILGVVV
SILLYRRKMRKEWNNKNKFEISMKELESKSNPRVLSNEYFSKVRDECIYE
TVKDENTYAYLHDKNDEYLIPSRPNTPGFPNSQNNDESDYLEMSNNFEVN
TLTNNRLYEKEDELPPLPTREIKRKLSLSKFCMS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001774DSL
IPR000742EGF-like_dom
IPR013032EGF-like_CS
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007154cell communication
GO:0007275multicellular organism development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000742EGF-like domainSMARTSM00181egf_5coord: 312..346
e-value: 1.1E-4
score: 31.6
coord: 273..309
e-value: 8.9E-4
score: 28.6
coord: 236..268
e-value: 170.0
score: 2.0
IPR000742EGF-like domainPFAMPF00008EGFcoord: 274..305
e-value: 1.9E-4
score: 21.6
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 310..346
score: 13.826
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 270..309
score: 17.371
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 233..268
score: 8.639
IPR001774Delta/Serrate/lag-2 (DSL) proteinSMARTSM00051dsl11coord: 171..231
e-value: 2.3E-7
score: 40.5
IPR001774Delta/Serrate/lag-2 (DSL) proteinPFAMPF01414DSLcoord: 178..231
e-value: 1.5E-12
score: 47.6
IPR001774Delta/Serrate/lag-2 (DSL) proteinPROSITEPS51051DSLcoord: 191..231
score: 11.201
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 311..348
e-value: 5.1E-7
score: 31.6
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 235..309
e-value: 3.0E-9
score: 39.3
NoneNo IPR availableGENE3DG3DSA:2.10.25.140coord: 194..234
e-value: 3.8E-9
score: 38.5
NoneNo IPR availablePANTHERPTHR24044:SF448coord: 198..450
NoneNo IPR availablePANTHERPTHR24044FAMILY NOT NAMEDcoord: 198..450
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 270..314
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 313..349
NoneNo IPR availableTMHMMTMhelixcoord: 383..405
NoneNo IPR availableTMHMMTMhelixcoord: 7..25
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 334..345
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 297..308
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 334..345