SMED30025261
Overview
Neoblast Clusters
Zeng et. al., 2018
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny AppEmbryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30025261 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4
Alignments
SMED30025261 aligns in the following genomic locations:
Homology
BLAST of SMED30025261 vs. TrEMBL
Match: A0A5K4F5G3 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 1.995e-8 Identity = 24/45 (53.33%), Postives = 30/45 (66.67%), Query Frame = 1 Query: 136 RKWVHNTAINCTPKFSCFHNLHCFARYKSNKYYCANIYPCGTSCA 270 R WV++ NC +SCF+ C RY S Y+CANIYPCG+SCA Sbjct: 41 RSWVYSDTYNCEKIYSCFNTRQCRQRYNSPNYFCANIYPCGSSCA 85
BLAST of SMED30025261 vs. TrEMBL
Match: A0A4Z2DHT6 (Uncharacterized protein OS=Schistosoma japonicum OX=6182 GN=EWB00_000804 PE=4 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 8.023e-8 Identity = 23/45 (51.11%), Postives = 30/45 (66.67%), Query Frame = 1 Query: 136 RKWVHNTAINCTPKFSCFHNLHCFARYKSNKYYCANIYPCGTSCA 270 R WV++ NC +SCF+ C RY S Y+CAN+YPCG+SCA Sbjct: 37 RTWVYSDTYNCEKIYSCFNTRQCRLRYNSPNYFCANMYPCGSSCA 81
BLAST of SMED30025261 vs. Planmine SMEST
Match: SMESG000072141.1 (SMESG000072141.1) HSP 1 Score: 182.57 bits (462), Expect = 5.343e-61 Identity = 88/92 (95.65%), Postives = 89/92 (96.74%), Query Frame = 1 Query: 7 ESPIYFQIMNSISVKILVVITFVLILSKHQCSPQIDNILGSRVRKWVHNTAINCTPKFSCFHNLHCFARYKSNKYYCANIYPCGTSCAIRNG 282 ES FQIMNSISVKILVVITFVLILSKHQCSPQIDNILGSRVR+WVHNTAINCTPKFSCFHNLHCFARYKSNKYYCANIYPCGTSCAIRNG Sbjct: 24 ESLSVFQIMNSISVKILVVITFVLILSKHQCSPQIDNILGSRVRRWVHNTAINCTPKFSCFHNLHCFARYKSNKYYCANIYPCGTSCAIRNG 115
BLAST of SMED30025261 vs. Planmine SMEST
Match: SMESG000077009.1 (SMESG000077009.1) HSP 1 Score: 58.151 bits (139), Expect = 3.852e-12 Identity = 21/45 (46.67%), Postives = 31/45 (68.89%), Query Frame = 1 Query: 136 RKWVHNTAINCTPKFSCFHNLHCFARYKSNKYYCANIYPCGTSCA 270 ++WVH ++ C +SCF + C RYK + YCA++YPCG+SCA Sbjct: 27 KRWVHFHSVGCDEAYSCFKDDSCRDRYKRDDLYCADMYPCGSSCA 71
BLAST of SMED30025261 vs. Planmine SMEST
Match: SMESG000077009.1 (SMESG000077009.1) HSP 1 Score: 56.9954 bits (136), Expect = 5.369e-12 Identity = 21/45 (46.67%), Postives = 31/45 (68.89%), Query Frame = 1 Query: 136 RKWVHNTAINCTPKFSCFHNLHCFARYKSNKYYCANIYPCGTSCA 270 ++WVH ++ C +SCF + C RYK + YCA++YPCG+SCA Sbjct: 9 KRWVHFHSVGCDEAYSCFKDDSCRDRYKRDDLYCADMYPCGSSCA 53 The following BLAST results are available for this feature:
BLAST of SMED30025261 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30025261 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30025261 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30025261 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30025261 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30025261 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30025261 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30025261 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 2
BLAST of SMED30025261 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30025261 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30025261 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30025261 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30025261 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30025261 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 3
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30025261 ID=SMED30025261|Name=SMED30025261|organism=Schmidtea mediterranea sexual|type=transcript|length=358bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|