WD repeat domain 19

Overview
NameWD repeat domain 19
Smed IDSMED30025283
Length (bp)4376
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat domain 19 (SMED30025283) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat domain 19 (SMED30025283) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat domain 19 (SMED30025283) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat domain 19 (SMED30025283) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025283

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025283SMESG000052128.1 SMESG000052127.1 SmedASXL_016970SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30025283SMESG000052128.1 SMESG000052127.1 dd_Smed_v4_10987_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025283SMESG000052128.1 SMESG000052127.1 dd_Smed_v6_10987_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025283SMESG000052128.1 SMESG000052127.1 dd_Smed_v4_10987_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat domain 19 vs. Ensembl Human
Match: WDR19 (WD repeat domain 19 [Source:HGNC Symbol;Acc:HGNC:18340])

HSP 1 Score: 1411.74 bits (3653), Expect = 0.000e+0
Identity = 704/1391 (50.61%), Postives = 957/1391 (68.80%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEA-KKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGS-DATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQ 4237
            +F++ E+      + F WQKT GNYLA+ G++  V I+DRHG   ++INL G CV +DWD+ GDVLA+I  KS  +YLWD + +K S+++ G +D +SF+ WSK  + LAVGT KGNLL+YNH  SRK+P+LGKH+K+ITCG W+ E LLALG ED+  T+SN EG+TI+Q  +R  PSN+QF  +K D+++S  E+ ++  L  +TLF   L + +NPA++ FQ+ +GNIV Y W+GDG IM+GFS G+ VVISTH  E+GQEI Q +++KDNL SI +S++L++  T GD C+KI DL  LK++  I+ LDE+ +     +W++DGQLLA+ST  G +HVFLT+LP+L   D   T+IA+LTSL EV+V N         + +++EP F+ VG  HL VGMNN+ W+Y         + + EY+ TV  + L+  Y+AA F+GK+ L +IE+    D +E +  +LFP        I    LTS+FLI+ TD G +  F+IEDW + ++++H   + KIF +  GT ++FID KS+ F Y P+ +   EI +F      VLW+    +  + +   DDK+YTY       +T +G                               K+ L G TK PF H PL L NG++    Q+GK+    L TH F   L+ L+     EL     Q +M+  FS+AW++   L   D+A     W ELA++ L  ++++FAIRVYRR+GN G+V SL +IK IED NLLAG++AMF ND+NLAQD +L SS P AAL MRRDL HWDSALQLAK L P QIPFIS+EYA QLEF GDYVNA+ +YE+G+        G NK   EH  +C  G+A+M+IR+GD +RGV  A +  +R+L ++C  ILE  KQ +EA  L+EK  Y++KA + YIR KNW KVG LL HVSSPK+HLQYAKA+EA+G YKEAV +YE AK + SVIR+ L+HLNNP++AV IV  T S +GA  VA+FF++LGD+ SAIQFLV+SKC++EA   AQ+H +ME YA IIGS D T EDYQ+IA YFE  K +  AGKF+LL  QY +A+KH LK    ED+ A+++AIE +G+A D+ LT+ L+++L+GE D +PK+ KYLF++YMALKQYREA +TAI+IA++EQ  GNYR AHD+LFSM  ELK   IKIPSEM++NLM++HSYI+ K+H+K GDH++GARMLIRVA +ISKFPSH+VPILTSTVIECHR+GL++S+FS+AAML+RP+YR +ID KY KK+E +VRRPD ++ EE  T CPFC  L+ E  L C  CK+SI YCIA+GRH+++DD  +CP C+FPA+ SEL+ +LN   S CPMCSE ++A +LK I D T+YL+
Sbjct:    4 IFSLLEKTWLGAPIQFAWQKTSGNYLAVTGADYIVKIFDRHGQKRSEINLPGNCVAMDWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRDQMSFLLWSKVGSFLAVGTVKGNLLIYNHQTSRKIPVLGKHTKRITCGCWNAENLLALGGEDKMITVSNQEGDTIRQTQVRSEPSNMQFFLMKMDDRTSAAESMISVVLGKKTLFFLNLNEPDNPADLEFQQDFGNIVCYNWYGDGRIMIGFSCGHFVVISTHTGELGQEIFQARNHKDNLTSIAVSQTLNKVATCGDNCIKIQDLVDLKDMYVILNLDEENKGLGTLSWTDDGQLLALSTQRGSLHVFLTKLPILG--DACSTRIAYLTSLLEVTVANPVEGELPITVSVDVEPNFVAVGLYHLAVGMNNRAWFYVLGENAVKKLKDMEYLGTVASICLHSDYAAALFEGKVQLHLIESEI-LDAQEERETRLFPAVDDKCR-ILCHALTSDFLIYGTDTGVVQYFYIEDWQFVNDYRHPVSVKKIFPDPNGTRLVFIDEKSDGFVYCPVNDATYEIPDFSPTIKGVLWENWPMDKGVFIAYDDDKVYTYVFHK---DTIQG------------------------------AKVILAGSTKVPFAHKPLLLYNGELTCQTQSGKVNNIYLSTHGF---LSNLKDTGPDELRPMLAQNLMLKRFSDAWEMCRILN--DEAA----WNELARACLHHMEVEFAIRVYRRIGNVGIVMSLEQIKGIEDYNLLAGHLAMFTNDYNLAQDLYLASSCPIAALEMRRDLQHWDSALQLAKHLAPDQIPFISKEYAIQLEFAGDYVNALAHYEKGI-------TGDNK---EHDEACLAGVAQMSIRMGDIRRGVNQALKHPSRVLKRDCGAILENMKQFSEAAQLYEKGLYYDKAASVYIRSKNWAKVGDLLPHVSSPKIHLQYAKAKEADGRYKEAVVAYENAKQWQSVIRIYLDHLNNPEKAVNIVRETQSLDGAKMVARFFLQLGDYGSAIQFLVMSKCNNEAFTLAQQHNKMEIYADIIGSEDTTNEDYQSIALYFEGEKRYLQAGKFFLLCGQYSRALKHFLKCPSSEDNVAIEMAIETVGQAKDELLTNQLIDHLLGENDGMPKDAKYLFRLYMALKQYREAAQTAIIIAREEQSAGNYRNAHDVLFSMYAELKSQKIKIPSEMATNLMILHSYILVKIHVKNGDHMKGARMLIRVANNISKFPSHIVPILTSTVIECHRAGLKNSAFSFAAMLMRPEYRSKIDAKYKKKIEGMVRRPDISEIEEATTPCPFCKFLLPECELLCPGCKNSIPYCIATGRHMLKDDWTVCPHCDFPALYSELKIMLNT-ESTCPMCSERLNAAQLKKISDCTQYLR 1337          
BLAST of WD repeat domain 19 vs. Ensembl Human
Match: WDR19 (WD repeat domain 19 [Source:HGNC Symbol;Acc:HGNC:18340])

HSP 1 Score: 448.743 bits (1153), Expect = 2.530e-143
Identity = 218/456 (47.81%), Postives = 313/456 (68.64%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEA-KKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSY 1435
            +F++ E+      + F WQKT GNYLA+ G++  V I+DRHG   ++INL G CV +DWD+ GDVLA+I  KS  +YLWD + +K S+++ G +D +SF+ WSK  + LAVGT KGNLL+YNH  SRK+P+LGKH+K+ITCG W+ E LLALG ED+  T+SN EG+TI+Q  +R  PSN+QF  +K D+++S  E+ ++  L  +TLF   L + +NPA++ FQ+ +GNIV Y W+GDG IM+GFS G+ VVISTH  E+GQEI Q +++KDNL SI +S++L++  T GD C+KI DL  LK++  I+ LDE+ +     +W++DGQLLA+ST  G +HVFLT+LP+L   D   T+IA+LTSL EV+V N         + +++EP F+ VG  HL VGMNN+ W+Y         + + EY+ TV  + L+  Y+AA F+GK+ L +   S+
Sbjct:    4 IFSLLEKTWLGAPIQFAWQKTSGNYLAVTGADYIVKIFDRHGQKRSEINLPGNCVAMDWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRDQMSFLLWSKVGSFLAVGTVKGNLLIYNHQTSRKIPVLGKHTKRITCGCWNAENLLALGGEDKMITVSNQEGDTIRQTQVRSEPSNMQFFLMKMDDRTSAAESMISVVLGKKTLFFLNLNEPDNPADLEFQQDFGNIVCYNWYGDGRIMIGFSCGHFVVISTHTGELGQEIFQARNHKDNLTSIAVSQTLNKVATCGDNCIKIQDLVDLKDMYVILNLDEENKGLGTLSWTDDGQLLALSTQRGSLHVFLTKLPILG--DACSTRIAYLTSLLEVTVANPVEGELPITVSVDVEPNFVAVGLYHLAVGMNNRAWFYVLGENAVKKLKDMEYLGTVASICLHSDYAAALFEGKVQLHLKAKSW 457          
BLAST of WD repeat domain 19 vs. Ensembl Human
Match: WDR19 (WD repeat domain 19 [Source:HGNC Symbol;Acc:HGNC:18340])

HSP 1 Score: 169.474 bits (428), Expect = 5.558e-48
Identity = 73/127 (57.48%), Postives = 98/127 (77.17%), Query Frame = 2
Query:  239 LDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQF 619
            +DWD+ GDVLA+I  KS  +YLWD + +K S+++ G +D +SF+ WSK  + LAVGT KGNLL+YNH  SRK+P+LGKH+K+ITCG W+ E LLALG ED+  T+SN EG+TI+Q  +R  PSN+QF
Sbjct:    1 MDWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRDQMSFLLWSKVGSFLAVGTVKGNLLIYNHQTSRKIPVLGKHTKRITCGCWNAENLLALGGEDKMITVSNQEGDTIRQTQVRSEPSNMQF 127          
BLAST of WD repeat domain 19 vs. Ensembl Human
Match: WDR19 (WD repeat domain 19 [Source:HGNC Symbol;Acc:HGNC:18340])

HSP 1 Score: 100.523 bits (249), Expect = 1.791e-24
Identity = 43/96 (44.79%), Postives = 65/96 (67.71%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDS 358
            +F++ E+      + F WQKT GNYLA+ G++  V I+DRHG   ++INL G CV +DWD+ GDVLA+I  KS  +YLWD + +K S+++ G + +
Sbjct:    4 IFSLLEKTWLGAPIQFAWQKTSGNYLAVTGADYIVKIFDRHGQKRSEINLPGNCVAMDWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRKT 99          
BLAST of WD repeat domain 19 vs. Ensembl Human
Match: WDR19 (WD repeat domain 19 [Source:HGNC Symbol;Acc:HGNC:18340])

HSP 1 Score: 100.138 bits (248), Expect = 2.515e-24
Identity = 43/94 (45.74%), Postives = 64/94 (68.09%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFK 352
            +F++ E+      + F WQKT GNYLA+ G++  V I+DRHG   ++INL G CV +DWD+ GDVLA+I  KS  +YLWD + +K S+++ G +
Sbjct:    4 IFSLLEKTWLGAPIQFAWQKTSGNYLAVTGADYIVKIFDRHGQKRSEINLPGNCVAMDWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMR 97          
BLAST of WD repeat domain 19 vs. Ensembl Celegans
Match: dyf-2 (WD repeat-containing protein dyf-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECZ4])

HSP 1 Score: 865.914 bits (2236), Expect = 0.000e+0
Identity = 490/1407 (34.83%), Postives = 789/1407 (56.08%), Query Frame = 2
Query:  128 KTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGF---KDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYY-----------------RENAETYHLVSEQ-----EYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTN--KVLWD-YKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQE-EEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNL--LNEPNSVCPMCSEPVSANELKMIL--DITEYLQKFNQ 4249
            + +G+ +A+  +N  V  YD+ GN+++ +N  GK + + WD++GDVLAI    +  +YLWDV+      +E+G    K+  + + WS     L +G + GN+++YNH  SR++ ++GKH + +T    + E  +   S+D T +++  EG T+        P+N+ +  +     S +    ++  +  + L L     ++ P  + FQEKYGNI  Y+WF DGYI++GF  GY++ IS H  EIG E+    +Y+  LASI +S S ++ +T+GD  VK+ DL+ L  +T + +++ +    +   +EDGQL+A+S+ +G + +F+T++P LA+       I +LT+L +V+V        S  L + +EP  +G+G  +L V  NN V++Y                 +  AE   +V+ +     EY+ TVT +QLN +Y+A  F  ++ L  I NS ++   E      FPE   +   + S+ LT NFLIF+T   Y+  F + +W   SE++H   +  IF +         D++  A  YS +++EV  +       +    +W+ +  D+N+  +         +  Q++YV                  F + K       + +    +  +  T+ P  ++PL L  G +  L  NGKL + +L +H  +  ++        ++L    ++++++ +S AW++   + S D +    +W + A ++L   D+  AI+++R +G+A MV +L  I+ IE+KNLL   I   L+ ++ A+  +L SS P  ALNMRRDLL W  AL LA+ + P +IP++S+EYA +LE  GD+ N++ NYE+G+  N  +      +L EH   C +GIARMAI+ GD +RGV +A+Q   R++ ++CA+ILEQ KQ  EA  L+E   ++++A    ++   W KVG+LL HV SPK+H+QY K  E E  YK AV  YE  +DYD+ +R+ L+ LN+P EAVR+V  + S EGA  VA+FF++LGD+ SAIQFLV+S+C  EA   A+++  +  YAK I     I     +A Y+ +  + ++A KFY  A QY  AI  L K    +D   V LA++   ++ D  L + LV++L+GE  N+ K+   LF++Y+ L + ++A +TA+++A+  Q  GNYR+A DLLF M Q+L++  ++IP +M+ +LM IHSYII K  I R + L  AR+LIR    I +FP+HVVPILTS+V+ C ++ L+ S+  +AA L+ P+YR +I  KY KK+E IVR+    ++  E  T CP C +L+    + C+ CKS + YCI +GRHI+  D   CP CE P   SE R L  LNE    C MC       +LK  +  D   YL+K  Q
Sbjct:   43 RPNGHTVAVACANNTVIYYDKKGNVIDALNPTGKLIDIAWDKEGDVLAIAVANTGTIYLWDVNSRNTDTVESGATSSKELPTCLAWSPSTPTLVIGNNAGNIVVYNHRTSRRIAVMGKHQRSVTQITVTPEDYVISCSDDNTLSVTTLEGTTVSTTTTNGEPTNMDYGSVNGKGGSGV--TMVSVVIGKKILMLAHYNALDEPVNLQFQEKYGNIHSYRWFNDGYILIGFDRGYIISISAHNNEIGSELVSFLEYRGYLASIAVSTSFNKLLTIGDNMVKVRDLDELTTVTMLTEIETEKNLSEIEVTEDGQLVAVSSQSGVLSIFVTKMPTLAAS--YNNSICYLTNLTQVTVVAEVEKKGSSTLELNIEPTVMGLGPLNLAVANNNTVFFYDYHTPAQMQAAQQLQSTQSAAEKPTIVAAEPINRVEYLSTVTNIQLNYMYAAVNFGSRLRLHRIRNSEDNVSIE------FPEANRN-ATLYSYALTENFLIFTTSNNYIVYFSLSEWAIVSEYRHVVPVRSIFPHPTNVVCCCFDDRLEAMIYSAVDDEVFRLPSVGSSAHYKGAIWETFTIDKNTFAV---------FDSQNIYV------------------FLLSK-------QHIQGESVIYVSATRLPHAYVPLSLNKGIVTCLMSNGKLSSVLLDSHKTESVISDKSETVIDDILT---RSLLMHRWSTAWKIC--IHSNDGS----HWNQFAMAALLDSDVGMAIKIFREIGDAAMVTALELIETIEEKNLLHAQIYTILSRYDDAEQLYLESSRPMEALNMRRDLLEWPKALVLAETMNPKEIPYLSKEYAQELELTGDHANSLANYEKGVMENPQNL----PELQEHNEICQSGIARMAIKTGDLRRGVQLAKQLEGRVVKRDCAIILEQMKQYTEAAQLYEVGLFYDRAAAVCLKANAWAKVGELLDHVKSPKIHIQYGKIMEKEKKYKVAVKCYETGRDYDNQVRLLLDPLNDPDEAVRVVRESRSIEGAKLVAKFFVKLGDYNSAIQFLVMSQCVQEAFELAEKNNAVREYAKAIEQHGNISQALELAEYYNRVNDMFMAAKFYTQAGQYNNAINLLFKNG--DDENCVALAVDCGIKSKDKTLNNKLVKFLLGEDGNV-KDPAQLFRLYVGLGRTKDAAQTAVVVAQIHQAKGNYRIARDLLFQMHQQLREKMMRIPLDMNKSLMAIHSYIIVKALINRKETLLAARLLIRTCGEIQRFPTHVVPILTSSVVICTQANLKKSAHKFAAQLMTPEYRPKIHEKYKKKIEDIVRKGGNQKDLVEENTPCPICDDLMPAYAMSCDNCKSLVPYCILTGRHIVASDFSRCPHCEMPGFYSEFRKLSILNEN---CYMC-----GGDLKGAIPEDAKAYLEKMEQ 1380          
BLAST of WD repeat domain 19 vs. Ensembl Celegans
Match: dyf-2 (WD repeat-containing protein dyf-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECZ4])

HSP 1 Score: 477.248 bits (1227), Expect = 4.424e-153
Identity = 250/588 (42.52%), Postives = 366/588 (62.24%), Query Frame = 2
Query: 2501 LEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQE-EEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNL--LNEPNSVCPMCSEPVSANELKMIL--DITEYLQKFNQ 4249
            + P +IP++S+EYA +LE  GD+ N++ NYE+G+  N  +      +L EH   C +GIARMAI+ GD +RGV +A+Q   R++ ++CA+ILEQ KQ  EA  L+E   ++++A    ++   W KVG+LL HV SPK+H+QY K  E E  YK AV  YE  +DYD+ +R+ L+ LN+P EAVR+V  + S EGA  VA+FF++LGD+ SAIQFLV+S+C  EA   A+++  +  YAK I     I     +A Y+ +  + ++A KFY  A QY  AI  L K    +D   V LA++   ++ D  L + LV++L+GE  N+ K+   LF++Y+ L + ++A +TA+++A+  Q  GNYR+A DLLF M Q+L++  ++IP +M+ +LM IHSYII K  I R + L  AR+LIR    I +FP+HVVPILTS+V+ C ++ L+ S+  +AA L+ P+YR +I  KY KK+E IVR+    ++  E  T CP C +L+    + C+ CKS + YCI +GRHI+  D   CP CE P   SE R L  LNE    C MC       +LK  +  D   YL+K  Q
Sbjct:    1 MNPKEIPYLSKEYAQELELTGDHANSLANYEKGVMENPQNL----PELQEHNEICQSGIARMAIKTGDLRRGVQLAKQLEGRVVKRDCAIILEQMKQYTEAAQLYEVGLFYDRAAAVCLKANAWAKVGELLDHVKSPKIHIQYGKIMEKEKKYKVAVKCYETGRDYDNQVRLLLDPLNDPDEAVRVVRESRSIEGAKLVAKFFVKLGDYNSAIQFLVMSQCVQEAFELAEKNNAVREYAKAIEQHGNISQALELAEYYNRVNDMFMAAKFYTQAGQYNNAINLLFKNG--DDENCVALAVDCGIKSKDKTLNNKLVKFLLGEDGNV-KDPAQLFRLYVGLGRTKDAAQTAVVVAQIHQAKGNYRIARDLLFQMHQQLREKMMRIPLDMNKSLMAIHSYIIVKALINRKETLLAARLLIRTCGEIQRFPTHVVPILTSSVVICTQANLKKSAHKFAAQLMTPEYRPKIHEKYKKKIEDIVRKGGNQKDLVEENTPCPICDDLMPAYAMSCDNCKSLVPYCILTGRHIVASDFSRCPHCEMPGFYSEFRKLSILNEN---CYMC-----GGDLKGAIPEDAKAYLEKMEQ 573          
BLAST of WD repeat domain 19 vs. Ensembl Celegans
Match: dyf-2 (WD repeat-containing protein dyf-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECZ4])

HSP 1 Score: 477.248 bits (1227), Expect = 4.424e-153
Identity = 250/588 (42.52%), Postives = 366/588 (62.24%), Query Frame = 2
Query: 2501 LEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQE-EEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNL--LNEPNSVCPMCSEPVSANELKMIL--DITEYLQKFNQ 4249
            + P +IP++S+EYA +LE  GD+ N++ NYE+G+  N  +      +L EH   C +GIARMAI+ GD +RGV +A+Q   R++ ++CA+ILEQ KQ  EA  L+E   ++++A    ++   W KVG+LL HV SPK+H+QY K  E E  YK AV  YE  +DYD+ +R+ L+ LN+P EAVR+V  + S EGA  VA+FF++LGD+ SAIQFLV+S+C  EA   A+++  +  YAK I     I     +A Y+ +  + ++A KFY  A QY  AI  L K    +D   V LA++   ++ D  L + LV++L+GE  N+ K+   LF++Y+ L + ++A +TA+++A+  Q  GNYR+A DLLF M Q+L++  ++IP +M+ +LM IHSYII K  I R + L  AR+LIR    I +FP+HVVPILTS+V+ C ++ L+ S+  +AA L+ P+YR +I  KY KK+E IVR+    ++  E  T CP C +L+    + C+ CKS + YCI +GRHI+  D   CP CE P   SE R L  LNE    C MC       +LK  +  D   YL+K  Q
Sbjct:    1 MNPKEIPYLSKEYAQELELTGDHANSLANYEKGVMENPQNL----PELQEHNEICQSGIARMAIKTGDLRRGVQLAKQLEGRVVKRDCAIILEQMKQYTEAAQLYEVGLFYDRAAAVCLKANAWAKVGELLDHVKSPKIHIQYGKIMEKEKKYKVAVKCYETGRDYDNQVRLLLDPLNDPDEAVRVVRESRSIEGAKLVAKFFVKLGDYNSAIQFLVMSQCVQEAFELAEKNNAVREYAKAIEQHGNISQALELAEYYNRVNDMFMAAKFYTQAGQYNNAINLLFKNG--DDENCVALAVDCGIKSKDKTLNNKLVKFLLGEDGNV-KDPAQLFRLYVGLGRTKDAAQTAVVVAQIHQAKGNYRIARDLLFQMHQQLREKMMRIPLDMNKSLMAIHSYIIVKALINRKETLLAARLLIRTCGEIQRFPTHVVPILTSSVVICTQANLKKSAHKFAAQLMTPEYRPKIHEKYKKKIEDIVRKGGNQKDLVEENTPCPICDDLMPAYAMSCDNCKSLVPYCILTGRHIVASDFSRCPHCEMPGFYSEFRKLSILNEN---CYMC-----GGDLKGAIPEDAKAYLEKMEQ 573          
BLAST of WD repeat domain 19 vs. Ensembl Celegans
Match: osm-1 (Intraflagellar transport protein osm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q22830])

HSP 1 Score: 56.225 bits (134), Expect = 1.998e-7
Identity = 123/533 (23.08%), Postives = 205/533 (38.46%), Query Frame = 2
Query: 2135 FHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLA------------GYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDE-------IGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPK---------LHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHY---VAQFFIRLGDFASAIQFLVLSKCHSEA-LHFAQEHGQMETY---AKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMY-------MALKQYREAG--RTAILIAKD-EQGNGNYRMA 3598
            F  A+    F  A    E  TS   A S   W  +A+ +L+  ++  A R Y  + +   V  L  I  I D+  ++              +A+    F  A+  FL  +   +A+ M   L  WD AL+LAK L   +   +   Y   L   G    A       L  +DGD        I  NK LS                L       ++++  N   ++++ A  L +++   +AG ++EK + F+KA+  + +   + K  QL +     K         LHL+Y       G Y  AV  +  A D    +   +     PK    + N  + K    Y   +A  +   GDF  A +  V +   ++A + + + +  ++ +    +  G +ATI  Y   A   ++H     A + Y+      KAI+   +V                GR +DD L   LVE   GE+  + +  K     Y        A +Q+ +AG  R+A+ + KD E  +  YR+A
Sbjct:  593 FGAALEKRDFDRAVAFLESNTSGTDAYSM--WIRVAEMALEHGNLFVAQRCYAAINDVAKVRKLHDILEIADEASISIGGDGTHFYKVRAMLAIMGRKFKEAERIFLEQNDTESAIGMYTSLHKWDEALELAKVLNYPEYEQLKTSYLRALSDTGQDSKAA-----ELKVSDGDTLSAIQLYIKSNKPLSA---------------LSAANNDSVLSQDEN---ILRQIADSLVKSQLYDKAGDVYEKLKDFDKAVEYFKKGDAYGKAIQLARFAFPEKVVTLEQEWGLHLEYI------GQYDAAVNHFVEANDLKKAVEAAIRAKEWPKALSIVENIQDQKVRTGYYGEIADHYSNKGDFERAERLFVEAGLFNDAIMMYGKNNKWIDAFRLSEEFHGREATISSYLAKAEDLDEHGRFAEAEQLYITIGMPHKAIQMYDRV----------------GR-DDDVLR--LVERYHGEH--MHETRKRFATQYEERGDLKAAEEQFLKAGDFRSAVNMYKDSEMWSDAYRIA 1073          
BLAST of WD repeat domain 19 vs. Ensembl Fly
Match: Oseg6 (gene:FBgn0034452 transcript:FBtr0086501)

HSP 1 Score: 998.038 bits (2579), Expect = 0.000e+0
Identity = 527/1402 (37.59%), Postives = 841/1402 (59.99%), Query Frame = 2
Query:  110 VNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNS-RKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKV---LPIELEPKFIGVGASHLGVGMNNQVWYY---RENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMI--ENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERG----LCNNDGDEIGGNKDLS----EHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIG--SDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYV--EDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDK-----TQEEEPKT-ECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYL 4234
            V F WQK     LA  G++  V++Y+R G LV +I L G C    WDQ+GD+L II + SP + LWD +  +   +ETG +D L+ + WSK Q  LAVGT +GNL +YNH +  R  P+LGKHSK+ITCGAWS + LLALGSED++F+LSN++G+T++ V LRD P+++ F+E+  DE+ +   N ++  +  +TLFL+ L + ENP E+ FQ +YG+++ +KWFGDGYI++GFS+G++V ISTH K++GQE+ Q++++KD+L  +    +L    + GD  +KIH +  L+E   II + +    +  +WS DGQLLA++T  G V++++T+LP L +V  S  +I  L+SL EVS+     + +  +   LP+E EP F+ VG  +   G+   VW+Y   +   E    +SE+++ ++V  ++LN  Y AA    +++LQ I  +N    D  +       P  P     IT F L+   LIF+TD G+L  + +E W+  + ++H  GI ++F +  GT ++FID+ S  + + P+ EE + I + P      LWD        I +  D ++         VNT                     ++  ++ +G  T    ++G +K   G  PL L  G++ L    G+  T  L TH    + ++  +++           + +  + EA++L +++        +  W+E  + ++  L+ D AIR YR+LG+A +V +L +++++ED ++L G     L  ++ A++  L      AAL++ RDLL WD AL LA   +P ++P+I+REYA QLEF G+Y +A+ +YE+G    L N+   E     D S    EH+  C  GIAR +IR GD +RG+  A +  ++ L+ +CA +L     + EA  L+E+  ++++A   YI LK WNK   +L  V S KLH  YAKA+E +G Y+EA+ SY +A D D+ +R+ L+HL +P  A  IV  + S + A  +A+F+ ++GD   A+QFLV+  C  EA   AQ H ++  + +++    +A   DY  +A YFE  K   LAGK+Y LA ++ KA++ LLK +    E+  ++ LAI+ +  +N+++L   L+E+L+GE D +PK+ +YLF++YMA K Y++A +TA++IA  EQ  GNY+ A DLL+SM QEL++NN+ + +EM    +L+H Y + ++H+K G+HL  A++L++VA  IS+FP H++PILTSTVIECHR+GL+ S+F+YA+ L+RPDYR+Q+DP+Y KK+E+IVR+  K       E + +T ECP C + +    + C  CK+++  CIA+G+HII+     CP+C+F    +E+ N+L+E N  CPMC E V+  +L  + DI  Y+
Sbjct:   19 VYFIWQKA---LLATTGTDGSVALYNRQGQLVQRIILSGLCSGFAWDQEGDLLGIITSGSPNITLWDYNSQEKISVETGLRDPLTCILWSKQQQLLAVGTGRGNLAIYNHSSGKRPTPVLGKHSKRITCGAWSAQNLLALGSEDKSFSLSNEDGDTVRVVQLRDAPTDMYFAEMANDERIAGD-NAISMIIGKRTLFLYYLPEPENPTELGFQSRYGSLMQHKWFGDGYILLGFSNGHVVAISTHPKDVGQELWQVKNHKDSLTGLAYCPTLDIVASCGDDSIKIHSITNLQETERIITVPDHAGVQMIDWSPDGQLLAVTTNHGTVYIYVTKLPHLFAV--SAPRIVLLSSLAEVSIYVYAPDKTKSLPFRLPLEGEPTFMAVGPYNFATGIEKHVWFYDLGKSLGEEPRPLSERDFPRSVESMKLNADYCAALCPPQLILQAIAADNPNCKDKLQAVFPTALPNMPSD-AVITCFALSQELLIFATDIGHLVFYSLEKWDSCTIYRHSMGIRQLFMDIEGTKVIFIDDHSQGYVFLPVVEEALLIPDIPKQCLGCLWDLTQPN---IFISYDARI---------VNTH--------------------VFVRHSVQGTHTL---MVGESKLNPGQFPLLLCGGEMALHIDGGQYATQSLSTHVVNPSNSQAANLQ---------MLLKLRNYDEAYKLCKQMNQ------SSAWREFGEQAISDLEPDIAIRAYRQLGDAALVNALSELRYVEDLDMLIGCCCTLLAQYDQAKEHMLKGVYTRAALDLCRDLLQWDQALLLAHKNDPQEVPYIAREYAQQLEFNGNYTDALYHYEKGYKEDLINSKETETDALMDSSPEYEEHVRLCKMGIARTSIRAGDFRRGIQYAVELEDQQLLFDCAELLATVGHLTEAAGLYERGGFYDEACGHYIALKMWNKANNILPKVKSTKLHAAYAKAKENDGHYEEAIRSYRIAGDLDACVRIYLDHLCDPHAASEIVLESRSMDSAKLLAKFYQKIGDVEQALQFLVICGCVEEAFALAQRHNKLRRHGELLERYENAKSSDYLALAHYFEGEKYTLLAGKYYFLAREFTKALRFLLKASAFNNEEQVSLSLAIDCVATSNNEQLATQLIEFLLGEVDGVPKDPRYLFRLYMARKHYKDAAKTAVIIANQEQIAGNYKSARDLLYSMYQELRRNNLSVTAEMRHQFILLHRYTLVRIHVKLGNHLLAAKLLVQVAACISQFPEHIIPILTSTVIECHRAGLKKSAFTYASTLMRPDYRNQLDPRYAKKIESIVRKAPKGIKQLRDEIDGETMECPICDSNLANMEVTCYSCKTTLPICIATGQHIIKQLMTSCPQCDFLCFRAEMENILSE-NGECPMCGENVAPEQLLDVEDIRPYI 1362          
BLAST of WD repeat domain 19 vs. Ensembl Zebrafish
Match: wdr19 (WD repeat domain 19 [Source:ZFIN;Acc:ZDB-GENE-090313-277])

HSP 1 Score: 1491.48 bits (3860), Expect = 0.000e+0
Identity = 730/1393 (52.40%), Postives = 987/1393 (70.85%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDED--GEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYF-HQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQK 4240
            VFT+ E+      + ++WQKT GNYLA+ G +  V I+DRHG  VN++NL G CV LDWD+ GD+LA+I  KS +VYLWD +++K S++++G +D +SF+ WSK    LAVGTSKGNLL+YN   SRK+P+LGKH+KKITCG WS + LLALGSEDR+ T+SN EG+TI+Q  +R  P+++QFS +K DE+SS  ++T++  L  +TLFLF L D +NP E+AFQ++YGNI+ Y+W+GDGYIM+GFSHGY VVISTH +EIGQE+ Q  ++KD+L SI IS+SL++A + GD C+KIHDL  LKE+ AI+ LDE+  G  + C W++DGQLLA+S+  G +HVFLT+LP+L   D SGT+IA+LTSL EV+V N     S   + +E+EP FI VG  H+ VGMNN+ W+Y         V + EY+ TV  + LN  Y+AA F+GK+ L +I+   E   +E +  KLFPE P     I S  LTS+FL + TD G +  F+ EDW   +E++H  G+ K+F +  GT ++FID KS+ F Y P+ + V EI +F      VLW+       + +   +DK+YTY   + + +T +G                              +K+ L+G TK PF H PL L NG++    Q+GK+ + VL THAF   LN   S   K+ LQ F  QA+M+  FS+AW + + L S      +E W EL ++ L  ++++ AIRVYR +GN GMV SL  IK IED+NLLAG++AMF ND+N AQD +L SS P AAL MRRDL HWDSALQLAK L+P +IPFIS+EYA QLEF+GDYVNA+ +YE+G          GN    +H  SC  G+ARM+IR+GD +RG   A +  ++ L K+C  ILE  KQ +EA  L+EK QY++KA + YIR KNW KVG+LL HV+SPK+HLQYAKA+EA+G YKEA  +YE A+D+D+VIR+ LEHLNNP+EAVRIV  T+S EGA  VA+FF+RL D+ SAIQFLVLS+C  EA   AQ+HGQME YA IIGS+ATIEDYQ+IA YFE  KNH  AGKF+    QY +A+KH LK    +DS A+++AIEA+G A D+ LT+ L+++LMGE D +PK+ KYLF++YMALKQYREA RTAI+IA++EQ  GNYR AHD+LFSM  EL+  +IKIP+EM++NLM++HSYI+ K+H+KRGDHL+GARMLIRV+ +ISKFPSH+VPILTS VIECHR+GLR+S+FS+A+ML+RP+YR++ID KY KK+E +VRRPD ++ EE  + CP+C   + +  L C  CK+++ YCIA+GRH++++D  +CP C+FPA+ S+   LL E  SVCPMCSE ++ +E+K +L+ ++YLQ+
Sbjct:    4 VFTLSEKSWSGSCLQYKWQKTVGNYLAVAGPDNLVKIFDRHGQKVNELNLPGNCVSLDWDKDGDILAVIAEKSSSVYLWDANVNKTSQLDSGMRDQMSFLLWSKTGPLLAVGTSKGNLLIYNQQTSRKIPVLGKHTKKITCGCWSSQNLLALGSEDRSITISNHEGDTIRQTSVRADPADVQFSVMKTDERSSPGQSTVSVALGKKTLFLFNLNDPDNPIELAFQQRYGNIISYRWYGDGYIMIGFSHGYFVVISTHIREIGQELFQAHNHKDSLTSIAISQSLNKAASCGDNCIKIHDLTDLKEMYAIVTLDEETKGLDQMC-WTDDGQLLAVSSQQGTLHVFLTKLPILG--DSSGTRIAYLTSLLEVTVANPVEGESPVPVAVEVEPSFIAVGPYHVAVGMNNRAWFYALGDSGVERVKDTEYLGTVASMCLNCDYAAALFEGKLQLHVIDGD-EQVVQEDRQTKLFPE-PDQKYRILSHALTSDFLYYGTDTGLIQCFYFEDWQSVTEYRHTVGVRKVFPDPNGTRLVFIDEKSDGFLYCPVNDSVFEIPDFSPAIKGVLWENWISSKGVFVAYEEDKVYTY---AFHKDTIQG------------------------------SKVILVGGTKLPFSHKPLLLHNGELTCQTQSGKINSVVLNTHAF---LNNQHSESSKDKLQSFLQQAVMLKRFSDAWSICKALNS------SEAWGELGRACLHHMEVELAIRVYRMMGNVGMVMSLEDIKGIEDQNLLAGHLAMFCNDYNRAQDLYLTSSYPMAALEMRRDLQHWDSALQLAKRLDPDEIPFISKEYAIQLEFVGDYVNALAHYEKG--------TTGNNKFQDHDESCLAGVARMSIRMGDIRRGANQAIKHPSKALKKDCGAILESMKQYSEAAQLYEKGQYYDKAASVYIRCKNWAKVGELLPHVTSPKIHLQYAKAKEADGKYKEAAMAYESARDWDNVIRILLEHLNNPEEAVRIVRETHSIEGAKMVARFFLRLSDYGSAIQFLVLSRCSDEAFQLAQQHGQMEVYADIIGSEATIEDYQSIALYFEGEKNHLQAGKFFQKCGQYSRALKHFLKCPSSDDSVAIEMAIEAVGEAKDESLTNQLIDHLMGESDGMPKDAKYLFRLYMALKQYREAARTAIIIAREEQSAGNYRNAHDVLFSMYAELQTQHIKIPAEMATNLMILHSYILVKIHVKRGDHLKGARMLIRVSNNISKFPSHIVPILTSAVIECHRAGLRNSAFSFASMLMRPEYRNKIDLKYKKKIEAMVRRPDTSEVEEESSPCPYCGFSLPDCELLCPGCKNNLPYCIATGRHMVKEDWCVCPHCDFPALHSQFTQLL-ETESVCPMCSEALNVSEVKKVLECSKYLQQ 1340          
BLAST of WD repeat domain 19 vs. Ensembl Zebrafish
Match: wdr19 (WD repeat domain 19 [Source:ZFIN;Acc:ZDB-GENE-090313-277])

HSP 1 Score: 1491.09 bits (3859), Expect = 0.000e+0
Identity = 732/1393 (52.55%), Postives = 988/1393 (70.93%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDED--GEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYF-HQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQK 4240
            VFT+ E+      + ++WQKT GNYLA+ G +  V I+DRHG  VN++NL G CV LDWD+ GD+LA+I  KS +VYLWD +++K S++++G +D +SF+ WSK    LAVGTSKGNLL+YN   SRK+P+LGKH+KKITCG WS + LLALGSEDR+ T+SN EG+TI+Q  +R  P+++QFS +K DE+SS  ++T++  L  +TLFLF L D +NP E+AFQ++YGNI+ Y+W+GDGYIM+GFSHGY VVISTH +EIGQE+ Q  ++KD+L SI IS+SL++A + GD C+KIHDL  LKE+ AI+ LDE+  G  + C W++DGQLLA+S+  G +HVFLT+LP+L   D SGT+IA+LTSL EV+V N     S   + +E+EP FI VG  H+ VGMNN+ W+Y         V + EY+ TV  + LN  Y+AA F+GK+ L +I+   E   +E +  KLFPE P     I S  LTS+FL + TD G +  F+ EDW   +E++H  G+ K+F +  GT ++FID KS+ F Y P+ + V EI +F      VLW+       + +   +DK+YTY   + + +T +G                              +K+ L+G TK PF H PL L NG++    Q+GK+ + VL THAF   LN   S   K+ LQ F  QA+M+  FS+AW + + L S      +E W EL ++ L  ++++ AIRVYR +GN GMV SL  IK IED+NLLAG++AMF ND+N AQD +L SS P AAL MRRDL HWDSALQLAK L+P +IPFIS+EYA QLEF+GDYVNA+ +YE+G         G NKD   H  SC  G+ARM+IR+GD +RG   A +  ++ L K+C  ILE  KQ +EA  L+EK QY++KA + YIR KNW KVG+LL HV+SPK+HLQYAKA+EA+G YKEA  +YE A+D+D+VIR+ LEHLNNP+EAVRIV  T+S EGA  VA+FF+RL D+ SAIQFLVLS+C  EA   AQ+HGQME YA IIGS+ATIEDYQ+IA YFE  KNH  AGKF+    QY +A+KH LK    +DS A+++AIEA+G A D+ LT+ L+++LMGE D +PK+ KYLF++YMALKQYREA RTAI+IA++EQ  GNYR AHD+LFSM  EL+  +IKIP+EM++NLM++HSYI+ K+H+KRGDHL+GARMLIRV+ +ISKFPSH+VPILTS VIECHR+GLR+S+FS+A+ML+RP+YR++ID KY KK+E +VRRPD ++ EE  + CP+C   + +  L C  CK+++ YCIA+GRH++++D  +CP C+FPA+ S+   LL E  SVCPMCSE ++ +E+K +L+ ++YLQ+
Sbjct:   33 VFTLSEKSWSGSCLQYKWQKTVGNYLAVAGPDNLVKIFDRHGQKVNELNLPGNCVSLDWDKDGDILAVIAEKSSSVYLWDANVNKTSQLDSGMRDQMSFLLWSKTGPLLAVGTSKGNLLIYNQQTSRKIPVLGKHTKKITCGCWSSQNLLALGSEDRSITISNHEGDTIRQTSVRADPADVQFSVMKTDERSSPGQSTVSVALGKKTLFLFNLNDPDNPIELAFQQRYGNIISYRWYGDGYIMIGFSHGYFVVISTHIREIGQELFQAHNHKDSLTSIAISQSLNKAASCGDNCIKIHDLTDLKEMYAIVTLDEETKGLDQMC-WTDDGQLLAVSSQQGTLHVFLTKLPILG--DSSGTRIAYLTSLLEVTVANPVEGESPVPVAVEVEPSFIAVGPYHVAVGMNNRAWFYALGDSGVERVKDTEYLGTVASMCLNCDYAAALFEGKLQLHVIDGD-EQVVQEDRQTKLFPE-PDQKYRILSHALTSDFLYYGTDTGLIQCFYFEDWQSVTEYRHTVGVRKVFPDPNGTRLVFIDEKSDGFLYCPVNDSVFEIPDFSPAIKGVLWENWISSKGVFVAYEEDKVYTY---AFHKDTIQG------------------------------SKVILVGGTKLPFSHKPLLLHNGELTCQTQSGKINSVVLNTHAF---LNNQHSESSKDKLQSFLQQAVMLKRFSDAWSICKALNS------SEAWGELGRACLHHMEVELAIRVYRMMGNVGMVMSLEDIKGIEDQNLLAGHLAMFCNDYNRAQDLYLTSSYPMAALEMRRDLQHWDSALQLAKRLDPDEIPFISKEYAIQLEFVGDYVNALAHYEKG-------TTGNNKD---HDESCLAGVARMSIRMGDIRRGANQAIKHPSKALKKDCGAILESMKQYSEAAQLYEKGQYYDKAASVYIRCKNWAKVGELLPHVTSPKIHLQYAKAKEADGKYKEAAMAYESARDWDNVIRILLEHLNNPEEAVRIVRETHSIEGAKMVARFFLRLSDYGSAIQFLVLSRCSDEAFQLAQQHGQMEVYADIIGSEATIEDYQSIALYFEGEKNHLQAGKFFQKCGQYSRALKHFLKCPSSDDSVAIEMAIEAVGEAKDESLTNQLIDHLMGESDGMPKDAKYLFRLYMALKQYREAARTAIIIAREEQSAGNYRNAHDVLFSMYAELQTQHIKIPAEMATNLMILHSYILVKIHVKRGDHLKGARMLIRVSNNISKFPSHIVPILTSAVIECHRAGLRNSAFSFASMLMRPEYRNKIDLKYKKKIEAMVRRPDTSEVEEESSPCPYCGFSLPDCELLCPGCKNNLPYCIATGRHMVKEDWCVCPHCDFPALHSQFTQLL-ETESVCPMCSEALNVSEVKKVLECSKYLQQ 1367          
BLAST of WD repeat domain 19 vs. Ensembl Zebrafish
Match: BX005212.1 (WD repeat domain 19 [Source:NCBI gene;Acc:556414])

HSP 1 Score: 1486.09 bits (3846), Expect = 0.000e+0
Identity = 730/1393 (52.40%), Postives = 988/1393 (70.93%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDED--GEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYF-HQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQK 4240
            VFT+ E+      + ++WQKT GNYLA+ G +  V I+DRHG  VN++ L G CV LDWD+ GD+LA+I  KS +VYLWD +++K S++++G +D +SF+ WSK    LAVGTSKGNLL+YN   SRK+P+LGKH+KKITCG WS + LLALGSEDR+ T+SN EG+TI+Q  +R  P+++QFS +K DE+SS  ++T++  L  +TLFLF L D +NP E+AFQ++YGNI+ Y+W+GDGYIM+GFSHGY VVISTH +EIGQE+ Q  ++KD+L SI IS+SL++A + GD C+KIHDL  LKE+ AI+ LDE+  G  + C W++DGQLLA+S+  G +HVFLT+LP+L   D SGT+IA+LTSL EV+V N     S   + +E+EP FI VG  H+ VGMNN+ W+Y         V + EY+ TV  + LN  Y+AA F+GK+ L +I+   E   +E +  KLFPE P     I S  LTS+FL + TD G +  F+ EDW   +E++H  G+ K+F +  GT ++FID KS+ F Y P+ + V EI +F      VLW+       + +   +DK+YTY   + + +T +G                              +K+ L+G TK PF H PL L NG++    Q+GK+ + VL THAF   LN   S   K+ LQ F  QA+M+  FS+AW + + L S      +E W EL ++ L  ++++ AIRVYR +GN GMV SL  IK IED+NLLAG++AMF ND+N AQD +L SS P AAL MRRDL HWDSALQLAK L+P +IPFIS+EYA QLEF+GDYVNA+ +YE+G         G NKD   H  SC  G+ARM+IR+GD +RG   A +  ++ L K+C  ILE  KQ +EA  L+EK QY++KA + YIR KNW KVG+LL +V+SPK+HLQYAKA+EA+G YKEA  +YE A+D+D+VIR+ LEHLNNP+EAVRIV  T+S EGA  VA+FF+RL D+ SAIQFLVLS+C  EA   AQ+HGQME YA IIGS+ATIEDYQ+IA YFE  KNH  AGKF+    QY +A+KH LK    +DS A+++AIEA+G A D+ LT+ L+++LMGE D +PK+ KYLF++YMALKQYREA RTAI+IA++EQ  GNYR AHD+LFSM  EL+  +IKIP+EM++NLM++HSYI+ K+H+KRGDHL+GARMLIRV+ +ISKFPSH+VPILTS VIECHR+GLR+S+FS+A+ML+RP+YR++ID KY KK+E +VRRPD ++ EE  + CP+C   + +  L C  CK+++ YCIA+GRH++++D  +CP+C+FPA+ S+   LL E  SVCPMCSE ++ +E+K +L+ ++YLQ+
Sbjct:   33 VFTLSEKSWSGSCLQYKWQKTVGNYLAVAGPDNLVKIFDRHGQKVNELILPGNCVSLDWDKDGDILAVIAEKSSSVYLWDANVNKTSQLDSGMRDQMSFLLWSKTGPLLAVGTSKGNLLIYNQQTSRKIPVLGKHTKKITCGCWSSQNLLALGSEDRSITISNHEGDTIRQTSVRADPADVQFSVMKTDERSSPGQSTVSVALGKKTLFLFNLNDPDNPIELAFQQRYGNIISYRWYGDGYIMIGFSHGYFVVISTHIREIGQELFQAHNHKDSLTSIAISQSLNKAASCGDNCIKIHDLTDLKEMYAIVTLDEETKGLDQMC-WTDDGQLLAVSSQQGTLHVFLTKLPILG--DSSGTRIAYLTSLLEVTVANPVEGESPVPVAVEVEPSFIAVGPYHVAVGMNNRAWFYALGDSGVERVKDTEYLGTVASMCLNCDYAAALFEGKLQLHVIDGD-EQVVQEDRQTKLFPE-PDQKYRILSHALTSDFLYYGTDTGLIQCFYFEDWQSVTEYRHTVGVRKVFPDPNGTRLVFIDEKSDGFLYCPVNDSVFEIPDFSPAIKGVLWENWISSKGVFVAYEEDKVYTY---AFHKDTIQG------------------------------SKVILVGGTKLPFSHKPLLLHNGELTCQTQSGKINSVVLNTHAF---LNNQHSESSKDKLQSFLQQAVMLKRFSDAWSICKALNS------SEAWGELGRACLHHMEVELAIRVYRMMGNVGMVMSLEDIKGIEDQNLLAGHLAMFCNDYNRAQDLYLTSSYPMAALEMRRDLQHWDSALQLAKRLDPDEIPFISKEYAIQLEFVGDYVNALAHYEKG-------TTGNNKD---HDESCLAGVARMSIRMGDIRRGANQAIKHPSKALKKDCGAILESMKQYSEAAQLYEKGQYYDKAASVYIRCKNWAKVGELLPNVTSPKIHLQYAKAKEADGKYKEAAMAYESARDWDNVIRILLEHLNNPEEAVRIVRETHSIEGAKMVARFFLRLSDYGSAIQFLVLSRCSDEAFQLAQQHGQMEVYADIIGSEATIEDYQSIALYFEGEKNHLQAGKFFQKCGQYSRALKHFLKCPSSDDSVAIEMAIEAVGEAKDESLTNQLIDHLMGESDGMPKDAKYLFRLYMALKQYREAARTAIIIAREEQSAGNYRNAHDVLFSMYAELQTQHIKIPAEMATNLMILHSYILVKIHVKRGDHLKGARMLIRVSNNISKFPSHIVPILTSAVIECHRAGLRNSAFSFASMLMRPEYRNKIDLKYKKKIEAMVRRPDTSEVEEESSPCPYCGFSLPDCELLCPGCKNNLPYCIATGRHMVKEDWCVCPQCDFPALHSQFTQLL-ETESVCPMCSEALNVSEVKKVLECSKYLQQ 1367          
BLAST of WD repeat domain 19 vs. Ensembl Zebrafish
Match: wdr19 (WD repeat domain 19 [Source:ZFIN;Acc:ZDB-GENE-090313-277])

HSP 1 Score: 807.749 bits (2085), Expect = 0.000e+0
Identity = 415/851 (48.77%), Postives = 567/851 (66.63%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDED--GEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYF-HQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNND 2614
            VFT+ E+      + ++WQKT GNYLA+ G +  V I+DRHG  VN++NL G CV LDWD+ GD+LA+I  KS +VYLWD +++K S++++G +D +SF+ WSK    LAVGTSKGNLL+YN   SRK+P+LGKH+KKITCG WS + LLALGSEDR+ T+SN EG+TI+Q  +R  P+++QFS +K DE+SS  ++T++  L  +TLFLF L D +NP E+AFQ++YGNI+ Y+W+GDGYIM+GFSHGY VVISTH +EIGQE+ Q  ++KD+L SI IS+SL++A + GD C+KIHDL  LKE+ AI+ LDE+  G  + C W++DGQLLA+S+  G +HVFLT+LP+L   D SGT+IA+LTSL EV+V N     S   + +E+EP FI VG  H+ VGMNN+ W+Y         V + EY+ TV  + LN  Y+AA F+GK+ L +I+   E   +E +  KLFPE P     I S  LTS+FL + TD G +  F+ EDW   +E++H  G+ K+F +  GT ++FID KS+ F Y P+ + V EI +F      VLW+       + +   +DK+YTY   + + +T +G                              +K+ L+G TK PF H PL L NG++    Q+GK+ + VL THAF   LN   S   K+ LQ F  QA+M+  FS+AW + + L       S+E W EL ++ L  ++++ AIRVYR +GN GMV SL  IK IED+NLLAG++AMF ND+N AQD +L SS P AAL MRRDL HWDSALQLAK L+P +IPFIS+EYA QLEF+GDYVNA+ +YE+G   N+
Sbjct:   33 VFTLSEKSWSGSCLQYKWQKTVGNYLAVAGPDNLVKIFDRHGQKVNELNLPGNCVSLDWDKDGDILAVIAEKSSSVYLWDANVNKTSQLDSGMRDQMSFLLWSKTGPLLAVGTSKGNLLIYNQQTSRKIPVLGKHTKKITCGCWSSQNLLALGSEDRSITISNHEGDTIRQTSVRADPADVQFSVMKTDERSSPGQSTVSVALGKKTLFLFNLNDPDNPIELAFQQRYGNIISYRWYGDGYIMIGFSHGYFVVISTHIREIGQELFQAHNHKDSLTSIAISQSLNKAASCGDNCIKIHDLTDLKEMYAIVTLDEETKGLDQMC-WTDDGQLLAVSSQQGTLHVFLTKLPILG--DSSGTRIAYLTSLLEVTVANPVEGESPVPVAVEVEPSFIAVGPYHVAVGMNNRAWFYALGDSGVERVKDTEYLGTVASMCLNCDYAAALFEGKLQLHVIDGD-EQVVQEDRQTKLFPE-PDQKYRILSHALTSDFLYYGTDTGLIQCFYFEDWQSVTEYRHTVGVRKVFPDPNGTRLVFIDEKSDGFLYCPVNDSVFEIPDFSPAIKGVLWENWISSKGVFVAYEEDKVYTY---AFHKDTIQG------------------------------SKVILVGGTKLPFSHKPLLLHNGELTCQTQSGKINSVVLNTHAF---LNNQHSESSKDKLQSFLQQAVMLKRFSDAWSICKAL------NSSEAWGELGRACLHHMEVELAIRVYRMMGNVGMVMSLEDIKGIEDQNLLAGHLAMFCNDYNRAQDLYLTSSYPMAALEMRRDLQHWDSALQLAKRLDPDEIPFISKEYAIQLEFVGDYVNALAHYEKGTTGNN 836          
BLAST of WD repeat domain 19 vs. Ensembl Zebrafish
Match: BX005212.1 (WD repeat domain 19 [Source:NCBI gene;Acc:556414])

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 414/851 (48.65%), Postives = 566/851 (66.51%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDED--GEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYF-HQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNND 2614
            VFT+ E+      + ++WQKT GNYLA+ G +  V I+DRHG  VN++ L G CV LDWD+ GD+LA+I  KS +VYLWD +++K S++++G +D +SF+ WSK    LAVGTSKGNLL+YN   SRK+P+LGKH+KKITCG WS + LLALGSEDR+ T+SN EG+TI+Q  +R  P+++QFS +K DE+SS  ++T++  L  +TLFLF L D +NP E+AFQ++YGNI+ Y+W+GDGYIM+GFSHGY VVISTH +EIGQE+ Q  ++KD+L SI IS+SL++A + GD C+KIHDL  LKE+ AI+ LDE+  G  + C W++DGQLLA+S+  G +HVFLT+LP+L   D SGT+IA+LTSL EV+V N     S   + +E+EP FI VG  H+ VGMNN+ W+Y         V + EY+ TV  + LN  Y+AA F+GK+ L +I+   E   +E +  KLFPE P     I S  LTS+FL + TD G +  F+ EDW   +E++H  G+ K+F +  GT ++FID KS+ F Y P+ + V EI +F      VLW+       + +   +DK+YTY   + + +T +G                              +K+ L+G TK PF H PL L NG++    Q+GK+ + VL THAF   LN   S   K+ LQ F  QA+M+  FS+AW + + L       S+E W EL ++ L  ++++ AIRVYR +GN GMV SL  IK IED+NLLAG++AMF ND+N AQD +L SS P AAL MRRDL HWDSALQLAK L+P +IPFIS+EYA QLEF+GDYVNA+ +YE+G   N+
Sbjct:   33 VFTLSEKSWSGSCLQYKWQKTVGNYLAVAGPDNLVKIFDRHGQKVNELILPGNCVSLDWDKDGDILAVIAEKSSSVYLWDANVNKTSQLDSGMRDQMSFLLWSKTGPLLAVGTSKGNLLIYNQQTSRKIPVLGKHTKKITCGCWSSQNLLALGSEDRSITISNHEGDTIRQTSVRADPADVQFSVMKTDERSSPGQSTVSVALGKKTLFLFNLNDPDNPIELAFQQRYGNIISYRWYGDGYIMIGFSHGYFVVISTHIREIGQELFQAHNHKDSLTSIAISQSLNKAASCGDNCIKIHDLTDLKEMYAIVTLDEETKGLDQMC-WTDDGQLLAVSSQQGTLHVFLTKLPILG--DSSGTRIAYLTSLLEVTVANPVEGESPVPVAVEVEPSFIAVGPYHVAVGMNNRAWFYALGDSGVERVKDTEYLGTVASMCLNCDYAAALFEGKLQLHVIDGD-EQVVQEDRQTKLFPE-PDQKYRILSHALTSDFLYYGTDTGLIQCFYFEDWQSVTEYRHTVGVRKVFPDPNGTRLVFIDEKSDGFLYCPVNDSVFEIPDFSPAIKGVLWENWISSKGVFVAYEEDKVYTY---AFHKDTIQG------------------------------SKVILVGGTKLPFSHKPLLLHNGELTCQTQSGKINSVVLNTHAF---LNNQHSESSKDKLQSFLQQAVMLKRFSDAWSICKAL------NSSEAWGELGRACLHHMEVELAIRVYRMMGNVGMVMSLEDIKGIEDQNLLAGHLAMFCNDYNRAQDLYLTSSYPMAALEMRRDLQHWDSALQLAKRLDPDEIPFISKEYAIQLEFVGDYVNALAHYEKGTTGNN 836          
BLAST of WD repeat domain 19 vs. Ensembl Xenopus
Match: cdk8 (cyclin-dependent kinase 8 [Source:Xenbase;Acc:XB-GENE-962267])

HSP 1 Score: 1384.78 bits (3583), Expect = 0.000e+0
Identity = 696/1392 (50.00%), Postives = 942/1392 (67.67%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEA-KKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDAT-IEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQK 4240
            VF++ E+    + +++ WQ+  GNY+A+ G +  V IYDRHG   ++INL G C  LDWD+ G+ LA++ +KS ++Y+WD +  K S++++G +D +SF+ WSK  + LAVGTSKG+LL+YN   SRKVP+LGKH+K++TCG WS + LLALGSED+  T+SN EG+TI+Q  +R  PS+IQFS +K DE++S  E+T++  +  +TLFLF L D +NP E+AFQ +YGNIV +KW+GDGYIM+GFSHG+ VVISTH +EIGQE+ Q  ++KD+L SI IS+SL +A + GD  +KIHDL  LKE+ AII LD++ +     +W++DGQLLA+ST  G ++VFLT+LP+L   D  GTKIA+LTSL EV+V N  +      + +E+EP F+ VG  H+ VGMNN+ W+Y         +++ EY+ +VTK+ LN  Y+AA F+GK+ L +IE S + D +E +  +LFP      + I    LT  FLI++T+ G +  F++EDW Y +E++H   I KIF +  GT ++ ID K+  F Y PL + + EI  F      +LW+    +  + +   DDKLYTY                              ++  +  +G   +K+ L G TK PF H P+ L NGD+I   Q+GKL    LGTH+F   +  L                         +L E++          NW ELA++ L  ++++FAIRVYR +GN GMV SL +IK IED NLLAG++AMF  DFNLAQD +L SSSP AAL MRRDL HWDSALQLAK L P+QI FIS+EYA QLEF GDYVNA+ +YE+G        I G+    EH  +C  G+ARM+IR+GD +RGV  A +  +R L K+C  ILE  KQ+ EA  L+EK QYF+KA + YIR KNW KVG+LL HVSSPK+HLQYAKA+EA+G YKEAV +YE AKD+D+VIR                     ++G  Y+  FF++LGD+ SAIQFLVLSKC+ EA   AQ+H QME YA IIGS+ T  EDYQ+IA YFE  K H+ AGKF+LL  QYE+A+KH +K    ED+ A+++AIE +GRA D+ LT+ L++YLMGE D +PK+ KYLF++YMALKQYREA RTAI+IA++EQ  GNYR AHD+LFSM  ELK   IKIP+EM++NLM++HSYI+ K+H+KRGDH++GARMLIRVA +ISKFPSH+VPILTSTVIECHR+GL++S+FS+AAML+RP+YR++ID KY KK+E +VRR D T+ +E  T CPFC   + E  L C  CK+++ YCIA+GRH+++++   C  C F A+ SE   LL E  S CPMCSEPVSA +L  + D TEYL++
Sbjct:    4 VFSLTEKSLLGYPIHYAWQRNLGNYIAVTGVDHTVKIYDRHGQKKDEINLPGVCFALDWDKDGNALAMVADKSSSIYMWDPNTCKTSQLDSGMRDQMSFLLWSKAGSLLAVGTSKGSLLMYNLQTSRKVPVLGKHTKRVTCGCWSSQNLLALGSEDKMITVSNQEGDTIRQTSVRMDPSDIQFSVMKTDERASAGESTVSVVVGKKTLFLFNLNDPDNPIELAFQPRYGNIVSHKWYGDGYIMIGFSHGFFVVISTHMREIGQELFQAHNHKDSLTSIAISQSLGKAASCGDNVIKIHDLTELKEMYAIINLDDETKGLDTLSWTDDGQLLAVSTQRGSLNVFLTKLPVLG--DTCGTKIAYLTSLLEVTVANSVDGELPITVSVEVEPNFVAVGQYHVAVGMNNRAWFYALTQNGVEKLTDMEYLGSVTKMCLNSDYAAALFEGKVQLHVIE-SKDEDAQEERETRLFPASDDKCK-ILCHALTGEFLIYATNNGLIKFFYLEDWQYVNEYRHSVSIRKIFPDVTGTTLVLIDEKTEGFVYCPLNDNLYEIPNFSPTIKGILWENWRMDRGVFVAYDDDKLYTY------------------------------VFHKDTIQG---SKVILAGGTKLPFSHKPVLLHNGDLICQTQSGKLNNICLGTHSFLGNIGDL-----------------------CKRLNEQI----------NWNELARACLHHMEVEFAIRVYRTIGNVGMVMSLEQIKGIEDHNLLAGHLAMFAGDFNLAQDLYLASSSPAAALEMRRDLQHWDSALQLAKRLAPNQISFISKEYAMQLEFTGDYVNALAHYEKG--------ITGDNKFQEHDETCLAGVARMSIRMGDIRRGVNQALKHPSRSLKKDCGAILESMKQLTEAAQLYEKGQYFDKAASVYIRCKNWAKVGELLPHVSSPKIHLQYAKAKEADGKYKEAVLAYENAKDWDNVIR--------------------DRDG--YIYGFFLKLGDYGSAIQFLVLSKCNDEAFQLAQQHNQMEIYADIIGSENTSTEDYQSIALYFEGEKKHFQAGKFFLLCGQYERALKHFIKCPITEDNLAIEMAIETVGRAKDELLTNQLIDYLMGEKDGMPKDAKYLFRLYMALKQYREAARTAIIIAREEQSAGNYRNAHDVLFSMYTELKAQKIKIPAEMATNLMILHSYILVKIHVKRGDHMKGARMLIRVANNISKFPSHIVPILTSTVIECHRAGLKNSAFSFAAMLMRPEYRNKIDVKYKKKIEAMVRRHDSTEVDEENTPCPFCGFQLPECELLCPGCKNNLPYCIATGRHMVKENWCACSHCGFSALYSEFTALL-ETESTCPMCSEPVSAKQLNRVADCTEYLRQ 1294          
BLAST of WD repeat domain 19 vs. Ensembl Xenopus
Match: cdk8 (cyclin-dependent kinase 8 [Source:Xenbase;Acc:XB-GENE-962267])

HSP 1 Score: 1286.94 bits (3329), Expect = 0.000e+0
Identity = 676/1402 (48.22%), Postives = 911/1402 (64.98%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGK----------CVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEA-KKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDAT-IEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQK 4240
            VF++ E+    + +++ WQ+  GNY+A+ G +  V IYDRHG   ++INL G           C  LDWD+ G+ LA++ +KS ++Y+WD +  K S++++G +D +SF+ WSK  + LAVGTSKG+LL+YN   SRKVP+LGKH+K++TCG WS + LLALGSED+  T+SN EG+TI+Q  +R  PS+IQFS +K DE++S  E+T++  +  +TLFLF L D +NP E+AFQ +YGNIV +KW+GDGYIM+GFSHG+ VVISTH +EIGQE+ Q  ++KD+L SI IS+SL +A + GD  +KIHDL  LKE+ AII LD++ +     +W++DGQLLA+ST  G ++VFLT+LP+L   D  GTKIA+LTSL EV+V N  +      + +E+EP F+ VG  H+ VGMNN+ W+Y         +++ EY+ +VTK+ LN  Y+AA F+GK+ L +IE S + D +E +  +LFP      + I    LT  FLI++T             N S  F ++  I  IF  E+             +  + L + + EI  F      +LW+    +  + +   DDKLYTY                              ++  +  +G   +K+ L G TK PF H P+ L NGD+I   Q+GKL    LGTH+F   +  L                         +L E++          NW ELA++ L  ++++FAIRVYR +GN GMV SL +IK IED NLLAG++AMF  DFNLAQD +L SSSP AAL MRRDL HWDSALQLAK L P+QI FIS+EYA QLEF GDYVNA+ +YE+G+        G NK   EH  +C  G+ARM+IR+GD +RGV  A +  +R L K+C  ILE  KQ+ EA  L+EK QYF+KA + YIR KNW KVG+LL HVSSPK+HLQYAKA+EA+G YKEAV +YE AKD+D+                                     LGD+ SAIQFLVLSKC+ EA   AQ+H QME YA IIGS+ T  EDYQ+IA YFE  K H+ AGKF+LL  QYE+A+KH +K    ED+ A+++AIE +GRA D+ LT+ L++YLMGE D +PK+ KYLF++YMALKQYREA RTAI+IA++EQ  GNYR AHD+LFSM  ELK   IKIP+EM++NLM++HSYI+ K+H+KRGDH++GARMLIRVA +ISKFPSH+VPILTSTVIECHR+GL++S+FS+AAML+RP+YR++ID KY KK+E +VRR D T+ +E  T CPFC   + E  L C  CK+++ YCIA+GRH+++++   C  C F A+ SEL     E  S CPMCSEPVSA +L  + D TEYL++
Sbjct:    4 VFSLTEKSLLGYPIHYAWQRNLGNYIAVTGVDHTVKIYDRHGQKKDEINLPGCADLIFLLCILCFALDWDKDGNALAMVADKSSSIYMWDPNTCKTSQLDSGMRDQMSFLLWSKAGSLLAVGTSKGSLLMYNLQTSRKVPVLGKHTKRVTCGCWSSQNLLALGSEDKMITVSNQEGDTIRQTSVRMDPSDIQFSVMKTDERASAGESTVSVVVGKKTLFLFNLNDPDNPIELAFQPRYGNIVSHKWYGDGYIMIGFSHGFFVVISTHMREIGQELFQAHNHKDSLTSIAISQSLGKAASCGDNVIKIHDLTELKEMYAIINLDDETKGLDTLSWTDDGQLLAVSTQRGSLNVFLTKLPVLG--DTCGTKIAYLTSLLEVTVANSVDGELPITVSVEVEPNFVAVGQYHVAVGMNNRAWFYALTQNGVEKLTDMEYLGSVTKMCLNSDYAAALFEGKVQLHVIE-SKDEDAQEERETRLFPASDDKCK-ILCHALTGEFLIYAT-------------NVSFPFLNQ--IKYIFIAEM------------LYTCTLLNDNLYEIPNFSPTIKGILWENWRMDRGVFVAYDDDKLYTY------------------------------VFHKDTIQG---SKVILAGGTKLPFSHKPVLLHNGDLICQTQSGKLNNICLGTHSFLGNIGDL-----------------------CKRLNEQI----------NWNELARACLHHMEVEFAIRVYRTIGNVGMVMSLEQIKGIEDHNLLAGHLAMFAGDFNLAQDLYLASSSPAAALEMRRDLQHWDSALQLAKRLAPNQISFISKEYAMQLEFTGDYVNALAHYEKGI-------TGDNK---EHDETCLAGVARMSIRMGDIRRGVNQALKHPSRSLKKDCGAILESMKQLTEAAQLYEKGQYFDKAASVYIRCKNWAKVGELLPHVSSPKIHLQYAKAKEADGKYKEAVLAYENAKDWDN-------------------------------------LGDYGSAIQFLVLSKCNDEAFQLAQQHNQMEIYADIIGSENTSTEDYQSIALYFEGEKKHFQAGKFFLLCGQYERALKHFIKCPITEDNLAIEMAIETVGRAKDELLTNQLIDYLMGEKDGMPKDAKYLFRLYMALKQYREAARTAIIIAREEQSAGNYRNAHDVLFSMYTELKAQKIKIPAEMATNLMILHSYILVKIHVKRGDHMKGARMLIRVANNISKFPSHIVPILTSTVIECHRAGLKNSAFSFAAMLMRPEYRNKIDVKYKKKIEAMVRRHDSTEVDEENTPCPFCGFQLPECELLCPGCKNNLPYCIATGRHMVKENWCACSHCGFSALYSELL----ETESTCPMCSEPVSAKQLNRVADCTEYLRQ 1257          
BLAST of WD repeat domain 19 vs. Ensembl Xenopus
Match: cdk8 (cyclin-dependent kinase 8 [Source:Xenbase;Acc:XB-GENE-962267])

HSP 1 Score: 1286.55 bits (3328), Expect = 0.000e+0
Identity = 675/1392 (48.49%), Postives = 909/1392 (65.30%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEA-KKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDAT-IEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQK 4240
            VF++ E+    + +++ WQ+  GNY+A+ G +  V IYDRHG   ++INL G C  LDWD+ G+ LA++ +KS ++Y+WD +  K S++++G +D +SF+ WSK  + LAVGTSKG+LL+YN   SRKVP+LGKH+K++TCG WS + LLALGSED+  T+SN EG+TI+Q  +R  PS+IQFS +K DE++S  E+T++  +  +TLFLF L D +NP E+AFQ +YGNIV    +GDGYIM+GFSHG+ VVISTH +EIGQE+ Q  ++KD+L SI IS+SL +A + GD  +KIHDL  LKE+ AII LD++ +     +W++DGQLLA+ST  G ++VFLT+LP+L   D  GTKIA+LTSL EV+V N  +      + +E+EP F+ VG  H+ VGMNN+ W+Y         +++ EY+ +VTK+ LN  Y+AA F+GK+ L +IE S + D +E +  +LFP      + I    LT  FLI++T             N S  F ++  I  IF  E+             +  + L + + EI  F      +LW+    +  + +   DDKLYTY                              ++  +  +G   +K+ L G TK PF H P+ L NGD+I   Q+GKL    LGTH+F   +  L                         +L E++          NW ELA++ L  ++++FAIRVYR +GN GMV SL +IK IED NLLAG++AMF  DFNLAQD +L SSSP AAL MRRDL HWDSALQLAK L P+QI FIS+EYA QLEF GDYVNA+ +YE+G+        G NK   EH  +C  G+ARM+IR+GD +RGV  A +  +R L K+C  ILE  KQ+ EA  L+EK QYF+KA + YIR KNW KVG+LL HVSSPK+HLQYAKA+EA+G YKEAV +YE AKD+D+                                     LGD+ SAIQFLVLSKC+ EA   AQ+H QME YA IIGS+ T  EDYQ+IA YFE  K H+ AGKF+LL  QYE+A+KH +K    ED+ A+++AIE +GRA D+ LT+ L++YLMGE D +PK+ KYLF++YMALKQYREA RTAI+IA++EQ  GNYR AHD+LFSM  ELK   IKIP+EM++NLM++HSYI+ K+H+KRGDH++GARMLIRVA +ISKFPSH+VPILTSTVIECHR+GL++S+FS+AAML+RP+YR++ID KY KK+E +VRR D T+ +E  T CPFC   + E  L C  CK+++ YCIA+GRH+++++   C  C F A+ SE   LL E  S CPMCSEPVSA +L  + D TEYL++
Sbjct:    4 VFSLTEKSLLGYPIHYAWQRNLGNYIAVTGVDHTVKIYDRHGQKKDEINLPGVCFALDWDKDGNALAMVADKSSSIYMWDPNTCKTSQLDSGMRDQMSFLLWSKAGSLLAVGTSKGSLLMYNLQTSRKVPVLGKHTKRVTCGCWSSQNLLALGSEDKMITVSNQEGDTIRQTSVRMDPSDIQFSVMKTDERASAGESTVSVVVGKKTLFLFNLNDPDNPIELAFQPRYGNIV----YGDGYIMIGFSHGFFVVISTHMREIGQELFQAHNHKDSLTSIAISQSLGKAASCGDNVIKIHDLTELKEMYAIINLDDETKGLDTLSWTDDGQLLAVSTQRGSLNVFLTKLPVLG--DTCGTKIAYLTSLLEVTVANSVDGELPITVSVEVEPNFVAVGQYHVAVGMNNRAWFYALTQNGVEKLTDMEYLGSVTKMCLNSDYAAALFEGKVQLHVIE-SKDEDAQEERETRLFPASDDKCK-ILCHALTGEFLIYAT-------------NVSFPFLNQ--IKYIFIAEM------------LYTCTLLNDNLYEIPNFSPTIKGILWENWRMDRGVFVAYDDDKLYTY------------------------------VFHKDTIQG---SKVILAGGTKLPFSHKPVLLHNGDLICQTQSGKLNNICLGTHSFLGNIGDL-----------------------CKRLNEQI----------NWNELARACLHHMEVEFAIRVYRTIGNVGMVMSLEQIKGIEDHNLLAGHLAMFAGDFNLAQDLYLASSSPAAALEMRRDLQHWDSALQLAKRLAPNQISFISKEYAMQLEFTGDYVNALAHYEKGI-------TGDNK---EHDETCLAGVARMSIRMGDIRRGVNQALKHPSRSLKKDCGAILESMKQLTEAAQLYEKGQYFDKAASVYIRCKNWAKVGELLPHVSSPKIHLQYAKAKEADGKYKEAVLAYENAKDWDN-------------------------------------LGDYGSAIQFLVLSKCNDEAFQLAQQHNQMEIYADIIGSENTSTEDYQSIALYFEGEKKHFQAGKFFLLCGQYERALKHFIKCPITEDNLAIEMAIETVGRAKDELLTNQLIDYLMGEKDGMPKDAKYLFRLYMALKQYREAARTAIIIAREEQSAGNYRNAHDVLFSMYTELKAQKIKIPAEMATNLMILHSYILVKIHVKRGDHMKGARMLIRVANNISKFPSHIVPILTSTVIECHRAGLKNSAFSFAAMLMRPEYRNKIDVKYKKKIEAMVRRHDSTEVDEENTPCPFCGFQLPECELLCPGCKNNLPYCIATGRHMVKENWCACSHCGFSALYSEFTALL-ETESTCPMCSEPVSAKQLNRVADCTEYLRQ 1246          
BLAST of WD repeat domain 19 vs. Ensembl Xenopus
Match: cdk8 (cyclin-dependent kinase 8 [Source:Xenbase;Acc:XB-GENE-962267])

HSP 1 Score: 767.689 bits (1981), Expect = 0.000e+0
Identity = 394/849 (46.41%), Postives = 553/849 (65.14%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEA-KKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNND 2614
            VF++ E+    + +++ WQ+  GNY+A+ G +  V IYDRHG   ++INL G C  LDWD+ G+ LA++ +KS ++Y+WD +  K S++++G +D +SF+ WSK  + LAVGTSKG+LL+YN   SRKVP+LGKH+K++TCG WS + LLALGSED+  T+SN EG+TI+Q  +R  PS+IQFS +K DE++S  E+T++  +  +TLFLF L D +NP E+AFQ +YGNIV +KW+GDGYIM+GFSHG+ VVISTH +EIGQE+ Q  ++KD+L SI IS+SL +A + GD  +KIHDL  LKE+ AII LD++ +     +W++DGQLLA+ST  G ++VFLT+LP+L   D  GTKIA+LTSL EV+V N  +      + +E+EP F+ VG  H+ VGMNN+ W+Y         +++ EY+ +VTK+ LN  Y+AA F+GK+ L +IE S + D +E +  +LFP      + I    LT  FLI++T+ G +  F++EDW Y +E++H   I KIF +  GT ++ ID K+  F Y PL + + EI  F      +LW+    +  + +   DDKLYTY       +T +G                              +K+ L G TK PF H P+ L NGD+I   Q+GKL    LGTH+F   L  +    +        QA+M   FS++W+L ++L          NW ELA++ L  ++++FAIRVYR +GN GMV SL +IK IED NLLAG++AMF  DFNLAQD +L SSSP AAL MRRDL HWDSALQLAK L P+QI FIS+EYA QLEF GDYVNA+ +YE+G+  ++
Sbjct:    4 VFSLTEKSLLGYPIHYAWQRNLGNYIAVTGVDHTVKIYDRHGQKKDEINLPGVCFALDWDKDGNALAMVADKSSSIYMWDPNTCKTSQLDSGMRDQMSFLLWSKAGSLLAVGTSKGSLLMYNLQTSRKVPVLGKHTKRVTCGCWSSQNLLALGSEDKMITVSNQEGDTIRQTSVRMDPSDIQFSVMKTDERASAGESTVSVVVGKKTLFLFNLNDPDNPIELAFQPRYGNIVSHKWYGDGYIMIGFSHGFFVVISTHMREIGQELFQAHNHKDSLTSIAISQSLGKAASCGDNVIKIHDLTELKEMYAIINLDDETKGLDTLSWTDDGQLLAVSTQRGSLNVFLTKLPVLG--DTCGTKIAYLTSLLEVTVANSVDGELPITVSVEVEPNFVAVGQYHVAVGMNNRAWFYALTQNGVEKLTDMEYLGSVTKMCLNSDYAAALFEGKVQLHVIE-SKDEDAQEERETRLFPASDDKCK-ILCHALTGEFLIYATNNGLIKFFYLEDWQYVNEYRHSVSIRKIFPDVTGTTLVLIDEKTEGFVYCPLNDNLYEIPNFSPTIKGILWENWRMDRGVFVAYDDDKLYTYVFHK---DTIQG------------------------------SKVILAGGTKLPFSHKPVLLHNGDLICQTQSGKLNNICLGTHSF---LGNIGDAGFNAAEVGLWQAVMAVRFSDSWELCKRL------NEQINWNELARACLHHMEVEFAIRVYRTIGNVGMVMSLEQIKGIEDHNLLAGHLAMFAGDFNLAQDLYLASSSPAAALEMRRDLQHWDSALQLAKRLAPNQISFISKEYAMQLEFTGDYVNALAHYEKGITGDN 806          
BLAST of WD repeat domain 19 vs. Ensembl Xenopus
Match: wdr19 (WD repeat domain 19 [Source:NCBI gene;Acc:100144725])

HSP 1 Score: 743.421 bits (1918), Expect = 0.000e+0
Identity = 388/796 (48.74%), Postives = 522/796 (65.58%), Query Frame = 2
Query: 1325 VSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDAT-IEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKL 3709
            +++ EY+ +VTK+ LN  Y+AA F+GK+ L +IE S + D +E +  +LFP      + I    LT  FLI++T+ G +  F++EDW Y +E++H   I KIF +  GT ++ ID K+  F Y PL + + EI  F      +LW+    +  + +   DDKLYTY                              ++  +  +G   +K+ L G TK PF H P+ L NGD+I   Q+GKL    LGTH+F   +    + E K++L    QA+M+  FS++W+L ++L          NW ELA++ L  ++++FAIRVYR +GN GMV SL +IK IED NLLAG++AMF  DFNLAQD +L SSSP AAL MRRDL HWDSALQLAK L P+QI FIS+EYA QLEF GDYVNA+ +YE+G        I G+    EH  +C  G+ARM+IR+GD +RGV  A +  +R L K+C  ILE  K +           +F +    Y  +    KVG+LL HVSSPK+HLQYAKA+EA+G YKEAV +YE AKD+D+VIR++L+HLNNP++AV IV  T S EGA  VA+FF++LGD+ SAIQFLVLSKC+ EA   AQ+H QME YA IIGS+ T  EDYQ+IA YFE  K H+ AGKF+LL  QYE+A+KH +K    ED+ A+++AIE +GRA D+ LT+ L++YLMGE D +PK+ KYLF++YMALKQYREA RTAI+IA++EQ  GNYR AHD+LFSM  ELK   IKIP+EM++NLM++HSYI+ K+
Sbjct:   41 LTDMEYLGSVTKMCLNSDYAAALFEGKVQLHVIE-SKDEDAQEERETRLFPASDDKCK-ILCHALTGEFLIYATNNGLIKFFYLEDWQYVNEYRHSVSIRKIFPDVTGTTLVLIDEKTEGFVYCPLNDNLYEIPNFSPTIKGILWENWRMDRGVFVAYDDDKLYTY------------------------------VFHKDTIQG---SKVILAGGTKLPFSHKPVLLHNGDLICQTQSGKLNNICLGTHSFLGNIGDAGANELKKMLT---QALMLRRFSDSWELCKRLNE------QINWNELARACLHHMEVEFAIRVYRTIGNVGMVMSLEQIKGIEDHNLLAGHLAMFAGDFNLAQDLYLASSSPAAALEMRRDLQHWDSALQLAKRLAPNQISFISKEYAMQLEFTGDYVNALAHYEKG--------ITGDNKFQEHDETCLAGVARMSIRMGDIRRGVNQALKHPSRSLKKDCGAILESMKVLT---------VHFVQIRATYDYVVCRAKVGELLPHVSSPKIHLQYAKAKEADGKYKEAVLAYENAKDWDNVIRISLDHLNNPEKAVGIVKETQSLEGAKMVARFFLKLGDYGSAIQFLVLSKCNDEAFQLAQQHNQMEIYADIIGSENTSTEDYQSIALYFEGEKKHFQAGKFFLLCGQYERALKHFIKCPITEDNLAIEMAIETVGRAKDELLTNQLIDYLMGEKDGMPKDAKYLFRLYMALKQYREAARTAIIIAREEQSAGNYRNAHDVLFSMYTELKAQKIKIPAEMATNLMILHSYILVKV 775          
BLAST of WD repeat domain 19 vs. Ensembl Mouse
Match: Wdr19 (WD repeat domain 19 [Source:MGI Symbol;Acc:MGI:2443231])

HSP 1 Score: 1431 bits (3703), Expect = 0.000e+0
Identity = 704/1391 (50.61%), Postives = 966/1391 (69.45%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEA-KKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGS-DATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQ 4237
            VF++ E+      + F WQK+ GNYLA+ G++  V I+DRHG   ++I+L G CV +DWD+ GD+LA+I  KS  +YLWD + +K S+++ G +D +SF+ WSK  + LAVGT KGNLL+YNH  SRK+P+LGKH+KKITCG W+ E LLALG ED+  T+SN EG+TI+Q P++  PS+I+FS  K DE+ S  ENT++  +  + LFLF L + +NP ++ FQ+ YGNIV Y W+GDGYIM+GFS G  + ISTH  E+GQEI + +D+KDNL S+ +S++L++A T GD C+KIHDL  L+++ AII LD++ +     +W++DGQLLA+ST  G +HVFLT+LP+L   D   T+IA+LTSL EV+V NL        + +++EP F+ VG  HL VGMNN+ W+Y         + + EY+ TV  + L+  Y+AA F+GKI L +IEN    D +E +  +LFP        I    LTS+FLI+ TD G ++ FFIEDW + ++++H  G+ K+F +  GT ++FID KS+ F Y P+ +   EI +F      VLW+    +  + +   DDK+YTY   + + +T +G                              +K+ L G TK PF H PL L NG++    Q+GK+ +  L TH+F   L  ++  E  +L Q   Q +++  FS+AW + + L          +W ELAK+ L  ++++FAIRV R +G+ G V SL +IK IED NLLAG++AMF NDFNLAQD +L S+ P AAL MRRDL HWDSALQLAK L P QIPFIS+EYA QLEF GDYVNA+ +YE+G+        G NK   EH   C  G+A+M+IR+GD +RG   A +  +R+L ++C  ILE  KQ +EA  L+EK QY+++A + YIR KNW KVG+LL HVSSPK+HLQYAKA+EA+G YKEAV +YE AK ++SVIR+ L+HLNNP++AV IV  T S +GA  VA+FF++LGD+ SAIQFLVLSKC++EA   AQ+H +ME YA IIG+ D T EDYQ+IA YFE  K H+ AGKF+LL  QY +A+KH LK    ED+ A+++AIE +G+A D+ LT+ L+++LMGE D +PK+ KYLF++YMALKQYREA RTAI+IA++EQ  GNYR AHD+LFSM  ELK   IKIPSEM++NLM++HSYI+ K+H+K GDH++GARMLIRVA +ISKFPSH+VPILTSTVIECHR+GL++S+FS+AAML+RP+YR++ID KY KK+E +VRRPD ++ EE  T CPFC  L+ E  L C  CK++I YCIA+GRH+++DD  +CP C FPA+ SE + LLN   S CPMCSE +++++LK I D ++YL+
Sbjct:    4 VFSLLEKSWLGAPIQFAWQKSSGNYLAVTGADYIVKIFDRHGQKRSEISLPGNCVTMDWDKDGDILAVIAEKSSCIYLWDANTNKTSQLDNGMRDQMSFLLWSKIGSFLAVGTIKGNLLIYNHQTSRKIPVLGKHTKKITCGCWNSENLLALGGEDKMITVSNQEGDTIRQTPVKSEPSDIKFSMSKTDERISSAENTISAVVGKKMLFLFHLNEPDNPVDLEFQQAYGNIVCYSWYGDGYIMIGFSRGTFLAISTHFPEVGQEIFKARDHKDNLTSVALSQTLNKAATCGDNCIKIHDLTELRDMYAIINLDDENKGLGTLSWTDDGQLLALSTQRGSLHVFLTKLPILG--DACHTRIAYLTSLLEVTVANLIEGEPPITVSVDVEPTFVAVGLYHLAVGMNNRAWFYVLGENVVKKLKDVEYLGTVASICLHSDYAAALFEGKIQLHLIENEM-LDAQEERETRLFPAVDDKCR-ILCHALTSDFLIYGTDTGIIHYFFIEDWQFVNDYRHPVGVKKLFPDPNGTRLVFIDEKSDGFVYCPVNDATYEIPDFSPTIKGVLWENWPMDKGVFIAYDDDKVYTY---AFHKDTIQG------------------------------SKVILAGSTKLPFSHKPLLLYNGELTCQTQSGKINSIYLSTHSF---LGSMKDTEPTDLRQMLTQTLLLKRFSDAWDICKMLND------RTSWSELAKACLHHMEVEFAIRVSRTMGDVGTVMSLEQIKGIEDYNLLAGHLAMFTNDFNLAQDLYLASNCPVAALEMRRDLQHWDSALQLAKRLAPDQIPFISKEYAIQLEFTGDYVNALAHYEKGI-------TGDNK---EHDEVCLAGVAQMSIRMGDIRRGANQALKHPSRVLKRDCGAILENMKQFSEAAQLYEKGQYYDRAASVYIRCKNWAKVGELLPHVSSPKIHLQYAKAKEADGRYKEAVVAYENAKQWNSVIRIYLDHLNNPEKAVSIVRETQSLDGAKMVARFFLQLGDYGSAIQFLVLSKCNNEAFTLAQQHNKMEIYADIIGAEDTTNEDYQSIALYFEGEKRHFQAGKFFLLCGQYSRALKHFLKCPSSEDNVAIEMAIETVGQAKDELLTNQLIDHLMGESDGMPKDAKYLFRLYMALKQYREAARTAIIIAREEQSAGNYRNAHDVLFSMYAELKAQKIKIPSEMATNLMILHSYILVKIHVKSGDHMKGARMLIRVANNISKFPSHIVPILTSTVIECHRAGLKNSAFSFAAMLMRPEYRNKIDAKYKKKIEAMVRRPDTSETEEATTPCPFCQFLLPECELLCPGCKNNIPYCIATGRHMLKDDWTMCPHCGFPALYSEFKILLNS-ESTCPMCSERLNSSQLKKITDCSQYLR 1337          
BLAST of WD repeat domain 19 vs. Ensembl Mouse
Match: Wdr19 (WD repeat domain 19 [Source:MGI Symbol;Acc:MGI:2443231])

HSP 1 Score: 1431 bits (3703), Expect = 0.000e+0
Identity = 704/1391 (50.61%), Postives = 966/1391 (69.45%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEA-KKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGS-DATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQ 4237
            VF++ E+      + F WQK+ GNYLA+ G++  V I+DRHG   ++I+L G CV +DWD+ GD+LA+I  KS  +YLWD + +K S+++ G +D +SF+ WSK  + LAVGT KGNLL+YNH  SRK+P+LGKH+KKITCG W+ E LLALG ED+  T+SN EG+TI+Q P++  PS+I+FS  K DE+ S  ENT++  +  + LFLF L + +NP ++ FQ+ YGNIV Y W+GDGYIM+GFS G  + ISTH  E+GQEI + +D+KDNL S+ +S++L++A T GD C+KIHDL  L+++ AII LD++ +     +W++DGQLLA+ST  G +HVFLT+LP+L   D   T+IA+LTSL EV+V NL        + +++EP F+ VG  HL VGMNN+ W+Y         + + EY+ TV  + L+  Y+AA F+GKI L +IEN    D +E +  +LFP        I    LTS+FLI+ TD G ++ FFIEDW + ++++H  G+ K+F +  GT ++FID KS+ F Y P+ +   EI +F      VLW+    +  + +   DDK+YTY   + + +T +G                              +K+ L G TK PF H PL L NG++    Q+GK+ +  L TH+F   L  ++  E  +L Q   Q +++  FS+AW + + L          +W ELAK+ L  ++++FAIRV R +G+ G V SL +IK IED NLLAG++AMF NDFNLAQD +L S+ P AAL MRRDL HWDSALQLAK L P QIPFIS+EYA QLEF GDYVNA+ +YE+G+        G NK   EH   C  G+A+M+IR+GD +RG   A +  +R+L ++C  ILE  KQ +EA  L+EK QY+++A + YIR KNW KVG+LL HVSSPK+HLQYAKA+EA+G YKEAV +YE AK ++SVIR+ L+HLNNP++AV IV  T S +GA  VA+FF++LGD+ SAIQFLVLSKC++EA   AQ+H +ME YA IIG+ D T EDYQ+IA YFE  K H+ AGKF+LL  QY +A+KH LK    ED+ A+++AIE +G+A D+ LT+ L+++LMGE D +PK+ KYLF++YMALKQYREA RTAI+IA++EQ  GNYR AHD+LFSM  ELK   IKIPSEM++NLM++HSYI+ K+H+K GDH++GARMLIRVA +ISKFPSH+VPILTSTVIECHR+GL++S+FS+AAML+RP+YR++ID KY KK+E +VRRPD ++ EE  T CPFC  L+ E  L C  CK++I YCIA+GRH+++DD  +CP C FPA+ SE + LLN   S CPMCSE +++++LK I D ++YL+
Sbjct:    4 VFSLLEKSWLGAPIQFAWQKSSGNYLAVTGADYIVKIFDRHGQKRSEISLPGNCVTMDWDKDGDILAVIAEKSSCIYLWDANTNKTSQLDNGMRDQMSFLLWSKIGSFLAVGTIKGNLLIYNHQTSRKIPVLGKHTKKITCGCWNSENLLALGGEDKMITVSNQEGDTIRQTPVKSEPSDIKFSMSKTDERISSAENTISAVVGKKMLFLFHLNEPDNPVDLEFQQAYGNIVCYSWYGDGYIMIGFSRGTFLAISTHFPEVGQEIFKARDHKDNLTSVALSQTLNKAATCGDNCIKIHDLTELRDMYAIINLDDENKGLGTLSWTDDGQLLALSTQRGSLHVFLTKLPILG--DACHTRIAYLTSLLEVTVANLIEGEPPITVSVDVEPTFVAVGLYHLAVGMNNRAWFYVLGENVVKKLKDVEYLGTVASICLHSDYAAALFEGKIQLHLIENEM-LDAQEERETRLFPAVDDKCR-ILCHALTSDFLIYGTDTGIIHYFFIEDWQFVNDYRHPVGVKKLFPDPNGTRLVFIDEKSDGFVYCPVNDATYEIPDFSPTIKGVLWENWPMDKGVFIAYDDDKVYTY---AFHKDTIQG------------------------------SKVILAGSTKLPFSHKPLLLYNGELTCQTQSGKINSIYLSTHSF---LGSMKDTEPTDLRQMLTQTLLLKRFSDAWDICKMLND------RTSWSELAKACLHHMEVEFAIRVSRTMGDVGTVMSLEQIKGIEDYNLLAGHLAMFTNDFNLAQDLYLASNCPVAALEMRRDLQHWDSALQLAKRLAPDQIPFISKEYAIQLEFTGDYVNALAHYEKGI-------TGDNK---EHDEVCLAGVAQMSIRMGDIRRGANQALKHPSRVLKRDCGAILENMKQFSEAAQLYEKGQYYDRAASVYIRCKNWAKVGELLPHVSSPKIHLQYAKAKEADGRYKEAVVAYENAKQWNSVIRIYLDHLNNPEKAVSIVRETQSLDGAKMVARFFLQLGDYGSAIQFLVLSKCNNEAFTLAQQHNKMEIYADIIGAEDTTNEDYQSIALYFEGEKRHFQAGKFFLLCGQYSRALKHFLKCPSSEDNVAIEMAIETVGQAKDELLTNQLIDHLMGESDGMPKDAKYLFRLYMALKQYREAARTAIIIAREEQSAGNYRNAHDVLFSMYAELKAQKIKIPSEMATNLMILHSYILVKIHVKSGDHMKGARMLIRVANNISKFPSHIVPILTSTVIECHRAGLKNSAFSFAAMLMRPEYRNKIDAKYKKKIEAMVRRPDTSETEEATTPCPFCQFLLPECELLCPGCKNNIPYCIATGRHMLKDDWTMCPHCGFPALYSEFKILLNS-ESTCPMCSERLNSSQLKKITDCSQYLR 1337          
BLAST of WD repeat domain 19 vs. Ensembl Mouse
Match: Wdr19 (WD repeat domain 19 [Source:MGI Symbol;Acc:MGI:2443231])

HSP 1 Score: 108.997 bits (271), Expect = 1.823e-27
Identity = 52/101 (51.49%), Postives = 72/101 (71.29%), Query Frame = 2
Query: 3935 VRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQ 4237
            VRRPD ++ EE  T CPFC  L+ E  L C  CK++I YCIA+GRH+++DD  +CP C FPA+ SE + LLN   S CPMCSE +++++LK I D ++YL+
Sbjct:    2 VRRPDTSETEEATTPCPFCQFLLPECELLCPGCKNNIPYCIATGRHMLKDDWTMCPHCGFPALYSEFKILLNS-ESTCPMCSERLNSSQLKKITDCSQYLR 101          
BLAST of WD repeat domain 19 vs. UniProt/SwissProt
Match: sp|Q3UGF1|WDR19_MOUSE (WD repeat-containing protein 19 OS=Mus musculus OX=10090 GN=Wdr19 PE=1 SV=1)

HSP 1 Score: 1431 bits (3703), Expect = 0.000e+0
Identity = 704/1391 (50.61%), Postives = 966/1391 (69.45%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEA-KKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGS-DATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQ 4237
            VF++ E+      + F WQK+ GNYLA+ G++  V I+DRHG   ++I+L G CV +DWD+ GD+LA+I  KS  +YLWD + +K S+++ G +D +SF+ WSK  + LAVGT KGNLL+YNH  SRK+P+LGKH+KKITCG W+ E LLALG ED+  T+SN EG+TI+Q P++  PS+I+FS  K DE+ S  ENT++  +  + LFLF L + +NP ++ FQ+ YGNIV Y W+GDGYIM+GFS G  + ISTH  E+GQEI + +D+KDNL S+ +S++L++A T GD C+KIHDL  L+++ AII LD++ +     +W++DGQLLA+ST  G +HVFLT+LP+L   D   T+IA+LTSL EV+V NL        + +++EP F+ VG  HL VGMNN+ W+Y         + + EY+ TV  + L+  Y+AA F+GKI L +IEN    D +E +  +LFP        I    LTS+FLI+ TD G ++ FFIEDW + ++++H  G+ K+F +  GT ++FID KS+ F Y P+ +   EI +F      VLW+    +  + +   DDK+YTY   + + +T +G                              +K+ L G TK PF H PL L NG++    Q+GK+ +  L TH+F   L  ++  E  +L Q   Q +++  FS+AW + + L          +W ELAK+ L  ++++FAIRV R +G+ G V SL +IK IED NLLAG++AMF NDFNLAQD +L S+ P AAL MRRDL HWDSALQLAK L P QIPFIS+EYA QLEF GDYVNA+ +YE+G+        G NK   EH   C  G+A+M+IR+GD +RG   A +  +R+L ++C  ILE  KQ +EA  L+EK QY+++A + YIR KNW KVG+LL HVSSPK+HLQYAKA+EA+G YKEAV +YE AK ++SVIR+ L+HLNNP++AV IV  T S +GA  VA+FF++LGD+ SAIQFLVLSKC++EA   AQ+H +ME YA IIG+ D T EDYQ+IA YFE  K H+ AGKF+LL  QY +A+KH LK    ED+ A+++AIE +G+A D+ LT+ L+++LMGE D +PK+ KYLF++YMALKQYREA RTAI+IA++EQ  GNYR AHD+LFSM  ELK   IKIPSEM++NLM++HSYI+ K+H+K GDH++GARMLIRVA +ISKFPSH+VPILTSTVIECHR+GL++S+FS+AAML+RP+YR++ID KY KK+E +VRRPD ++ EE  T CPFC  L+ E  L C  CK++I YCIA+GRH+++DD  +CP C FPA+ SE + LLN   S CPMCSE +++++LK I D ++YL+
Sbjct:    4 VFSLLEKSWLGAPIQFAWQKSSGNYLAVTGADYIVKIFDRHGQKRSEISLPGNCVTMDWDKDGDILAVIAEKSSCIYLWDANTNKTSQLDNGMRDQMSFLLWSKIGSFLAVGTIKGNLLIYNHQTSRKIPVLGKHTKKITCGCWNSENLLALGGEDKMITVSNQEGDTIRQTPVKSEPSDIKFSMSKTDERISSAENTISAVVGKKMLFLFHLNEPDNPVDLEFQQAYGNIVCYSWYGDGYIMIGFSRGTFLAISTHFPEVGQEIFKARDHKDNLTSVALSQTLNKAATCGDNCIKIHDLTELRDMYAIINLDDENKGLGTLSWTDDGQLLALSTQRGSLHVFLTKLPILG--DACHTRIAYLTSLLEVTVANLIEGEPPITVSVDVEPTFVAVGLYHLAVGMNNRAWFYVLGENVVKKLKDVEYLGTVASICLHSDYAAALFEGKIQLHLIENEM-LDAQEERETRLFPAVDDKCR-ILCHALTSDFLIYGTDTGIIHYFFIEDWQFVNDYRHPVGVKKLFPDPNGTRLVFIDEKSDGFVYCPVNDATYEIPDFSPTIKGVLWENWPMDKGVFIAYDDDKVYTY---AFHKDTIQG------------------------------SKVILAGSTKLPFSHKPLLLYNGELTCQTQSGKINSIYLSTHSF---LGSMKDTEPTDLRQMLTQTLLLKRFSDAWDICKMLND------RTSWSELAKACLHHMEVEFAIRVSRTMGDVGTVMSLEQIKGIEDYNLLAGHLAMFTNDFNLAQDLYLASNCPVAALEMRRDLQHWDSALQLAKRLAPDQIPFISKEYAIQLEFTGDYVNALAHYEKGI-------TGDNK---EHDEVCLAGVAQMSIRMGDIRRGANQALKHPSRVLKRDCGAILENMKQFSEAAQLYEKGQYYDRAASVYIRCKNWAKVGELLPHVSSPKIHLQYAKAKEADGRYKEAVVAYENAKQWNSVIRIYLDHLNNPEKAVSIVRETQSLDGAKMVARFFLQLGDYGSAIQFLVLSKCNNEAFTLAQQHNKMEIYADIIGAEDTTNEDYQSIALYFEGEKRHFQAGKFFLLCGQYSRALKHFLKCPSSEDNVAIEMAIETVGQAKDELLTNQLIDHLMGESDGMPKDAKYLFRLYMALKQYREAARTAIIIAREEQSAGNYRNAHDVLFSMYAELKAQKIKIPSEMATNLMILHSYILVKIHVKSGDHMKGARMLIRVANNISKFPSHIVPILTSTVIECHRAGLKNSAFSFAAMLMRPEYRNKIDAKYKKKIEAMVRRPDTSETEEATTPCPFCQFLLPECELLCPGCKNNIPYCIATGRHMLKDDWTMCPHCGFPALYSEFKILLNS-ESTCPMCSERLNSSQLKKITDCSQYLR 1337          
BLAST of WD repeat domain 19 vs. UniProt/SwissProt
Match: sp|Q8NEZ3|WDR19_HUMAN (WD repeat-containing protein 19 OS=Homo sapiens OX=9606 GN=WDR19 PE=1 SV=2)

HSP 1 Score: 1411.74 bits (3653), Expect = 0.000e+0
Identity = 704/1391 (50.61%), Postives = 957/1391 (68.80%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEA-KKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGS-DATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQ 4237
            +F++ E+      + F WQKT GNYLA+ G++  V I+DRHG   ++INL G CV +DWD+ GDVLA+I  KS  +YLWD + +K S+++ G +D +SF+ WSK  + LAVGT KGNLL+YNH  SRK+P+LGKH+K+ITCG W+ E LLALG ED+  T+SN EG+TI+Q  +R  PSN+QF  +K D+++S  E+ ++  L  +TLF   L + +NPA++ FQ+ +GNIV Y W+GDG IM+GFS G+ VVISTH  E+GQEI Q +++KDNL SI +S++L++  T GD C+KI DL  LK++  I+ LDE+ +     +W++DGQLLA+ST  G +HVFLT+LP+L   D   T+IA+LTSL EV+V N         + +++EP F+ VG  HL VGMNN+ W+Y         + + EY+ TV  + L+  Y+AA F+GK+ L +IE+    D +E +  +LFP        I    LTS+FLI+ TD G +  F+IEDW + ++++H   + KIF +  GT ++FID KS+ F Y P+ +   EI +F      VLW+    +  + +   DDK+YTY       +T +G                               K+ L G TK PF H PL L NG++    Q+GK+    L TH F   L+ L+     EL     Q +M+  FS+AW++   L   D+A     W ELA++ L  ++++FAIRVYRR+GN G+V SL +IK IED NLLAG++AMF ND+NLAQD +L SS P AAL MRRDL HWDSALQLAK L P QIPFIS+EYA QLEF GDYVNA+ +YE+G+        G NK   EH  +C  G+A+M+IR+GD +RGV  A +  +R+L ++C  ILE  KQ +EA  L+EK  Y++KA + YIR KNW KVG LL HVSSPK+HLQYAKA+EA+G YKEAV +YE AK + SVIR+ L+HLNNP++AV IV  T S +GA  VA+FF++LGD+ SAIQFLV+SKC++EA   AQ+H +ME YA IIGS D T EDYQ+IA YFE  K +  AGKF+LL  QY +A+KH LK    ED+ A+++AIE +G+A D+ LT+ L+++L+GE D +PK+ KYLF++YMALKQYREA +TAI+IA++EQ  GNYR AHD+LFSM  ELK   IKIPSEM++NLM++HSYI+ K+H+K GDH++GARMLIRVA +ISKFPSH+VPILTSTVIECHR+GL++S+FS+AAML+RP+YR +ID KY KK+E +VRRPD ++ EE  T CPFC  L+ E  L C  CK+SI YCIA+GRH+++DD  +CP C+FPA+ SEL+ +LN   S CPMCSE ++A +LK I D T+YL+
Sbjct:    4 IFSLLEKTWLGAPIQFAWQKTSGNYLAVTGADYIVKIFDRHGQKRSEINLPGNCVAMDWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRDQMSFLLWSKVGSFLAVGTVKGNLLIYNHQTSRKIPVLGKHTKRITCGCWNAENLLALGGEDKMITVSNQEGDTIRQTQVRSEPSNMQFFLMKMDDRTSAAESMISVVLGKKTLFFLNLNEPDNPADLEFQQDFGNIVCYNWYGDGRIMIGFSCGHFVVISTHTGELGQEIFQARNHKDNLTSIAVSQTLNKVATCGDNCIKIQDLVDLKDMYVILNLDEENKGLGTLSWTDDGQLLALSTQRGSLHVFLTKLPILG--DACSTRIAYLTSLLEVTVANPVEGELPITVSVDVEPNFVAVGLYHLAVGMNNRAWFYVLGENAVKKLKDMEYLGTVASICLHSDYAAALFEGKVQLHLIESEI-LDAQEERETRLFPAVDDKCR-ILCHALTSDFLIYGTDTGVVQYFYIEDWQFVNDYRHPVSVKKIFPDPNGTRLVFIDEKSDGFVYCPVNDATYEIPDFSPTIKGVLWENWPMDKGVFIAYDDDKVYTYVFHK---DTIQG------------------------------AKVILAGSTKVPFAHKPLLLYNGELTCQTQSGKVNNIYLSTHGF---LSNLKDTGPDELRPMLAQNLMLKRFSDAWEMCRILN--DEAA----WNELARACLHHMEVEFAIRVYRRIGNVGIVMSLEQIKGIEDYNLLAGHLAMFTNDYNLAQDLYLASSCPIAALEMRRDLQHWDSALQLAKHLAPDQIPFISKEYAIQLEFAGDYVNALAHYEKGI-------TGDNK---EHDEACLAGVAQMSIRMGDIRRGVNQALKHPSRVLKRDCGAILENMKQFSEAAQLYEKGLYYDKAASVYIRSKNWAKVGDLLPHVSSPKIHLQYAKAKEADGRYKEAVVAYENAKQWQSVIRIYLDHLNNPEKAVNIVRETQSLDGAKMVARFFLQLGDYGSAIQFLVMSKCNNEAFTLAQQHNKMEIYADIIGSEDTTNEDYQSIALYFEGEKRYLQAGKFFLLCGQYSRALKHFLKCPSSEDNVAIEMAIETVGQAKDELLTNQLIDHLLGENDGMPKDAKYLFRLYMALKQYREAAQTAIIIAREEQSAGNYRNAHDVLFSMYAELKSQKIKIPSEMATNLMILHSYILVKIHVKNGDHMKGARMLIRVANNISKFPSHIVPILTSTVIECHRAGLKNSAFSFAAMLMRPEYRSKIDAKYKKKIEGMVRRPDISEIEEATTPCPFCKFLLPECELLCPGCKNSIPYCIATGRHMLKDDWTVCPHCDFPALYSELKIMLNT-ESTCPMCSERLNAAQLKKISDCTQYLR 1337          
BLAST of WD repeat domain 19 vs. UniProt/SwissProt
Match: sp|G5ECZ4|DYF2_CAEEL (WD repeat-containing protein dyf-2 OS=Caenorhabditis elegans OX=6239 GN=dyf-2 PE=1 SV=1)

HSP 1 Score: 865.914 bits (2236), Expect = 0.000e+0
Identity = 490/1407 (34.83%), Postives = 789/1407 (56.08%), Query Frame = 2
Query:  128 KTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGF---KDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYY-----------------RENAETYHLVSEQ-----EYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTN--KVLWD-YKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQE-EEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNL--LNEPNSVCPMCSEPVSANELKMIL--DITEYLQKFNQ 4249
            + +G+ +A+  +N  V  YD+ GN+++ +N  GK + + WD++GDVLAI    +  +YLWDV+      +E+G    K+  + + WS     L +G + GN+++YNH  SR++ ++GKH + +T    + E  +   S+D T +++  EG T+        P+N+ +  +     S +    ++  +  + L L     ++ P  + FQEKYGNI  Y+WF DGYI++GF  GY++ IS H  EIG E+    +Y+  LASI +S S ++ +T+GD  VK+ DL+ L  +T + +++ +    +   +EDGQL+A+S+ +G + +F+T++P LA+       I +LT+L +V+V        S  L + +EP  +G+G  +L V  NN V++Y                 +  AE   +V+ +     EY+ TVT +QLN +Y+A  F  ++ L  I NS ++   E      FPE   +   + S+ LT NFLIF+T   Y+  F + +W   SE++H   +  IF +         D++  A  YS +++EV  +       +    +W+ +  D+N+  +         +  Q++YV                  F + K       + +    +  +  T+ P  ++PL L  G +  L  NGKL + +L +H  +  ++        ++L    ++++++ +S AW++   + S D +    +W + A ++L   D+  AI+++R +G+A MV +L  I+ IE+KNLL   I   L+ ++ A+  +L SS P  ALNMRRDLL W  AL LA+ + P +IP++S+EYA +LE  GD+ N++ NYE+G+  N  +      +L EH   C +GIARMAI+ GD +RGV +A+Q   R++ ++CA+ILEQ KQ  EA  L+E   ++++A    ++   W KVG+LL HV SPK+H+QY K  E E  YK AV  YE  +DYD+ +R+ L+ LN+P EAVR+V  + S EGA  VA+FF++LGD+ SAIQFLV+S+C  EA   A+++  +  YAK I     I     +A Y+ +  + ++A KFY  A QY  AI  L K    +D   V LA++   ++ D  L + LV++L+GE  N+ K+   LF++Y+ L + ++A +TA+++A+  Q  GNYR+A DLLF M Q+L++  ++IP +M+ +LM IHSYII K  I R + L  AR+LIR    I +FP+HVVPILTS+V+ C ++ L+ S+  +AA L+ P+YR +I  KY KK+E IVR+    ++  E  T CP C +L+    + C+ CKS + YCI +GRHI+  D   CP CE P   SE R L  LNE    C MC       +LK  +  D   YL+K  Q
Sbjct:   43 RPNGHTVAVACANNTVIYYDKKGNVIDALNPTGKLIDIAWDKEGDVLAIAVANTGTIYLWDVNSRNTDTVESGATSSKELPTCLAWSPSTPTLVIGNNAGNIVVYNHRTSRRIAVMGKHQRSVTQITVTPEDYVISCSDDNTLSVTTLEGTTVSTTTTNGEPTNMDYGSVNGKGGSGV--TMVSVVIGKKILMLAHYNALDEPVNLQFQEKYGNIHSYRWFNDGYILIGFDRGYIISISAHNNEIGSELVSFLEYRGYLASIAVSTSFNKLLTIGDNMVKVRDLDELTTVTMLTEIETEKNLSEIEVTEDGQLVAVSSQSGVLSIFVTKMPTLAAS--YNNSICYLTNLTQVTVVAEVEKKGSSTLELNIEPTVMGLGPLNLAVANNNTVFFYDYHTPAQMQAAQQLQSTQSAAEKPTIVAAEPINRVEYLSTVTNIQLNYMYAAVNFGSRLRLHRIRNSEDNVSIE------FPEANRN-ATLYSYALTENFLIFTTSNNYIVYFSLSEWAIVSEYRHVVPVRSIFPHPTNVVCCCFDDRLEAMIYSAVDDEVFRLPSVGSSAHYKGAIWETFTIDKNTFAV---------FDSQNIYV------------------FLLSK-------QHIQGESVIYVSATRLPHAYVPLSLNKGIVTCLMSNGKLSSVLLDSHKTESVISDKSETVIDDILT---RSLLMHRWSTAWKIC--IHSNDGS----HWNQFAMAALLDSDVGMAIKIFREIGDAAMVTALELIETIEEKNLLHAQIYTILSRYDDAEQLYLESSRPMEALNMRRDLLEWPKALVLAETMNPKEIPYLSKEYAQELELTGDHANSLANYEKGVMENPQNL----PELQEHNEICQSGIARMAIKTGDLRRGVQLAKQLEGRVVKRDCAIILEQMKQYTEAAQLYEVGLFYDRAAAVCLKANAWAKVGELLDHVKSPKIHIQYGKIMEKEKKYKVAVKCYETGRDYDNQVRLLLDPLNDPDEAVRVVRESRSIEGAKLVAKFFVKLGDYNSAIQFLVMSQCVQEAFELAEKNNAVREYAKAIEQHGNISQALELAEYYNRVNDMFMAAKFYTQAGQYNNAINLLFKNG--DDENCVALAVDCGIKSKDKTLNNKLVKFLLGEDGNV-KDPAQLFRLYVGLGRTKDAAQTAVVVAQIHQAKGNYRIARDLLFQMHQQLREKMMRIPLDMNKSLMAIHSYIIVKALINRKETLLAARLLIRTCGEIQRFPTHVVPILTSSVVICTQANLKKSAHKFAAQLMTPEYRPKIHEKYKKKIEDIVRKGGNQKDLVEENTPCPICDDLMPAYAMSCDNCKSLVPYCILTGRHIVASDFSRCPHCEMPGFYSEFRKLSILNEN---CYMC-----GGDLKGAIPEDAKAYLEKMEQ 1380          
BLAST of WD repeat domain 19 vs. UniProt/SwissProt
Match: sp|Q22830|OSM1_CAEEL (Intraflagellar transport protein osm-1 OS=Caenorhabditis elegans OX=6239 GN=osm-1 PE=1 SV=4)

HSP 1 Score: 56.225 bits (134), Expect = 2.542e-6
Identity = 123/533 (23.08%), Postives = 205/533 (38.46%), Query Frame = 2
Query: 2135 FHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLA------------GYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDE-------IGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPK---------LHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHY---VAQFFIRLGDFASAIQFLVLSKCHSEA-LHFAQEHGQMETY---AKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMY-------MALKQYREAG--RTAILIAKD-EQGNGNYRMA 3598
            F  A+    F  A    E  TS   A S   W  +A+ +L+  ++  A R Y  + +   V  L  I  I D+  ++              +A+    F  A+  FL  +   +A+ M   L  WD AL+LAK L   +   +   Y   L   G    A       L  +DGD        I  NK LS                L       ++++  N   ++++ A  L +++   +AG ++EK + F+KA+  + +   + K  QL +     K         LHL+Y       G Y  AV  +  A D    +   +     PK    + N  + K    Y   +A  +   GDF  A +  V +   ++A + + + +  ++ +    +  G +ATI  Y   A   ++H     A + Y+      KAI+   +V                GR +DD L   LVE   GE+  + +  K     Y        A +Q+ +AG  R+A+ + KD E  +  YR+A
Sbjct:  593 FGAALEKRDFDRAVAFLESNTSGTDAYSM--WIRVAEMALEHGNLFVAQRCYAAINDVAKVRKLHDILEIADEASISIGGDGTHFYKVRAMLAIMGRKFKEAERIFLEQNDTESAIGMYTSLHKWDEALELAKVLNYPEYEQLKTSYLRALSDTGQDSKAA-----ELKVSDGDTLSAIQLYIKSNKPLSA---------------LSAANNDSVLSQDEN---ILRQIADSLVKSQLYDKAGDVYEKLKDFDKAVEYFKKGDAYGKAIQLARFAFPEKVVTLEQEWGLHLEYI------GQYDAAVNHFVEANDLKKAVEAAIRAKEWPKALSIVENIQDQKVRTGYYGEIADHYSNKGDFERAERLFVEAGLFNDAIMMYGKNNKWIDAFRLSEEFHGREATISSYLAKAEDLDEHGRFAEAEQLYITIGMPHKAIQMYDRV----------------GR-DDDVLR--LVERYHGEH--MHETRKRFATQYEERGDLKAAEEQFLKAGDFRSAVNMYKDSEMWSDAYRIA 1073          
BLAST of WD repeat domain 19 vs. TrEMBL
Match: E7FGG5 (WD repeat domain 19 OS=Danio rerio OX=7955 GN=wdr19 PE=4 SV=1)

HSP 1 Score: 1491.48 bits (3860), Expect = 0.000e+0
Identity = 730/1393 (52.40%), Postives = 987/1393 (70.85%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDED--GEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYF-HQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQK 4240
            VFT+ E+      + ++WQKT GNYLA+ G +  V I+DRHG  VN++NL G CV LDWD+ GD+LA+I  KS +VYLWD +++K S++++G +D +SF+ WSK    LAVGTSKGNLL+YN   SRK+P+LGKH+KKITCG WS + LLALGSEDR+ T+SN EG+TI+Q  +R  P+++QFS +K DE+SS  ++T++  L  +TLFLF L D +NP E+AFQ++YGNI+ Y+W+GDGYIM+GFSHGY VVISTH +EIGQE+ Q  ++KD+L SI IS+SL++A + GD C+KIHDL  LKE+ AI+ LDE+  G  + C W++DGQLLA+S+  G +HVFLT+LP+L   D SGT+IA+LTSL EV+V N     S   + +E+EP FI VG  H+ VGMNN+ W+Y         V + EY+ TV  + LN  Y+AA F+GK+ L +I+   E   +E +  KLFPE P     I S  LTS+FL + TD G +  F+ EDW   +E++H  G+ K+F +  GT ++FID KS+ F Y P+ + V EI +F      VLW+       + +   +DK+YTY   + + +T +G                              +K+ L+G TK PF H PL L NG++    Q+GK+ + VL THAF   LN   S   K+ LQ F  QA+M+  FS+AW + + L S      +E W EL ++ L  ++++ AIRVYR +GN GMV SL  IK IED+NLLAG++AMF ND+N AQD +L SS P AAL MRRDL HWDSALQLAK L+P +IPFIS+EYA QLEF+GDYVNA+ +YE+G          GN    +H  SC  G+ARM+IR+GD +RG   A +  ++ L K+C  ILE  KQ +EA  L+EK QY++KA + YIR KNW KVG+LL HV+SPK+HLQYAKA+EA+G YKEA  +YE A+D+D+VIR+ LEHLNNP+EAVRIV  T+S EGA  VA+FF+RL D+ SAIQFLVLS+C  EA   AQ+HGQME YA IIGS+ATIEDYQ+IA YFE  KNH  AGKF+    QY +A+KH LK    +DS A+++AIEA+G A D+ LT+ L+++LMGE D +PK+ KYLF++YMALKQYREA RTAI+IA++EQ  GNYR AHD+LFSM  EL+  +IKIP+EM++NLM++HSYI+ K+H+KRGDHL+GARMLIRV+ +ISKFPSH+VPILTS VIECHR+GLR+S+FS+A+ML+RP+YR++ID KY KK+E +VRRPD ++ EE  + CP+C   + +  L C  CK+++ YCIA+GRH++++D  +CP C+FPA+ S+   LL E  SVCPMCSE ++ +E+K +L+ ++YLQ+
Sbjct:    4 VFTLSEKSWSGSCLQYKWQKTVGNYLAVAGPDNLVKIFDRHGQKVNELNLPGNCVSLDWDKDGDILAVIAEKSSSVYLWDANVNKTSQLDSGMRDQMSFLLWSKTGPLLAVGTSKGNLLIYNQQTSRKIPVLGKHTKKITCGCWSSQNLLALGSEDRSITISNHEGDTIRQTSVRADPADVQFSVMKTDERSSPGQSTVSVALGKKTLFLFNLNDPDNPIELAFQQRYGNIISYRWYGDGYIMIGFSHGYFVVISTHIREIGQELFQAHNHKDSLTSIAISQSLNKAASCGDNCIKIHDLTDLKEMYAIVTLDEETKGLDQMC-WTDDGQLLAVSSQQGTLHVFLTKLPILG--DSSGTRIAYLTSLLEVTVANPVEGESPVPVAVEVEPSFIAVGPYHVAVGMNNRAWFYALGDSGVERVKDTEYLGTVASMCLNCDYAAALFEGKLQLHVIDGD-EQVVQEDRQTKLFPE-PDQKYRILSHALTSDFLYYGTDTGLIQCFYFEDWQSVTEYRHTVGVRKVFPDPNGTRLVFIDEKSDGFLYCPVNDSVFEIPDFSPAIKGVLWENWISSKGVFVAYEEDKVYTY---AFHKDTIQG------------------------------SKVILVGGTKLPFSHKPLLLHNGELTCQTQSGKINSVVLNTHAF---LNNQHSESSKDKLQSFLQQAVMLKRFSDAWSICKALNS------SEAWGELGRACLHHMEVELAIRVYRMMGNVGMVMSLEDIKGIEDQNLLAGHLAMFCNDYNRAQDLYLTSSYPMAALEMRRDLQHWDSALQLAKRLDPDEIPFISKEYAIQLEFVGDYVNALAHYEKG--------TTGNNKFQDHDESCLAGVARMSIRMGDIRRGANQAIKHPSKALKKDCGAILESMKQYSEAAQLYEKGQYYDKAASVYIRCKNWAKVGELLPHVTSPKIHLQYAKAKEADGKYKEAAMAYESARDWDNVIRILLEHLNNPEEAVRIVRETHSIEGAKMVARFFLRLSDYGSAIQFLVLSRCSDEAFQLAQQHGQMEVYADIIGSEATIEDYQSIALYFEGEKNHLQAGKFFQKCGQYSRALKHFLKCPSSDDSVAIEMAIEAVGEAKDESLTNQLIDHLMGESDGMPKDAKYLFRLYMALKQYREAARTAIIIAREEQSAGNYRNAHDVLFSMYAELQTQHIKIPAEMATNLMILHSYILVKIHVKRGDHLKGARMLIRVSNNISKFPSHIVPILTSAVIECHRAGLRNSAFSFASMLMRPEYRNKIDLKYKKKIEAMVRRPDTSEVEEESSPCPYCGFSLPDCELLCPGCKNNLPYCIATGRHMVKEDWCVCPHCDFPALHSQFTQLL-ETESVCPMCSEALNVSEVKKVLECSKYLQQ 1340          
BLAST of WD repeat domain 19 vs. TrEMBL
Match: A0A2R8RPA6 (WD repeat domain 19 OS=Danio rerio OX=7955 GN=wdr19 PE=4 SV=1)

HSP 1 Score: 1491.09 bits (3859), Expect = 0.000e+0
Identity = 732/1393 (52.55%), Postives = 988/1393 (70.93%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDED--GEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYF-HQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQK 4240
            VFT+ E+      + ++WQKT GNYLA+ G +  V I+DRHG  VN++NL G CV LDWD+ GD+LA+I  KS +VYLWD +++K S++++G +D +SF+ WSK    LAVGTSKGNLL+YN   SRK+P+LGKH+KKITCG WS + LLALGSEDR+ T+SN EG+TI+Q  +R  P+++QFS +K DE+SS  ++T++  L  +TLFLF L D +NP E+AFQ++YGNI+ Y+W+GDGYIM+GFSHGY VVISTH +EIGQE+ Q  ++KD+L SI IS+SL++A + GD C+KIHDL  LKE+ AI+ LDE+  G  + C W++DGQLLA+S+  G +HVFLT+LP+L   D SGT+IA+LTSL EV+V N     S   + +E+EP FI VG  H+ VGMNN+ W+Y         V + EY+ TV  + LN  Y+AA F+GK+ L +I+   E   +E +  KLFPE P     I S  LTS+FL + TD G +  F+ EDW   +E++H  G+ K+F +  GT ++FID KS+ F Y P+ + V EI +F      VLW+       + +   +DK+YTY   + + +T +G                              +K+ L+G TK PF H PL L NG++    Q+GK+ + VL THAF   LN   S   K+ LQ F  QA+M+  FS+AW + + L S      +E W EL ++ L  ++++ AIRVYR +GN GMV SL  IK IED+NLLAG++AMF ND+N AQD +L SS P AAL MRRDL HWDSALQLAK L+P +IPFIS+EYA QLEF+GDYVNA+ +YE+G         G NKD   H  SC  G+ARM+IR+GD +RG   A +  ++ L K+C  ILE  KQ +EA  L+EK QY++KA + YIR KNW KVG+LL HV+SPK+HLQYAKA+EA+G YKEA  +YE A+D+D+VIR+ LEHLNNP+EAVRIV  T+S EGA  VA+FF+RL D+ SAIQFLVLS+C  EA   AQ+HGQME YA IIGS+ATIEDYQ+IA YFE  KNH  AGKF+    QY +A+KH LK    +DS A+++AIEA+G A D+ LT+ L+++LMGE D +PK+ KYLF++YMALKQYREA RTAI+IA++EQ  GNYR AHD+LFSM  EL+  +IKIP+EM++NLM++HSYI+ K+H+KRGDHL+GARMLIRV+ +ISKFPSH+VPILTS VIECHR+GLR+S+FS+A+ML+RP+YR++ID KY KK+E +VRRPD ++ EE  + CP+C   + +  L C  CK+++ YCIA+GRH++++D  +CP C+FPA+ S+   LL E  SVCPMCSE ++ +E+K +L+ ++YLQ+
Sbjct:   33 VFTLSEKSWSGSCLQYKWQKTVGNYLAVAGPDNLVKIFDRHGQKVNELNLPGNCVSLDWDKDGDILAVIAEKSSSVYLWDANVNKTSQLDSGMRDQMSFLLWSKTGPLLAVGTSKGNLLIYNQQTSRKIPVLGKHTKKITCGCWSSQNLLALGSEDRSITISNHEGDTIRQTSVRADPADVQFSVMKTDERSSPGQSTVSVALGKKTLFLFNLNDPDNPIELAFQQRYGNIISYRWYGDGYIMIGFSHGYFVVISTHIREIGQELFQAHNHKDSLTSIAISQSLNKAASCGDNCIKIHDLTDLKEMYAIVTLDEETKGLDQMC-WTDDGQLLAVSSQQGTLHVFLTKLPILG--DSSGTRIAYLTSLLEVTVANPVEGESPVPVAVEVEPSFIAVGPYHVAVGMNNRAWFYALGDSGVERVKDTEYLGTVASMCLNCDYAAALFEGKLQLHVIDGD-EQVVQEDRQTKLFPE-PDQKYRILSHALTSDFLYYGTDTGLIQCFYFEDWQSVTEYRHTVGVRKVFPDPNGTRLVFIDEKSDGFLYCPVNDSVFEIPDFSPAIKGVLWENWISSKGVFVAYEEDKVYTY---AFHKDTIQG------------------------------SKVILVGGTKLPFSHKPLLLHNGELTCQTQSGKINSVVLNTHAF---LNNQHSESSKDKLQSFLQQAVMLKRFSDAWSICKALNS------SEAWGELGRACLHHMEVELAIRVYRMMGNVGMVMSLEDIKGIEDQNLLAGHLAMFCNDYNRAQDLYLTSSYPMAALEMRRDLQHWDSALQLAKRLDPDEIPFISKEYAIQLEFVGDYVNALAHYEKG-------TTGNNKD---HDESCLAGVARMSIRMGDIRRGANQAIKHPSKALKKDCGAILESMKQYSEAAQLYEKGQYYDKAASVYIRCKNWAKVGELLPHVTSPKIHLQYAKAKEADGKYKEAAMAYESARDWDNVIRILLEHLNNPEEAVRIVRETHSIEGAKMVARFFLRLSDYGSAIQFLVLSRCSDEAFQLAQQHGQMEVYADIIGSEATIEDYQSIALYFEGEKNHLQAGKFFQKCGQYSRALKHFLKCPSSDDSVAIEMAIEAVGEAKDESLTNQLIDHLMGESDGMPKDAKYLFRLYMALKQYREAARTAIIIAREEQSAGNYRNAHDVLFSMYAELQTQHIKIPAEMATNLMILHSYILVKIHVKRGDHLKGARMLIRVSNNISKFPSHIVPILTSAVIECHRAGLRNSAFSFASMLMRPEYRNKIDLKYKKKIEAMVRRPDTSEVEEESSPCPYCGFSLPDCELLCPGCKNNLPYCIATGRHMVKEDWCVCPHCDFPALHSQFTQLL-ETESVCPMCSEALNVSEVKKVLECSKYLQQ 1367          
BLAST of WD repeat domain 19 vs. TrEMBL
Match: A0A210QC01 (WD repeat-containing protein 19 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT13018 PE=4 SV=1)

HSP 1 Score: 1488.78 bits (3853), Expect = 0.000e+0
Identity = 724/1376 (52.62%), Postives = 971/1376 (70.57%), Query Frame = 2
Query:  107 VVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYL 4234
             +++ WQKT GNYLA+ G +  + IYDRHG+L  + NL G C  + WD+ GD LA+I++K+  + LWD +  + S I++G +DSL+++ W+K    LAVGTSKGNLL+YNH  SRKVP+LGKH+KKITCG+WS E LLALGS+DRT T+SN EG+TI+Q  +R  P  +QFSE+K DE+S I +NT++  +  +TLFL+ L D ENP E+AFQ++YGNI+ Y+W+GDGYIM+GFSHGY VVISTH KEIGQE+ Q +++KDNL  I IS SL++A + GD C+KIHDL+ LKE+ AII +D++    K NW++DGQLLA+ST  G++HV+LTRLPMLAS   S T+IAHLTSL EV++++  N      +PI++EP F+G+G  HL VGMNN+ W+Y         + ++EY+ TV  + LN  Y+A  F+G++ L MIE        E +S KLFP+       IT   +T +FLIF+TD G +N FFIEDW   +EF+H  GI KIF +  G+ ++F+D+KS+ F Y+P+ ++ +EI +F   T   LW+    +  + L   ++K+ TY    LY                                 V   ++   G T+ P+G +P+ L NG++ L  ++G+L T +L TH    + N LE +E + +    HQ  ++  F +AW L  ++           W EL + +L  L++DFA+RVYR +G+ GMV SL +IKH+ED+NLL+GYIAMFL +FNLAQD FL S  P AAL MRRDLLHWDSALQLAKAL P QIP+ISREYA QLEF GDY+NA+ +YE+G+   + D         EH   C  GIARM+IR+GD +RGV MA +  +R+L KEC+ ILE  KQ  EA  L+E   Y++KA + YIR KNWNKVG+LL H++SPK+H QYAKA+EA+G YKEA  +Y+ AKD+D+VIR+NL++L NP+EAVRIV    S EGA  VA+FF +L D++SAIQFLV+SKC+ EA   AQ H QMETYA IIG DAT EDYQ+IA +FE  KNH+L+GKF+LL+ QY +A+KH L+ +  ED  A++LAIE +GRAND +LT  L+++LMGE DNIPK+ KYLF++YMALKQYREA RTAI+IA++EQ  GNYR AHD+LFSM QELK+  IKIP+EM +NLM++HSYI+ K+H+K GDHL+GARMLIRVA +ISKFPSH+VPILTSTVIECHR+GL++SSFSYAAML+RP+YR+QID K+ KK+E IVR+PDKT+EEEP T CP+C   + ET L C ECK+S+ YC  +GRH+++DD   CPKC+FP + SE   LL   +S CPMC+E V    ++ + D   YL
Sbjct:   17 TIHYCWQKTLGNYLAVVGHDHVLRIYDRHGDLKEEFNLPGACTGIGWDKDGDTLAVINDKNGVIILWDANTQRTSPIDSGLRDSLTYMLWAKAGPYLAVGTSKGNLLIYNHQTSRKVPVLGKHTKKITCGSWSNENLLALGSDDRTITISNIEGDTIRQTSVRSDPQEVQFSEMKGDERSQIGDNTVSVVIGKKTLFLYNLNDPENPIELAFQQRYGNIISYRWYGDGYIMIGFSHGYFVVISTHMKEIGQELFQARNHKDNLTCIAISNSLNKAASCGDNCIKIHDLSDLKEMFAIINMDDERGLDKLNWTDDGQLLAVSTQKGNLHVYLTRLPMLASA--SSTRIAHLTSLLEVTIEDNVNQDPPLTIPIDVEPSFLGIGPYHLAVGMNNRAWFYLLGDNGLEKLKDREYLGTVGTICLNADYAAVSFEGRVQLHMIEGETAGTTDERES-KLFPDMDQQDSRITCHSMTQDFLIFATDNGGINYFFIEDWQMVNEFRHVVGIRKIFPDPSGSRVIFVDDKSDGFVYNPVNDQNLEIPKFSPTTKGALWEMWTADKGVFLTYDEEKICTY----LYCR-----------------------------ESVQGPQVAFAGETRLPYGQIPIMLYNGEVTLQTESGRLGTLLLETHTALFSDN-LEDMEKEVMKSALHQGTLLRRFKDAWNLCSQMNDL------VCWLELGRGALSSLEVDFAMRVYREIGDVGMVTSLQQIKHLEDRNLLSGYIAMFLAEFNLAQDLFLASGKPLAALEMRRDLLHWDSALQLAKALAPEQIPYISREYAQQLEFTGDYMNALSHYEKGVTRQEKDR--------EHDEVCAAGIARMSIRMGDIRRGVNMALKMPSRILKKECSTILEGMKQWQEAAMLYEHGGYYDKAASVYIRSKNWNKVGELLSHITSPKIHAQYAKAKEADGRYKEAAEAYKQAKDWDNVIRINLDYLQNPEEAVRIVREIQSIEGAKMVAKFFQKLNDYSSAIQFLVMSKCNDEAFQLAQTHNQMETYADIIGPDATPEDYQSIALFFENEKNHFLSGKFFLLSGQYSRAMKHFLRCS-GEDGRAIELAIETVGRANDTQLTRQLIDFLMGETDNIPKDAKYLFRLYMALKQYREAARTAIIIAREEQNAGNYRNAHDVLFSMYQELKEQKIKIPAEMGTNLMILHSYILVKIHVKHGDHLKGARMLIRVANNISKFPSHIVPILTSTVIECHRAGLKNSSFSYAAMLMRPEYRNQIDLKFKKKIEMIVRKPDKTEEEEPLTPCPYCGFQLPETDLTCPECKNSLPYCTITGRHLVKDDMAACPKCDFPGLFSEFIRLLEIEDS-CPMCTEKVIKENIQKVTDTQHYL 1339          
BLAST of WD repeat domain 19 vs. TrEMBL
Match: A0A2R8RPG4 (WD_REPEATS_REGION domain-containing protein OS=Danio rerio OX=7955 GN=wdr19 PE=4 SV=1)

HSP 1 Score: 1486.09 bits (3846), Expect = 0.000e+0
Identity = 730/1393 (52.40%), Postives = 988/1393 (70.93%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDED--GEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYF-HQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQK 4240
            VFT+ E+      + ++WQKT GNYLA+ G +  V I+DRHG  VN++ L G CV LDWD+ GD+LA+I  KS +VYLWD +++K S++++G +D +SF+ WSK    LAVGTSKGNLL+YN   SRK+P+LGKH+KKITCG WS + LLALGSEDR+ T+SN EG+TI+Q  +R  P+++QFS +K DE+SS  ++T++  L  +TLFLF L D +NP E+AFQ++YGNI+ Y+W+GDGYIM+GFSHGY VVISTH +EIGQE+ Q  ++KD+L SI IS+SL++A + GD C+KIHDL  LKE+ AI+ LDE+  G  + C W++DGQLLA+S+  G +HVFLT+LP+L   D SGT+IA+LTSL EV+V N     S   + +E+EP FI VG  H+ VGMNN+ W+Y         V + EY+ TV  + LN  Y+AA F+GK+ L +I+   E   +E +  KLFPE P     I S  LTS+FL + TD G +  F+ EDW   +E++H  G+ K+F +  GT ++FID KS+ F Y P+ + V EI +F      VLW+       + +   +DK+YTY   + + +T +G                              +K+ L+G TK PF H PL L NG++    Q+GK+ + VL THAF   LN   S   K+ LQ F  QA+M+  FS+AW + + L S      +E W EL ++ L  ++++ AIRVYR +GN GMV SL  IK IED+NLLAG++AMF ND+N AQD +L SS P AAL MRRDL HWDSALQLAK L+P +IPFIS+EYA QLEF+GDYVNA+ +YE+G         G NKD   H  SC  G+ARM+IR+GD +RG   A +  ++ L K+C  ILE  KQ +EA  L+EK QY++KA + YIR KNW KVG+LL +V+SPK+HLQYAKA+EA+G YKEA  +YE A+D+D+VIR+ LEHLNNP+EAVRIV  T+S EGA  VA+FF+RL D+ SAIQFLVLS+C  EA   AQ+HGQME YA IIGS+ATIEDYQ+IA YFE  KNH  AGKF+    QY +A+KH LK    +DS A+++AIEA+G A D+ LT+ L+++LMGE D +PK+ KYLF++YMALKQYREA RTAI+IA++EQ  GNYR AHD+LFSM  EL+  +IKIP+EM++NLM++HSYI+ K+H+KRGDHL+GARMLIRV+ +ISKFPSH+VPILTS VIECHR+GLR+S+FS+A+ML+RP+YR++ID KY KK+E +VRRPD ++ EE  + CP+C   + +  L C  CK+++ YCIA+GRH++++D  +CP+C+FPA+ S+   LL E  SVCPMCSE ++ +E+K +L+ ++YLQ+
Sbjct:   33 VFTLSEKSWSGSCLQYKWQKTVGNYLAVAGPDNLVKIFDRHGQKVNELILPGNCVSLDWDKDGDILAVIAEKSSSVYLWDANVNKTSQLDSGMRDQMSFLLWSKTGPLLAVGTSKGNLLIYNQQTSRKIPVLGKHTKKITCGCWSSQNLLALGSEDRSITISNHEGDTIRQTSVRADPADVQFSVMKTDERSSPGQSTVSVALGKKTLFLFNLNDPDNPIELAFQQRYGNIISYRWYGDGYIMIGFSHGYFVVISTHIREIGQELFQAHNHKDSLTSIAISQSLNKAASCGDNCIKIHDLTDLKEMYAIVTLDEETKGLDQMC-WTDDGQLLAVSSQQGTLHVFLTKLPILG--DSSGTRIAYLTSLLEVTVANPVEGESPVPVAVEVEPSFIAVGPYHVAVGMNNRAWFYALGDSGVERVKDTEYLGTVASMCLNCDYAAALFEGKLQLHVIDGD-EQVVQEDRQTKLFPE-PDQKYRILSHALTSDFLYYGTDTGLIQCFYFEDWQSVTEYRHTVGVRKVFPDPNGTRLVFIDEKSDGFLYCPVNDSVFEIPDFSPAIKGVLWENWISSKGVFVAYEEDKVYTY---AFHKDTIQG------------------------------SKVILVGGTKLPFSHKPLLLHNGELTCQTQSGKINSVVLNTHAF---LNNQHSESSKDKLQSFLQQAVMLKRFSDAWSICKALNS------SEAWGELGRACLHHMEVELAIRVYRMMGNVGMVMSLEDIKGIEDQNLLAGHLAMFCNDYNRAQDLYLTSSYPMAALEMRRDLQHWDSALQLAKRLDPDEIPFISKEYAIQLEFVGDYVNALAHYEKG-------TTGNNKD---HDESCLAGVARMSIRMGDIRRGANQAIKHPSKALKKDCGAILESMKQYSEAAQLYEKGQYYDKAASVYIRCKNWAKVGELLPNVTSPKIHLQYAKAKEADGKYKEAAMAYESARDWDNVIRILLEHLNNPEEAVRIVRETHSIEGAKMVARFFLRLSDYGSAIQFLVLSRCSDEAFQLAQQHGQMEVYADIIGSEATIEDYQSIALYFEGEKNHLQAGKFFQKCGQYSRALKHFLKCPSSDDSVAIEMAIEAVGEAKDESLTNQLIDHLMGESDGMPKDAKYLFRLYMALKQYREAARTAIIIAREEQSAGNYRNAHDVLFSMYAELQTQHIKIPAEMATNLMILHSYILVKIHVKRGDHLKGARMLIRVSNNISKFPSHIVPILTSAVIECHRAGLRNSAFSFASMLMRPEYRNKIDLKYKKKIEAMVRRPDTSEVEEESSPCPYCGFSLPDCELLCPGCKNNLPYCIATGRHMVKEDWCVCPQCDFPALHSQFTQLL-ETESVCPMCSEALNVSEVKKVLECSKYLQQ 1367          
BLAST of WD repeat domain 19 vs. TrEMBL
Match: A0A1S3K567 (WD repeat-containing protein 19 OS=Lingula unguis OX=7574 GN=LOC106178847 PE=4 SV=1)

HSP 1 Score: 1482.62 bits (3837), Expect = 0.000e+0
Identity = 735/1393 (52.76%), Postives = 988/1393 (70.93%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAET---YHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIE-NSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFK-QALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYL 4234
            VFT+ E+      + ++WQ++ GNYLA  G +  V I+DRHG L  +INL G C    WD  GDVLAII++K+  V+LW+ +  ++S++++G +DSL+F+ WSK   QL++GT+KGNL++YNH  SRK+PILGKH+KKITCGAWS + LLALGS+D T T+SN EG+TI+Q  LR  PS+IQFSE+K DE+S + +NT++  +  +TL+L+ + D ENP E+AFQ++YG+IV YKW+GDGYIM+GFS G+ VVISTH KEIGQE+ Q +++KDNL SI I+ SL++A + GD  VKIH+L+ LKE  AI+ LD++ +  + NW++DGQLLA+ST  G +HV+LT+LPM+   D   T++A+LTSL EV+V +  +  +  VL  ++EP FIG+G  HL VGMNN+ W+Y  + E       + ++EY+ TV  L++N  Y+A  F+GK+ L MIE +   SD +ET+   LFP++      IT   LT  FLIF TD G L+ FFIEDW Y +E++H  GI KIF +  GT I+FID+KS+ F Y+P+ ++VVEI +F   T  +LW+    +  + +   ++KLYT    ++Y           ET                    V+ +  +L+G TK P+G +P+ L NG++ L  Q+GK    VL TH+F  + L ++   + K  L    Q I +  + +AW L+  L       S E+W +L +++L  L+IDFA+RVYR++G+ GMV SL  IK  ED+NLLAGYIAMF  DFN AQD FL SS+P AAL MRRDLLHWDSALQLAKAL P QIPFIS+EYA QLEF GDY N++++YE+G+   +           EH  +C  G+ARM+IRLGD +RGV MA Q   R L K+CA ILE  KQ +EA  L+EK  Y++KA   YIR KNW KVG+LL  V+SPK+H QYAKA+EA+G YKEA  +YE AKD+DSVIR+NL+HL NP++AVRIV  T S EGA  VA+FF++L D+ASAIQFLV+SKC+ EA   AQ+H QME YA+IIGSDAT EDYQ+IA YFE  KNH+LAGKF+ L  QY +A+KH L+ +  +DS A+ +AIE +G+ANDD LTH L +YL+GE D +PK  KYLF++YMALKQ+REA RTAI+IA++EQ  GNYR AHD+LFSM QELKQ  IKIPSEM+ NLM++HSYI+AK+H+KRGDHL+GARMLIRVA +ISKFPSH+V ILTSTVIECH++GL++S FSYAAML+RP+YR+QID KY KK+E IVR+PDKT+E+EP T CP C     ET L C  CK++I YCI +GRH+ +D+   CP+C+FPA+  E  ++L E    CPMCSE V + ELK ++D+ +Y+
Sbjct:    4 VFTLNEKTHGPGGIFYQWQRSLGNYLATTGFDHNVRIFDRHGELREEINLPGLCTGFGWDVDGDVLAIINDKTGVVFLWNANSARLSQLDSGLRDSLTFLLWSKTGQQLSIGTAKGNLMIYNHQTSRKIPILGKHTKKITCGAWSSQNLLALGSQDNTLTISNAEGDTIRQTNLRAEPSDIQFSEMKGDERSQMGDNTVSIVIGRKTLYLYNINDPENPIELAFQQRYGSIVAYKWYGDGYIMIGFSQGFFVVISTHMKEIGQELFQARNHKDNLTSIAITLSLNKAASCGDNIVKIHELSDLKETYAILNLDDERQLGQINWTDDGQLLAVSTKAGSLHVYLTKLPMV--FDTYNTRLAYLTSLLEVTVQDNVSGDAPIVLAADVEPAFIGLGPYHLAVGMNNRAWFYALDCEVGAPPEKLKDREYLGTVQSLKMNADYAAVRFEGKVQLHMIEGDQGASDDRETR---LFPDKDQADTKITCHCLTPEFLIFGTDSGGLHYFFIEDWQYVNEYRHMVGIRKIFVDPTGTRIIFIDDKSDGFVYNPVNDQVVEIPDFSPTTKGILWENWLSDKGIFVAFDEEKLYT----NVYCR---------ET--------------------VNESVCELVGVTKLPYGQVPMLLYNGEVTLQTQSGKTSNLVLDTHSFDGRNLQEMPPADVKTALD---QCIKLRRYKDAWALSAHL------DSRESWLDLGRAALYNLEIDFAMRVYRQIGDVGMVMSLQAIKDSEDRNLLAGYIAMFTEDFNRAQDLFLASSNPQAALEMRRDLLHWDSALQLAKALAPDQIPFISKEYAQQLEFTGDYTNSLMHYEKGITKEEA--------YREHDENCAAGVARMSIRLGDIRRGVGMAVQMPGRALKKDCAQILENMKQWSEAAMLYEKGGYYDKAAAVYIRSKNWAKVGELLPQVTSPKIHAQYAKAKEADGRYKEAAQAYENAKDWDSVIRINLDHLQNPEDAVRIVRETQSVEGAKMVAKFFLKLNDYASAIQFLVMSKCNDEAFQLAQQHDQMEVYAEIIGSDATAEDYQSIALYFENEKNHFLAGKFFFLCAQYGRALKHFLRCSNSDDSKAIGMAIETVGQANDDALTHQLFDYLLGETDGVPKASKYLFRLYMALKQFREAARTAIIIAREEQNAGNYRDAHDVLFSMYQELKQQKIKIPSEMAHNLMILHSYILAKVHVKRGDHLKGARMLIRVANNISKFPSHIVQILTSTVIECHKAGLKNSCFSYAAMLMRPEYRNQIDVKYKKKIEQIVRKPDKTEEDEPTTPCPQCGYAQAETELVCPNCKNNIPYCIITGRHMTKDNVTACPRCDFPALKDEFLSVL-ETEENCPMCSEMVKSEELKDVMDLNKYM 1340          
BLAST of WD repeat domain 19 vs. Ensembl Cavefish
Match: wdr19 (WD repeat domain 19 [Source:ZFIN;Acc:ZDB-GENE-090313-277])

HSP 1 Score: 1465.67 bits (3793), Expect = 0.000e+0
Identity = 715/1392 (51.36%), Postives = 974/1392 (69.97%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEA-KKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQ-YFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQK 4240
            VFT+ E+      + + WQK  GNYLA+ G +  V I+DRHG  +N+++L G+CV LDWD+ GD+LA+I  KS +++LWD +++K S++++G +D LSF+ WSK    LAVGTSKGNLL+YN   SRK+P+LGKH+K+ITCG WS + LLALGSEDR  T+SN EG+TI+Q  +R  P++IQFS +K DE+SS  E+T++  +  +TLFLF L D +NP E+AFQ++YGNI+ Y+W+GDGYIM+GFSHGY VVISTH +EIGQE+ Q  ++KD+L SI IS++L++A + GD CVKIHDL  LKE+ AI+ L+E+ +   +  W++DGQLLAIS+  G +HV+LT+LP+L    I GT+IA+LTSL EV+V N      +  + +E+EP FI VG  HL VGMNN+ W+Y         + + EY+ TV  L LN  Y+AA F+GK+ L  IE+  + + +E +  KLFP+ P     I S  LT+ FL F TD G +  F+IEDW   +E++H  GI K+F +  GT ++FID+KS+ F Y P+++ + EI +F      VLW+   ++ S+ +   +DK+YTY   + + +T +G                              +K+ L+G TK PF H PL L NG++    Q+GK    +L TH+F   L+   +   KE LQ    QAI +  F+EAW + + L S       E W EL ++ L  ++++ AIRVYR +GN GMV SL  IK IED++LLAG++AMFLND+N AQD +L SS P AAL MRRDL HWDSALQLAK L P +IPFIS+EYA QLEF+GDY NA+ +YE+G                EH  SC  G+ARM+IR+GD +RG   A +  +R L KEC  ILE  KQ +EA  L+EK QY++KA + YIR KNW KVG+LL HVSSPK+HLQYAKA+EA+G YKEA  +YE A+D+D++IR+ LEHLNNP+EAVRIV  T S +GA  VA+FF+RL D+ SAIQFLV+S+C  EA   AQ+HGQME YA IIGS+AT EDYQ+IA YFE  K H  AGKF+    QY +A+KH LK    +D+ A+++AIE +G A D+ LT+ L++YLMGE D +PK+ KYLF++YMALKQYRE+ RTAI+IA++EQ  GNYR AHD+LFSM  EL+   IKIP+EM++NLM++HSYI+ K+H+KRGDHL+GARMLIRV+ +ISKFPSH+VPILTS VIECHR+GL++SSFS+AAML+RP+YR++IDPKY KK+E +VRRPD ++ EE  + CP+C   + E  L C  CK+++ YCIA+GRH++++D  +CP C+FPA+ ++   LL E  S CPMCSE +S N+L+ I D + +LQ+
Sbjct:    4 VFTLSEKGWSGSALQYRWQKALGNYLAVAGPDNSVKIFDRHGQKMNELSLPGRCVSLDWDKDGDILAVIAEKSSSIHLWDANVNKTSQLDSGMRDQLSFLLWSKTGPLLAVGTSKGNLLIYNQQTSRKIPVLGKHTKRITCGCWSSQNLLALGSEDRNITVSNHEGDTIRQTSVRADPADIQFSVMKTDERSSPGESTVSVAVGKKTLFLFNLNDPDNPIELAFQQRYGNIISYRWYGDGYIMIGFSHGYFVVISTHIREIGQELFQAHNHKDSLTSIAISQALNKAASCGDNCVKIHDLTDLKEMDAIVTLEEETKGLDQICWTDDGQLLAISSQQGSLHVYLTKLPILGG--ICGTRIAYLTSLLEVTVANQVEGDPTMAVAVEVEPNFIAVGPYHLAVGMNNRAWFYALGNTGVARLKDMEYLGTVVSLSLNCDYAAALFEGKVQLHAIEDE-DQNVEEDRQTKLFPD-PDQKYRILSHALTTEFLFFGTDTGLIQCFYIEDWQSVNEYRHPVGIRKVFPDPNGTRLVFIDDKSDGFLYCPVDDSLFEIPDFSPMITGVLWENWVNDKSVFVAFDEDKVYTY---AFHKDTVQG------------------------------SKVILVGSTKLPFSHKPLLLYNGELTCQTQSGKTSNVILSTHSF---LSDTHADSRKEQLQSLLQQAIKLKRFTEAWSVCKSLGS------AEAWAELGRACLHHMEVELAIRVYRSMGNVGMVLSLEDIKGIEDQSLLAGHLAMFLNDYNQAQDLYLASSYPMAALEMRRDLQHWDSALQLAKRLRPEEIPFISKEYAIQLEFVGDYTNALAHYEKGF--------------QEHDESCQAGVARMSIRMGDIRRGANQAIKHPSRTLKKECGAILESMKQYSEAAQLYEKGQYYDKAASVYIRCKNWAKVGELLPHVSSPKIHLQYAKAKEADGKYKEAAMAYESARDWDNMIRILLEHLNNPEEAVRIVRETQSIDGAKMVARFFLRLNDYGSAIQFLVMSRCSDEAFQLAQQHGQMEVYADIIGSEATAEDYQSIALYFEGEKKHLHAGKFFHKCGQYSRALKHFLKCPNTDDNLAIEMAIETVGEAKDEALTNQLIDYLMGESDGMPKDAKYLFRLYMALKQYRESARTAIIIAREEQSAGNYRNAHDVLFSMYMELQTQKIKIPAEMATNLMILHSYILVKIHVKRGDHLKGARMLIRVSNNISKFPSHIVPILTSAVIECHRAGLKNSSFSFAAMLMRPEYRNKIDPKYKKKIEAMVRRPDTSEVEEESSPCPYCGFSLPECELLCPGCKNNLPYCIATGRHMVKEDWCVCPHCDFPALYTQFTQLL-ESESTCPMCSESLSVNQLQKISDCSRFLQQ 1334          
BLAST of WD repeat domain 19 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003023.1 (pep scaffold:Pmarinus_7.0:GL476533:253722:274137:-1 gene:ENSPMAG00000002733.1 transcript:ENSPMAT00000003023.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1462.97 bits (3786), Expect = 0.000e+0
Identity = 711/1391 (51.11%), Postives = 976/1391 (70.17%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEA-KKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYR-ENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQ 4237
            VF++ E+ +    + + WQKT GNYLA+ GS     IYDRHG  ++ INL GKC+  DWD+ GD LA+I  KS ++YLWD +  K S++++G +D ++F++W +    LAVGT+KGNLLLYNH  SRK+PILGKH+K+ITCG WS + LLALGSED++ T+SN EG+TI+Q  +R  PS + FS +K DE+++  ENT++  +  +TLFLF + D +NP E+AFQ +YG+IV Y+W+GDGYIM+GFS GY VVISTH +EIGQE+ Q  ++KD+L SI IS+SL +A + GD C+KIHDL+ LKE+ AII LD++ +   K  W++DGQLLAIST+ G +HVFLT+LP+L   D   T+IA+LTSL EV++ N         + I++EP FI VG  HL VGMNN+ W Y    +     + ++EY+ TV+ ++LN  Y+AA F+GK+ L M+E +   DG+E +  +LFP        IT   LT++FLI++TD G +  FF+EDW + +E+KH  GI K+F +  GT ++ ID+K + + YSP+ + + EI         +LW+    +  + +   DDK+YTY                               Y  +   G   +K+ L G TK PF   PL L NG++     +GK    +LG+HAF   L+ +      E  +   Q++M+  F +AW + E+L+       +  W E+A++SL  ++++FAIRVYR L N GMV +L  IK +ED NLLAG++AM   DFNLAQD FL+SS+P AAL MRRDL +WDSALQLAK L P+QIPFIS+EYA QLEF GDYVNA+ +YE+G+ N++        + +EH  +C  G+ARMA+R+GD +RGV +A + ++R+L ++CA ILE  KQ +EA  L+EK QY +KA + YIR KNW KVG+LL HV+SPK+HLQYAKA+EA+G YKEA  +YE AKDYD++IRV LEHLN+P+EAVR+V  T S EGA  VA+FF+RL D+ SAIQFLV+SKC++EA   AQ+H QME YA IIG+DAT EDYQ+IA +FE  K H+LAGKF+LL  QY KA+KH L     ++  A+D+AIE +GRA D  LT++L+++LMGE D +PK+ KYLF++YMALKQY EA RTAI+IA++EQ  GNYR AHD+LFSM  ELK   I++P+EM++NLM++HSY++ K+H++RGDH++GARMLIRVA +IS+FPSH+V ILTSTVIECHR+GL++SSFSYAAML+RP+YR +IDPKY KK+E IVRRPD ++ EEP + CPFCS  + E  L C +CK+++ YCIA+GRH+ +DD  ICP C FPA+ SE ++LL E  S CPMCSE V A ++K I D + YL+
Sbjct:    4 VFSLTERNNTGGPLLYGWQKTLGNYLALSGSESSAKIYDRHGQKIDLINLPGKCLGFDWDKDGDTLALIAEKSSSIYLWDANTHKTSQVDSGMRDQMTFLRWGRSSAMLAVGTAKGNLLLYNHQTSRKIPILGKHTKRITCGCWSAQDLLALGSEDKSITVSNPEGDTIRQASIRADPSEMLFSVMKTDERNNYGENTVSVMVGKKTLFLFNMNDPDNPIELAFQPRYGSIVSYRWYGDGYIMIGFSQGYFVVISTHMREIGQELFQAHNHKDSLTSIAISQSLGKAASCGDNCIKIHDLSELKEMYAIITLDDEIKGLDKLAWTDDGQLLAISTLRGSLHVFLTKLPVLG--DTFSTRIAYLTSLLEVTIANSVEGEPPVTVAIDVEPNFIAVGPYHLAVGMNNRAWVYALSESGAVERLKDREYLGTVSSMRLNADYAAALFEGKVQLHMVE-AQGPDGQEERETRLFPSGDDR-SRITCHALTADFLIYATDAGGIFYFFLEDWQFVNEYKHMVGIRKLFPDTSGTQLVIIDDKGDGYVYSPVNDSLFEIPNLSPTIKGILWENFPLDRGVFVAYDDDKIYTYA------------------------------YHKDTIAG---SKVILAGGTKLPFSQKPLLLYNGELTCQTGSGKTNNLLLGSHAF---LSPMADRPQPECARLLTQSLMLRRFKDAWTICEQLSD------SAAWNEMARASLYHMEVEFAIRVYRMLSNGGMVLALENIKAVEDHNLLAGHLAMLSEDFNLAQDLFLSSSNPVAALEMRRDLQNWDSALQLAKRLAPNQIPFISKEYAMQLEFTGDYVNALAHYEKGIVNDN--------NYTEHDEACRAGVARMALRMGDIRRGVSLALKHSSRILKRDCAAILESMKQFSEAAQLYEKGQYHDKAASVYIRSKNWVKVGELLSHVASPKIHLQYAKAKEADGRYKEAALAYENAKDYDAMIRVLLEHLNSPEEAVRVVRETQSIEGAKMVARFFLRLSDYGSAIQFLVMSKCNNEAFQLAQQHQQMEVYADIIGADATPEDYQSIAMHFENEKKHFLAGKFFLLCQQYSKALKHFLLCQGADNGQAIDMAIETVGRAKDMMLTNHLIDHLMGETDGMPKDAKYLFRLYMALKQYHEAARTAIIIAREEQAAGNYRSAHDMLFSMYVELKAQQIRVPAEMATNLMILHSYVLVKMHVRRGDHMKGARMLIRVANNISRFPSHIVQILTSTVIECHRAGLKNSSFSYAAMLMRPEYRGKIDPKYKKKIEAIVRRPDTSEAEEPSSRCPFCSFQLPECELVCPDCKNTLPYCIATGRHMAKDDWGICPHCSFPALYSEFKSLL-ESESTCPMCSEKVGAEQIKKIEDPSGYLR 1339          
BLAST of WD repeat domain 19 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010689.1 (pep scaffold:Pmarinus_7.0:GL477043:7942:58124:-1 gene:ENSPMAG00000009672.1 transcript:ENSPMAT00000010689.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 3.745e-7
Identity = 63/232 (27.16%), Postives = 109/232 (46.98%), Query Frame = 2
Query: 2699 GDTKRGVMMAEQSNNRLLMKEC----AMILEQTKQMAEAGALFEKAQ---------YFEK--AITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHY-LAGKFYLLACQYEKAIK 3346
            G  ++ V  AE +N+R+ ++      A  LE+T     A   +EK++          FE   A+  YI   N NK   LLK          +A+  E+ G    A+ +YE A DY S++RV    L N ++A  I + T +K  ++++A+ +    DF  AI F   ++  + A+   +EH +++     +   +T ED  + A Y+E++ N    A   Y  A  + KA++
Sbjct:  891 GQWQKAVETAE-TNDRVHLRTTYYNKAKYLEETGDFDAAITYYEKSETHKFEVPRMLFEDQHALENYI---NKNKDVSLLK---------WWAQYLESTGAMDAALKAYESAHDYLSLVRVYC-FLGNTQKASEIASETGNKAASYHLARQYEAQDDFKQAINFYTRAQAFNNAIRLCKEH-KLDDQLMNLALLSTPEDMMDTAQYYEENGNQMDRAVMLYHKAGHFSKALE 1107          
BLAST of WD repeat domain 19 vs. Ensembl Nematostella
Match: EDO29788 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2M7])

HSP 1 Score: 870.922 bits (2249), Expect = 0.000e+0
Identity = 472/1018 (46.37%), Postives = 653/1018 (64.15%), Query Frame = 2
Query:   71 VFTIKEQISENH-VVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQL-DEDGEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMI--ENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGT---HAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQ 3103
            VFTI E+++     V++ WQ   GN+LA+ GSN  V IYDRHG+ +++I+L G  + +  +  GD LAII +K+  +YLWD +  K +++E+G +D+L+F+ WSK   QLA+GTSKGNLL+YNH  SRK+PILGKH+KKI+CG W+ E LLALGSED++ T+SN++G+TI+Q  LR  P+++QFSE+K DE+SS  E T++  +  +TL+L+ L D ENP E+AFQ +YGNI+ Y+WFGDGYIM+GFS+G+ VVISTH KEIGQE+ Q +D+KD L  I IS  L++A + GD CVKIHDL  +KE+ AII L D  GE     W      LA + ++  +HV+LT+LP+L     SGT++A+LT+LREV   ++     S  + I +EP F+ +G  HL VGMNN+ W+Y    +    + ++EY+ TV  + LN  Y+A  F+ K+ L +I  EN+  SD +ET   +LFP++    +  T   LTS+FLI+ TD G L+ FFIEDW + +EF+H  GI KIF +  GT ++FID KS+ F Y+P+ +   EI  F      ++W+    +  +     D+K+YTY     Y  T                              ++     + G TK P+   PL L +G++     +GK+  +   T   H ++     L      +L   F Q +++  F EAW +A+ +       S E WKEL K ++ CL++  AI+VYR++G+  MV SL KIK  EDKNLLAGY+AMFL D+N AQD FL SS P AAL MRRDLLHWD AL+LAK+L P  IP+ISREYA QLEF GDY N++++YERG        I    +  +H  +C  G+ARMAIR+GD +RGV  A +S  R L KECA ILE  KQ +E+  L+EK QY++KA   Y++ KNW KVG+LL HV+SPKLH QYAKAREA+G Y+EA  +YE AKDYD+VIR+NL+ L NP+EAVRIV  T S EGA  VA+
Sbjct:    4 VFTIPEKVTGGGGSVSYCWQVKQGNFLAVTGSNRVVCIYDRHGDQLDEISLPGYSITISNEDDGDTLAIIQDKNGIIYLWDANSLKTTQLESGLRDTLTFLLWSKVGPQLAIGTSKGNLLIYNHQTSRKIPILGKHTKKISCGCWNTENLLALGSEDKSITISNEDGDTIRQATLRSEPAHVQFSEMKTDERSSAAEATVSIIVGKKTLYLYNLNDPENPIELAFQSRYGNIIAYRWFGDGYIMIGFSNGFFVVISTHMKEIGQELFQTRDHKDVLTDIAISTELNKAASCGDNCVKIHDLVEMKEIYAIITLEDAGGELSLLCWRLP---LAHTEVSCAIHVYLTKLPILGYA--SGTRLAYLTALREVHSMHIIERPQS--VDIVVEPTFVSLGPYHLAVGMNNRAWFYMLGDKGTEQLKDREYLGTVNAIHLNADYAAVLFENKVQLHLIEGENTDTSDERET---RLFPDKSSQGK-ATCCALTSDFLIYGTDNGGLHYFFIEDWQFVNEFRHVVGIRKIFPDPSGTRLVFIDEKSDGFVYNPVNDATFEIPNFSPTIKGIVWENWALDKDVFCGYDDEKIYTYI---FYKET------------------------------ITGPHCIMAGSTKLPYAQKPLMLYDGEMTCQTLSGKVHRDNAATPREHVYRNHQLLLPP----QLKNCFSQCLLLKRFKEAWAVAKVM------DSQEAWKELGKKAVSCLELGLAIKVYRKIGDVAMVLSLEKIKETEDKNLLAGYVAMFLEDYNAAQDLFLASSHPTAALEMRRDLLHWDQALELAKSLAPEHIPYISREYAQQLEFTGDYSNSLIHYERG--------ITKLPEKRDHDEACVGGMARMAIRVGDIRRGVQYATKSPGRQLKKECAAILESMKQYSESALLYEKGQYWDKAAAVYMKTKNWAKVGELLNHVTSPKLHAQYAKAREADGKYREAAKAYEAAKDYDNVIRINLDFLQNPEEAVRIVKETQSVEGAKMVAK 959          
BLAST of WD repeat domain 19 vs. Ensembl Medaka
Match: wdr19 (WD repeat domain 19 [Source:NCBI gene;Acc:101165282])

HSP 1 Score: 1328.15 bits (3436), Expect = 0.000e+0
Identity = 661/1395 (47.38%), Postives = 937/1395 (67.17%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGF-KDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEA-KKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYR--ENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSP--LEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQ 4237
            VF + ++      + ++WQK+ GNY+A+ G +  V I+DR+G+   ++NL G+C+ +DWD  GD+LA+I  KS ++YLWD  ++K S+I++G  KD +SF+ WSK    LAVGT+KGNLL+YN   SRK+P+LGKH+K+ITCG W+ + LLALGS+D T T+SN EG+TI Q  LR  P +I FS +K DE+SS  E+T++  +  ++L LF + D ENP ++AFQ  YG+IV Y W+GDGYI++GFSHGY +VISTH +EIG EI Q ++ +D+L S+ +S +L +A + GD  +K+H+L+  K +++++QLDED +   + +W++DGQL A+ST  G +HVFL +LP+L   D  GT++A+LTSL E++V N         + +E+EP FI VG  H+ VGMNN+ W+Y   +    ++L+ + EY+ T+  + LN  Y+AA F+GK+ L MIE+ ++   +E K  KLFP+       I    LTS+FL + TD G +    +EDW   S + H  G+ K+F +  GT ++FID++++ F  SP  +     E+  F      VLWD  + +  + +   +DK+YTY                         F    +YG          ++ L+G     F   PL L NG++     +G+     L TH+F +      + + +EL +   +A+ +  F EAW L       + A S+ +W  L ++ L  ++++ AIRVYR  GN  MV SL  I+ IEDKNLLAG++AMFL D+N+AQD FL+SS P  AL MRR+LLHWDSAL LAK L   QIP+IS+EYA  LEF+GDYVNA+ +YE+G  ++D          SEH  +C  G+ARM+IR+GD +RG  +A Q  +RLL KEC  ILE  KQ +EA  L+EK Q+++KA   YIR KNW KV +LL +VSSPK+HLQYAKA+EA+G YKEA   YE AKD+D+VIRV L+HLNNP +AVRIV  T S +GA  VA+FF+RL D+ SAI FLVLS+C+ EA H AQ+HGQME YA IIGS+AT EDYQ+IA YFE  K H  AGKF+    QY +A+KH LK +  ED+ A+++AIE +G+A D  LT+ L+++L+GE D +PK+ KYLF++YMAL+QYREA RTAI+IA++EQ  G+Y  AH++LFSM  EL+ + IKIP+EM++NLM++HSY++A+++ KRGDHL+ ARMLIRV+ +ISKFP+HVVPILTS VIEC R+GL+ S+FS+A+ML+RPDYR+ +DPK+ KK E++VR P  ++ +E  T CP+C   + E  L C  CK++I YCIA+GRH+I++D   CP C+FPA+ S+   L  E  + CPMC E +SA ELK I D ++YLQ
Sbjct:    4 VFILADKAWTGSNLLYKWQKSLGNYIAVAGQDNSVKIFDRYGHKWTELNLPGRCMGMDWDNDGDILAVIAAKSVSIYLWDASVNKTSQIDSGLNKDQMSFILWSKTGPLLAVGTAKGNLLIYNRQTSRKIPVLGKHTKRITCGCWNSQNLLALGSDDNTLTISNHEGDTISQAALRGEPGDIYFSSMKTDERSSHGESTVSVIVDKKSLMLFNINDPENPIKLAFQRTYGSIVSYHWYGDGYILIGFSHGYFIVISTHIREIGHEIYQTRNQEDSLNSVAVSPALHKAASCGDNSIKVHELSESKYISSVVQLDEDIKGLDQISWTDDGQLFAVSTKKGALHVFLFKLPILG--DSYGTRLAYLTSLLEITVSNQVEGEKPVTIEVEVEPTFIAVGPYHVAVGMNNRAWFYALDDQKPGFNLLKDTEYLGTIVSMHLNSDYAAALFEGKVQLHMIESRHQ---EERKQMKLFPDDVKK-SRILCHALTSDFLYYGTDMGNVVCVLVEDWETLSTYSHPVGVRKVFPDANGTHVVFIDDENSGFLLSPANVTASCFELPNFSPTITGVLWDTWHADRGVFVAYDNDKVYTYA------------------------FHKTTVYG---------PRVVLVGSAALLFSQKPLLLYNGELTCQTSSGRTSELALSTHSFLRPPTG-SAADPEELRKQLAEALQLKRFQEAWDLC------NSAGSSADWAALGRACLVHMEVELAIRVYRISGNRDMVLSLQSIQGIEDKNLLAGHLAMFLEDYNVAQDLFLSSSCPITALEMRRELLHWDSALLLAKRLAEDQIPYISKEYAIHLEFVGDYVNALAHYEKGNTHSD----------SEHDETCQAGVARMSIRMGDVRRGAALAVQHPSRLLKKECGAILESMKQFSEAAQLYEKGQFYDKAALVYIRCKNWAKVEELLPNVSSPKIHLQYAKAKEADGKYKEAALGYESAKDWDNVIRVLLDHLNNPDDAVRIVRETQSIDGAKMVARFFLRLNDYGSAIHFLVLSQCNEEAFHLAQQHGQMEVYAAIIGSEATQEDYQSIALYFEGEKKHLQAGKFFQKCGQYSRALKHFLKCSNTEDNQAIEMAIETVGQAKDMTLTNQLIDFLLGESDGMPKDAKYLFRLYMALQQYREAARTAIIIAREEQCAGSYLNAHNVLFSMYTELQAHKIKIPAEMATNLMILHSYLLARIYTKRGDHLKAARMLIRVSNNISKFPAHVVPILTSAVIECQRAGLKKSAFSFASMLMRPDYRNDVDPKFRKKFESLVRHPQMSELDEETTPCPYCGFQLPENELLCIACKNNIPYCIATGRHLIKEDWSTCPHCDFPALYSQFI-LFLETETACPMCFENLSAKELKKIPDCSKYLQ 1341          
BLAST of WD repeat domain 19 vs. Ensembl Medaka
Match: wdr19 (WD repeat domain 19 [Source:NCBI gene;Acc:101165282])

HSP 1 Score: 1286.17 bits (3327), Expect = 0.000e+0
Identity = 642/1339 (47.95%), Postives = 901/1339 (67.29%), Query Frame = 2
Query:  239 LDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGF-KDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEA-KKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYR--ENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSP--LEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTSTVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQ 4237
            +DWD  GD+LA+I  KS ++YLWD  ++K S+I++G  KD +SF+ WSK    LAVGT+KGNLL+YN   SRK+P+LGKH+K+ITCG W+ + LLALGS+D T T+SN EG+TI Q  LR  P +I FS +K DE+SS  E+T++  +  ++L LF + D ENP ++AFQ  YG+IV Y W+GDGYI++GFSHGY +VISTH +EIG EI Q ++ +D+L S+ +S +L +A + GD  +K+H+L+  K +++++QLDED +   + +W++DGQL A+ST  G +HVFL +LP+L   D  GT++A+LTSL E++V N         + +E+EP FI VG  H+ VGMNN+ W+Y   +    ++L+ + EY+ T+  + LN  Y+AA F+GK+ L MIE+ ++   +E K  KLFP+       I    LTS+FL + TD G +    +EDW   S + H  G+ K+F +  GT ++FID++++ F  SP  +     E+  F      VLWD  + +  + +   +DK+YTY                         F    +YG          ++ L+G     F   PL L NG++     +G+     L TH+F +      + + +EL +   +A+ +  F EAW L       + A S+ +W  L ++ L  ++++ AIRVYR  GN  MV SL  I+ IEDKNLLAG++AMFL D+N+AQD FL+SS P  AL MRR+LLHWDSAL LAK L   QIP+IS+EYA  LEF+GDYVNA+ +YE+G  ++D          SEH  +C  G+ARM+IR+GD +RG  +A Q  +RLL KEC  ILE  KQ +EA  L+EK Q+++KA   YIR KNW KV +LL +VSSPK+HLQYAKA+EA+G YKEA   YE AKD+D+VIRV L+HLNNP +AVRIV  T S +GA  VA+FF+RL D+ SAI FLVLS+C+ EA H AQ+HGQME YA IIGS+AT EDYQ+IA YFE  K H  AGKF+    QY +A+KH LK +  ED+ A+++AIE +G+A D  LT+ L+++L+GE D +PK+ KYLF++YMAL+QYREA RTAI+IA++EQ  G+Y  AH++LFSM  EL+ + IKIP+EM++NLM++HSY++A+++ KRGDHL+ ARMLIRV+ +ISKFP+HVVPILTS VIEC R+GL+ S+FS+A+ML+RPDYR+ +DPK+ KK E++VR P  ++ +E  T CP+C   + E  L C  CK++I YCIA+GRH+I++D   CP C+FPA+ S+   L  E  + CPMC E +SA ELK I D ++YLQ
Sbjct:    3 MDWDNDGDILAVIAAKSVSIYLWDASVNKTSQIDSGLNKDQMSFILWSKTGPLLAVGTAKGNLLIYNRQTSRKIPVLGKHTKRITCGCWNSQNLLALGSDDNTLTISNHEGDTISQAALRGEPGDIYFSSMKTDERSSHGESTVSVIVDKKSLMLFNINDPENPIKLAFQRTYGSIVSYHWYGDGYILIGFSHGYFIVISTHIREIGHEIYQTRNQEDSLNSVAVSPALHKAASCGDNSIKVHELSESKYISSVVQLDEDIKGLDQISWTDDGQLFAVSTKKGALHVFLFKLPILG--DSYGTRLAYLTSLLEITVSNQVEGEKPVTIEVEVEPTFIAVGPYHVAVGMNNRAWFYALDDQKPGFNLLKDTEYLGTIVSMHLNSDYAAALFEGKVQLHMIESRHQ---EERKQMKLFPDDVKK-SRILCHALTSDFLYYGTDMGNVVCVLVEDWETLSTYSHPVGVRKVFPDANGTHVVFIDDENSGFLLSPANVTASCFELPNFSPTITGVLWDTWHADRGVFVAYDNDKVYTYA------------------------FHKTTVYG---------PRVVLVGSAALLFSQKPLLLYNGELTCQTSSGRTSELALSTHSFLRPPTG-SAADPEELRKQLAEALQLKRFQEAWDLC------NSAGSSADWAALGRACLVHMEVELAIRVYRISGNRDMVLSLQSIQGIEDKNLLAGHLAMFLEDYNVAQDLFLSSSCPITALEMRRELLHWDSALLLAKRLAEDQIPYISKEYAIHLEFVGDYVNALAHYEKGNTHSD----------SEHDETCQAGVARMSIRMGDVRRGAALAVQHPSRLLKKECGAILESMKQFSEAAQLYEKGQFYDKAALVYIRCKNWAKVEELLPNVSSPKIHLQYAKAKEADGKYKEAALGYESAKDWDNVIRVLLDHLNNPDDAVRIVRETQSIDGAKMVARFFLRLNDYGSAIHFLVLSQCNEEAFHLAQQHGQMEVYAAIIGSEATQEDYQSIALYFEGEKKHLQAGKFFQKCGQYSRALKHFLKCSNTEDNQAIEMAIETVGQAKDMTLTNQLIDFLLGESDGMPKDAKYLFRLYMALQQYREAARTAIIIAREEQCAGSYLNAHNVLFSMYTELQAHKIKIPAEMATNLMILHSYLLARIYTKRGDHLKAARMLIRVSNNISKFPAHVVPILTSAVIECQRAGLKKSAFSFASMLMRPDYRNDVDPKFRKKFESLVRHPQMSELDEETTPCPYCGFQLPENELLCIACKNNIPYCIATGRHLIKEDWSTCPHCDFPALYSQFI-LFLETETACPMCFENLSAKELKKIPDCSKYLQ 1284          
BLAST of WD repeat domain 19 vs. Planmine SMEST
Match: SMESG000052128.1 (SMESG000052128.1)

HSP 1 Score: 2540.76 bits (6584), Expect = 0.000e+0
Identity = 1237/1239 (99.84%), Postives = 1238/1239 (99.92%), Query Frame = 2
Query:   71 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFXXXXXXXXXXXXXNTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPS 3787
            VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLE KCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFSEIKEDEKSSIKENTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNY+SEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPS
Sbjct:    4 VFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQINLECKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFSEIKEDEKSSIKENTLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFSHGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKIHDLNALKELTAIIQLDEDGEAKKCNWSEDGQLLAISTITGHVHVFLTRLPMLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASHLGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIMLQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYLNIFFIEDWNYASEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEEVVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGDEDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLKNGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNYFSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAGMVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRDLLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNNDGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKECAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSPKLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIVNATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMETYAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPS 1242          

HSP 2 Score: 331.643 bits (849), Expect = 3.598e-93
Identity = 159/160 (99.38%), Postives = 160/160 (100.00%), Query Frame = 2
Query: 3230 SDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKL 3709
            SDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAK+
Sbjct: 1244 SDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKVTYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMYMALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSEMSSNLMLIHSYIIAKV 1403          
BLAST of WD repeat domain 19 vs. Planmine SMEST
Match: SMESG000052127.1 (SMESG000052127.1)

HSP 1 Score: 272.322 bits (695), Expect = 1.519e-84
Identity = 129/130 (99.23%), Postives = 130/130 (100.00%), Query Frame = 2
Query: 3869 MLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQKFNQSIE 4258
            MLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEY+QKFNQSIE
Sbjct:    1 MLLRPDYRDQIDPKYVKKMETIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYIQKFNQSIE 130          
BLAST of WD repeat domain 19 vs. Planmine SMEST
Match: SMESG000052127.1 (SMESG000052127.1)

HSP 1 Score: 233.417 bits (594), Expect = 3.575e-71
Identity = 111/112 (99.11%), Postives = 112/112 (100.00%), Query Frame = 2
Query: 3923 METIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQKFNQSIE 4258
            METIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEY+QKFNQSIE
Sbjct:    1 METIVRRPDKTQEEEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCEFPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYIQKFNQSIE 112          
BLAST of WD repeat domain 19 vs. Planmine SMEST
Match: SMESG000011293.1 (SMESG000011293.1)

HSP 1 Score: 52.373 bits (124), Expect = 2.509e-6
Identity = 34/124 (27.42%), Postives = 67/124 (54.03%), Query Frame = 2
Query:  236 MLDWDQQGDVLAIIDNKSPAVYLWDV---HLDKMSKIETGFKDSLSFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEEGLLALGSEDRTFTLSNDEGETIKQVPLRD 598
            ++DW  Q +VLA+       VYLW+     ++++  + +   D+++ V W +  T++AVGT  G + +++    +++  L  H+ ++   AW+ E LLA GS DR   L +    + +  PL++
Sbjct:  181 LVDWSSQ-NVLAV--GLGTCVYLWNAVSSEINRLCDVNSD-SDTITSVAWCEKGTRVAVGTHHGKVQIWDAAAEQQLQTLEGHTARVGTLAWNAE-LLASGSRDRNVHLRDTRTSSTEFKPLKE 299          
The following BLAST results are available for this feature:
BLAST of WD repeat domain 19 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR190.000e+050.61WD repeat domain 19 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WDR192.530e-14347.81WD repeat domain 19 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WDR195.558e-4857.48WD repeat domain 19 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WDR191.791e-2444.79WD repeat domain 19 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WDR192.515e-2445.74WD repeat domain 19 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of WD repeat domain 19 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dyf-20.000e+034.83WD repeat-containing protein dyf-2 [Source:UniPro... [more]
dyf-24.424e-15342.52WD repeat-containing protein dyf-2 [Source:UniPro... [more]
dyf-24.424e-15342.52WD repeat-containing protein dyf-2 [Source:UniPro... [more]
osm-11.998e-723.08Intraflagellar transport protein osm-1 [Source:Un... [more]
back to top
BLAST of WD repeat domain 19 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Oseg60.000e+037.59gene:FBgn0034452 transcript:FBtr0086501[more]
back to top
BLAST of WD repeat domain 19 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr190.000e+052.40WD repeat domain 19 [Source:ZFIN;Acc:ZDB-GENE-0903... [more]
wdr190.000e+052.55WD repeat domain 19 [Source:ZFIN;Acc:ZDB-GENE-0903... [more]
BX005212.10.000e+052.40WD repeat domain 19 [Source:NCBI gene;Acc:556414][more]
wdr190.000e+048.77WD repeat domain 19 [Source:ZFIN;Acc:ZDB-GENE-0903... [more]
BX005212.10.000e+048.65WD repeat domain 19 [Source:NCBI gene;Acc:556414][more]
back to top
BLAST of WD repeat domain 19 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk80.000e+050.00cyclin-dependent kinase 8 [Source:Xenbase;Acc:XB-G... [more]
cdk80.000e+048.22cyclin-dependent kinase 8 [Source:Xenbase;Acc:XB-G... [more]
cdk80.000e+048.49cyclin-dependent kinase 8 [Source:Xenbase;Acc:XB-G... [more]
cdk80.000e+046.41cyclin-dependent kinase 8 [Source:Xenbase;Acc:XB-G... [more]
wdr190.000e+048.74WD repeat domain 19 [Source:NCBI gene;Acc:10014472... [more]
back to top
BLAST of WD repeat domain 19 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Wdr190.000e+050.61WD repeat domain 19 [Source:MGI Symbol;Acc:MGI:244... [more]
Wdr190.000e+050.61WD repeat domain 19 [Source:MGI Symbol;Acc:MGI:244... [more]
Wdr191.823e-2751.49WD repeat domain 19 [Source:MGI Symbol;Acc:MGI:244... [more]
back to top
BLAST of WD repeat domain 19 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q3UGF1|WDR19_MOUSE0.000e+050.61WD repeat-containing protein 19 OS=Mus musculus OX... [more]
sp|Q8NEZ3|WDR19_HUMAN0.000e+050.61WD repeat-containing protein 19 OS=Homo sapiens OX... [more]
sp|G5ECZ4|DYF2_CAEEL0.000e+034.83WD repeat-containing protein dyf-2 OS=Caenorhabdit... [more]
sp|Q22830|OSM1_CAEEL2.542e-623.08Intraflagellar transport protein osm-1 OS=Caenorha... [more]
back to top
BLAST of WD repeat domain 19 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E7FGG50.000e+052.40WD repeat domain 19 OS=Danio rerio OX=7955 GN=wdr1... [more]
A0A2R8RPA60.000e+052.55WD repeat domain 19 OS=Danio rerio OX=7955 GN=wdr1... [more]
A0A210QC010.000e+052.62WD repeat-containing protein 19 OS=Mizuhopecten ye... [more]
A0A2R8RPG40.000e+052.40WD_REPEATS_REGION domain-containing protein OS=Dan... [more]
A0A1S3K5670.000e+052.76WD repeat-containing protein 19 OS=Lingula unguis ... [more]
back to top
BLAST of WD repeat domain 19 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wdr190.000e+051.36WD repeat domain 19 [Source:ZFIN;Acc:ZDB-GENE-0903... [more]
back to top
BLAST of WD repeat domain 19 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003023.10.000e+051.11pep scaffold:Pmarinus_7.0:GL476533:253722:274137:-... [more]
ENSPMAT00000010689.13.745e-727.16pep scaffold:Pmarinus_7.0:GL477043:7942:58124:-1 g... [more]
back to top
BLAST of WD repeat domain 19 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat domain 19 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO297880.000e+046.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat domain 19 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wdr190.000e+047.38WD repeat domain 19 [Source:NCBI gene;Acc:10116528... [more]
wdr190.000e+047.95WD repeat domain 19 [Source:NCBI gene;Acc:10116528... [more]
back to top
BLAST of WD repeat domain 19 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000052128.13.598e-9399.84SMESG000052128.1[more]
SMESG000052127.11.519e-8499.23SMESG000052127.1[more]
SMESG000052127.13.575e-7199.11SMESG000052127.1[more]
SMESG000011293.12.509e-627.42SMESG000011293.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025283 ID=SMED30025283|Name=WD repeat domain 19|organism=Schmidtea mediterranea sexual|type=transcript|length=4376bp
TGAAATCGTTTAAAAAACAATTTTTAACGAAAATATAAAAATAATTCGAA
TAATTTCATAAATGAAGAAAGTTTTCACGATTAAGGAACAAATTAGTGAA
AATCATGTTGTAAATTTTGAATGGCAAAAAACTCACGGAAATTATCTTGC
TATATTCGGATCAAATCCTAAAGTTTCTATCTACGATAGACATGGAAACT
TAGTTAATCAAATAAATTTGGAAGGCAAATGCGTTATGCTGGACTGGGAT
CAACAAGGCGACGTTTTAGCTATCATAGATAACAAATCGCCAGCTGTTTA
CTTATGGGATGTCCATCTCGATAAAATGTCAAAAATAGAAACAGGGTTTA
AAGATTCTTTAAGTTTTGTTAAGTGGTCTAAATTTCAAACACAACTAGCT
GTAGGAACATCAAAAGGCAATCTTCTTCTCTATAATCACATGAACTCAAG
AAAAGTTCCAATTCTTGGGAAACACAGTAAAAAAATTACCTGCGGAGCAT
GGAGTGAAGAAGGATTATTGGCACTTGGTTCCGAAGACCGAACGTTTACT
TTGAGCAATGATGAAGGTGAAACCATTAAGCAAGTTCCATTGAGAGATTT
TCCTTCCAATATTCAATTCTCAGAAATCAAAGAAGATGAGAAAAGCAGTA
TTAAAGAAAACACCTTGACCTGTACACTAGCCAATCAAACTTTGTTTTTG
TTTAAATTGATTGATATGGAAAATCCAGCAGAAGTAGCTTTTCAGGAAAA
ATATGGAAATATTGTCGATTACAAATGGTTTGGAGATGGGTATATTATGG
TCGGTTTCTCCCATGGTTATCTAGTTGTCATTTCAACTCATAAAAAAGAA
ATTGGCCAGGAAATTAATCAAATTCAAGATTATAAAGACAATCTTGCTAG
CATAGGCATTTCAAAAAGCTTGTCTAGGGCGGTAACTGTCGGCGATAGAT
GCGTGAAAATTCACGATTTGAATGCATTGAAAGAATTAACTGCTATAATC
CAATTGGACGAAGACGGAGAAGCGAAAAAGTGTAATTGGTCGGAAGATGG
TCAATTATTAGCAATATCTACGATTACTGGACATGTACACGTCTTCTTGA
CCCGTTTGCCTATGTTAGCCAGTGTCGATATTAGTGGAACCAAAATTGCC
CATTTAACATCTTTAAGAGAAGTTTCCGTGGATAATTTAGACAATAACTT
TTCTAGTAAAGTTTTACCTATTGAACTTGAACCAAAGTTCATTGGAGTTG
GAGCAAGTCATCTTGGAGTTGGGATGAACAATCAAGTTTGGTATTATCGA
GAAAATGCTGAAACTTATCATCTGGTTTCGGAACAAGAATATATGAAAAC
TGTTACAAAATTGCAACTCAATGACGTTTATTCCGCTGCTTATTTTGATG
GGAAAATTATGCTACAAATGATTGAAAACAGCTACGAATCGGACGGTAAA
GAAACCAAGTCGAGAAAGCTATTTCCTGAACAGCCTCATCATTTTGAATA
TATTACTAGTTTTGAATTGACATCGAATTTTTTAATATTTTCAACAGATA
AAGGATATCTTAACATTTTCTTCATAGAAGATTGGAACTATTCTAGTGAA
TTCAAGCACGAATGCGGTATTTCCAAGATATTCTCCAATGAAGTTGGAAC
GGCAATTATGTTCATTGATAATAAATCAAATGCTTTTTTCTATTCACCGC
TCGAAGAGGAAGTTGTTGAAATCCATGAATTTCCGGGTGGTACCAATAAA
GTTCTTTGGGATTACAAAAATGATGAAAATTCGATGATTTTGGTTTGCAC
GGATGATAAACTTTATACGTACACCATTCAATCTCTTTATGTTAATACTA
AAAAAGGAGATGAAGATGAATTCGAAACAGAAAATAATCGGCCGAAATTT
GAAATTCCAAAAATCTACGGAGATAATAACACTAGAGGAGTTTCGACTAC
AAAAATAAAGTTAATTGGATTTACAAAGGCTCCATTTGGACATTTGCCAT
TGTTTCTAAAGAATGGTGATATAATTCTATTGAATCAAAATGGAAAACTT
GTTACTAATGTCCTTGGTACTCATGCATTTAAACAAGCACTAAATAAACT
TGAGAGTGTGGAATATAAAGAGTTACTTCAATATTTCCATCAAGCAATAA
TGGTGAATTACTTTTCCGAAGCTTGGCAGTTGGCTGAGAAATTAACTTCT
TTTGATAAAGCCAAATCAACGGAAAATTGGAAGGAGTTGGCTAAATCCTC
TTTAAAATGTTTGGATATTGACTTTGCAATAAGAGTATATCGGCGATTAG
GAAATGCCGGCATGGTGTTTTCCTTGTTGAAAATCAAGCATATTGAAGAC
AAAAACCTTTTAGCTGGATATATAGCAATGTTTTTAAATGATTTCAATCT
CGCTCAAGATTTCTTTCTTAATTCATCAAGTCCTGGAGCAGCTCTTAATA
TGAGAAGAGATTTATTACATTGGGATTCGGCTTTACAATTGGCTAAAGCT
TTGGAACCATCTCAAATCCCATTTATTAGCCGAGAATATGCTGGACAATT
AGAATTTATTGGTGATTACGTAAACGCCATGTTGAATTATGAGAGGGGTC
TTTGCAATAATGACGGAGATGAAATAGGAGGCAATAAGGATCTCAGTGAA
CACATTAATTCATGCACGACCGGGATTGCACGAATGGCAATACGATTAGG
CGACACAAAACGAGGTGTCATGATGGCAGAACAGAGCAACAATAGATTGC
TAATGAAAGAGTGCGCAATGATTCTAGAACAAACAAAACAAATGGCTGAA
GCGGGAGCTTTATTTGAGAAAGCCCAATATTTTGAAAAAGCTATTACCGC
GTATATAAGATTGAAAAATTGGAATAAAGTTGGCCAGTTACTGAAGCATG
TTTCATCACCTAAGCTTCATTTACAGTATGCCAAGGCTCGTGAAGCGGAA
GGTCTCTATAAAGAGGCTGTAGCCTCTTACGAGTTAGCAAAAGATTATGA
CTCAGTCATTAGAGTTAATTTGGAGCATCTTAACAATCCAAAGGAAGCTG
TGAGAATTGTTAATGCTACAAATAGCAAAGAGGGTGCTCATTATGTTGCT
CAATTTTTCATTAGACTCGGAGATTTTGCAAGTGCCATTCAATTTCTTGT
TTTGAGCAAATGCCACAGCGAAGCTCTGCATTTCGCTCAAGAACATGGCC
AGATGGAAACTTATGCAAAAATTATTGGATCTGACGCAACAATTGAGGAT
TATCAAAACATTGCTGGCTATTTCGAACAACATAAAAATCACTATCTGGC
AGGGAAATTCTACCTTTTAGCATGTCAATATGAAAAGGCCATAAAACATC
TCCTTAAAGTAACTTATGTTGAAGACAGTCCAGCCGTCGATTTGGCAATT
GAAGCAATTGGCCGGGCTAACGATGACAAACTGACCCATTATTTAGTCGA
ATATCTAATGGGAGAATATGACAATATTCCAAAAAATATGAAATATCTAT
TCAAAATGTATATGGCTTTAAAACAATATCGAGAAGCCGGCAGAACTGCC
ATTCTCATTGCTAAAGACGAACAGGGAAATGGAAATTATCGCATGGCTCA
TGATTTATTATTTAGCATGATGCAAGAACTGAAGCAGAATAACATTAAAA
TTCCATCAGAAATGAGCAGCAATCTAATGCTTATACATTCTTATATAATC
GCTAAATTGCATATTAAACGCGGTGATCATCTAAGAGGGGCCAGGATGTT
GATTCGTGTTGCAGAGAGCATCAGCAAATTTCCATCTCATGTTGTACCAA
TATTGACAAGCACTGTAATCGAATGTCATAGATCTGGTCTAAGAGACTCA
AGTTTCAGTTATGCAGCAATGTTGTTGAGGCCTGATTATCGAGACCAAAT
TGATCCTAAATATGTTAAGAAAATGGAAACAATTGTTCGAAGACCAGATA
AAACTCAAGAGGAAGAACCAAAAACCGAATGTCCATTTTGTTCGAATCTG
GTATTGGAAACAACCCTTCAGTGTAACGAATGCAAAAGTTCAATCTCCTA
TTGTATAGCATCTGGCCGACACATTATCAGAGATGATTGCGTAATCTGTC
CAAAATGTGAATTTCCTGCTATTGGTTCTGAACTTAGGAATCTCCTTAAT
GAACCGAATTCCGTCTGTCCAATGTGCTCTGAGCCCGTGTCAGCTAACGA
ACTGAAAATGATCCTCGATATCACAGAATATCTCCAGAAATTTAACCAAA
GCATAGAATAAAATTCTAAAATAAGAAAAATATGATTCAAAGTCCCTTGG
AAATGATTTTTAAATAAATGAAATGTTGTTTGATACTTTCTAAATGTTAT
TATTGCTAGAAATAATATATATTTTG
back to top

protein sequence of SMED30025283-orf-1

>SMED30025283-orf-1 ID=SMED30025283-orf-1|Name=SMED30025283-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1400bp
MKKVFTIKEQISENHVVNFEWQKTHGNYLAIFGSNPKVSIYDRHGNLVNQ
INLEGKCVMLDWDQQGDVLAIIDNKSPAVYLWDVHLDKMSKIETGFKDSL
SFVKWSKFQTQLAVGTSKGNLLLYNHMNSRKVPILGKHSKKITCGAWSEE
GLLALGSEDRTFTLSNDEGETIKQVPLRDFPSNIQFSEIKEDEKSSIKEN
TLTCTLANQTLFLFKLIDMENPAEVAFQEKYGNIVDYKWFGDGYIMVGFS
HGYLVVISTHKKEIGQEINQIQDYKDNLASIGISKSLSRAVTVGDRCVKI
HDLNALKELTAIIQLDEDGEAKKCNWSEDGQLLAISTITGHVHVFLTRLP
MLASVDISGTKIAHLTSLREVSVDNLDNNFSSKVLPIELEPKFIGVGASH
LGVGMNNQVWYYRENAETYHLVSEQEYMKTVTKLQLNDVYSAAYFDGKIM
LQMIENSYESDGKETKSRKLFPEQPHHFEYITSFELTSNFLIFSTDKGYL
NIFFIEDWNYSSEFKHECGISKIFSNEVGTAIMFIDNKSNAFFYSPLEEE
VVEIHEFPGGTNKVLWDYKNDENSMILVCTDDKLYTYTIQSLYVNTKKGD
EDEFETENNRPKFEIPKIYGDNNTRGVSTTKIKLIGFTKAPFGHLPLFLK
NGDIILLNQNGKLVTNVLGTHAFKQALNKLESVEYKELLQYFHQAIMVNY
FSEAWQLAEKLTSFDKAKSTENWKELAKSSLKCLDIDFAIRVYRRLGNAG
MVFSLLKIKHIEDKNLLAGYIAMFLNDFNLAQDFFLNSSSPGAALNMRRD
LLHWDSALQLAKALEPSQIPFISREYAGQLEFIGDYVNAMLNYERGLCNN
DGDEIGGNKDLSEHINSCTTGIARMAIRLGDTKRGVMMAEQSNNRLLMKE
CAMILEQTKQMAEAGALFEKAQYFEKAITAYIRLKNWNKVGQLLKHVSSP
KLHLQYAKAREAEGLYKEAVASYELAKDYDSVIRVNLEHLNNPKEAVRIV
NATNSKEGAHYVAQFFIRLGDFASAIQFLVLSKCHSEALHFAQEHGQMET
YAKIIGSDATIEDYQNIAGYFEQHKNHYLAGKFYLLACQYEKAIKHLLKV
TYVEDSPAVDLAIEAIGRANDDKLTHYLVEYLMGEYDNIPKNMKYLFKMY
MALKQYREAGRTAILIAKDEQGNGNYRMAHDLLFSMMQELKQNNIKIPSE
MSSNLMLIHSYIIAKLHIKRGDHLRGARMLIRVAESISKFPSHVVPILTS
TVIECHRSGLRDSSFSYAAMLLRPDYRDQIDPKYVKKMETIVRRPDKTQE
EEPKTECPFCSNLVLETTLQCNECKSSISYCIASGRHIIRDDCVICPKCE
FPAIGSELRNLLNEPNSVCPMCSEPVSANELKMILDITEYLQKFNQSIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR039468WDR19_WD40_rpt
IPR040379WDR19/dyf-2
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0000902cell morphogenesis
GO:0001701in utero embryonic development
GO:0007224smoothened signaling pathway
GO:0008406gonad development
GO:0030030cell projection organization
GO:0030326embryonic limb morphogenesis
GO:0031076embryonic camera-type eye development
GO:0035721intraciliary retrograde transport
GO:0042471ear morphogenesis
GO:0048701embryonic cranial skeleton morphogenesis
GO:0050877neurological system process
GO:0055123digestive system development
GO:0060271cilium morphogenesis
GO:0060830ciliary receptor clustering involved in smoothened signaling pathway
GO:0060831smoothened signaling pathway involved in dorsal/ventral neural tube patterning
GO:0061055myotome development
GO:0061512protein localization to cilium
Vocabulary: cellular component
TermDefinition
GO:0001750photoreceptor outer segment
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005929cilium
GO:0030991intraciliary transport particle A
GO:0031514motile cilium
GO:0032391photoreceptor connecting cilium
GO:0042995cell projection
GO:0097730non-motile cilium
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 257..277
NoneNo IPR availableSUPERFAMILYSSF69322Tricorn protease domain 2coord: 14..345
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 128..166
e-value: 1.5
score: 15.9
coord: 306..346
e-value: 140.0
score: 3.4
coord: 264..302
e-value: 82.0
score: 4.9
coord: 85..125
e-value: 23.0
score: 8.5
IPR039468WDR19, WD40 repeatPFAMPF15911WD40_3coord: 512..567
e-value: 9.9E-19
score: 67.1
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 1..175
e-value: 5.2E-14
score: 54.1
IPR040379WD repeat-containing protein 19/dyf-2PANTHERPTHR14920OSMOTIC AVOIDANCE ABNORMAL PROTEIN 1/WD REPEAT MEMBRANE PROTEINcoord: 1..1393
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 442..593