Otopetrin

Overview
NameOtopetrin
Smed IDSMED30025256
Length (bp)2288
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Otopetrin (SMED30025256) t-SNE clustered cells

Violin plots show distribution of expression levels for Otopetrin (SMED30025256) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Otopetrin (SMED30025256) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Otopetrin (SMED30025256) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025256

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30025256SMESG000058901.1 dd_Smed_v4_12786_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025256SMESG000058901.1 dd_Smed_v4_12786_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-3 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL0])

HSP 1 Score: 63.1586 bits (152), Expect = 4.862e-10
Identity = 88/444 (19.82%), Postives = 181/444 (40.77%), Query Frame = 1
Query:  391 LYLRFGVVLIGTLSLIY---------LGFSSARNNPMDPNCLNLTTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIW----------QISSLTKIKYAPLTK---NHNNCTNAEIQSIILYF-------LPTVSEFCVICMAIFY------------ELQKRLGKLSLIETAHTEKDHLVFWRIPRXXXXXXXXXXXXXLCVGFTVFIIVMDNQPSNN-----WIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYL------SNNVDKNLLFASCFLSIAFSV--IISTCCFQYITENSQIGIQMGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQ--KNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPVLSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQ 1554
            LYLR G V+ G + ++Y         LG+SS      +  C  ++ + +  A +  F+ Q  F+     I+   +  L +FGL ++   N+ +W           +  +  +++A L+K   +H+       + ++  F          V E+ +IC  + +            +++K++ K S+++   +     +F                   C+  T+  I + N  S++     WIF   S   +  ++ S  ++  AF +   LKF           +  +D+ LL       + FS+  I+S         N  IG+ + I   + L  + Q+ FQ+ ++  A     +   Q   + KPG+  + +L+ +N   +++  F+ +   I       ++     +     V    PL+I YR+HSS+C A+++ K ++
Sbjct:  143 LYLRLGCVVFGIIGVVYYLLIFVICLLGWSSN-----EGECSVISDVLNVMAAVFIFV-QMWFVYCNGKIIFTGDGNLARFGLMHLTGTNLWMWLRYILYEEVETVKEIRHVQHANLSKASAHHHEVHEEACKGVLCIFNGYNEFMYTCVVEYSLICAGVAFVFWANLERLKREQMEKKMKKRSILKIDCSRTAEGLF---------------AGFACIIVTIIAIALFNAYSSDKNVAQWIF---SCTNMSFFLVSTFLVVFAFWRMRYLKFLMEDDDEEDDNAELLDRILLVVGLIGELIFSIGGILS------FINNMTIGLPLIIFTTNVL-RLIQVTFQSCLLMVASRLRIEESNQHMLRYKPGKQVITMLLMMNCAQFMMNVFEAQKAGI----NDEMIHMYGSYYWAIVVRGCSPLTIFYRFHSSACFAEIWKKTFR 551          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-3 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL0])

HSP 1 Score: 63.1586 bits (152), Expect = 4.862e-10
Identity = 88/444 (19.82%), Postives = 181/444 (40.77%), Query Frame = 1
Query:  391 LYLRFGVVLIGTLSLIY---------LGFSSARNNPMDPNCLNLTTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIW----------QISSLTKIKYAPLTK---NHNNCTNAEIQSIILYF-------LPTVSEFCVICMAIFY------------ELQKRLGKLSLIETAHTEKDHLVFWRIPRXXXXXXXXXXXXXLCVGFTVFIIVMDNQPSNN-----WIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYL------SNNVDKNLLFASCFLSIAFSV--IISTCCFQYITENSQIGIQMGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQ--KNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPVLSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQ 1554
            LYLR G V+ G + ++Y         LG+SS      +  C  ++ + +  A +  F+ Q  F+     I+   +  L +FGL ++   N+ +W           +  +  +++A L+K   +H+       + ++  F          V E+ +IC  + +            +++K++ K S+++   +     +F                   C+  T+  I + N  S++     WIF   S   +  ++ S  ++  AF +   LKF           +  +D+ LL       + FS+  I+S         N  IG+ + I   + L  + Q+ FQ+ ++  A     +   Q   + KPG+  + +L+ +N   +++  F+ +   I       ++     +     V    PL+I YR+HSS+C A+++ K ++
Sbjct:  143 LYLRLGCVVFGIIGVVYYLLIFVICLLGWSSN-----EGECSVISDVLNVMAAVFIFV-QMWFVYCNGKIIFTGDGNLARFGLMHLTGTNLWMWLRYILYEEVETVKEIRHVQHANLSKASAHHHEVHEEACKGVLCIFNGYNEFMYTCVVEYSLICAGVAFVFWANLERLKREQMEKKMKKRSILKIDCSRTAEGLF---------------AGFACIIVTIIAIALFNAYSSDKNVAQWIF---SCTNMSFFLVSTFLVVFAFWRMRYLKFLMEDDDEEDDNAELLDRILLVVGLIGELIFSIGGILS------FINNMTIGLPLIIFTTNVL-RLIQVTFQSCLLMVASRLRIEESNQHMLRYKPGKQVITMLLMMNCAQFMMNVFEAQKAGI----NDEMIHMYGSYYWAIVVRGCSPLTIFYRFHSSACFAEIWKKTFR 551          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-6 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q22977])

HSP 1 Score: 56.225 bits (134), Expect = 7.950e-8
Identity = 100/452 (22.12%), Postives = 172/452 (38.05%), Query Frame = 1
Query:  376 GEKVG-LYLRFGVVLIGTLSLIYLG-------FSSARNNPMDPNCLNLTTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKIKYA-------------PLTKNHNNCTNAEIQSIIL--------------------------------YFLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTEKDHLVFWRIPRXXXXXXXXXXXXXLCVGFTVFII---VMDNQPSNNWIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFASCFLSIAFSVIISTCCFQYITENSQIGIQMG---IRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFF-HKKSPVLSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIY 1551
            GE  G LYLR G VL GTL  +  G       F+  R+N           +       LF  +Q  F+     I + KN  L  FG+ + V +N+ +W    L K  Y                 K +   T A  ++I                                  + L T+ EF +I  A+++ + K  G+ +        K H+ F          V      VL +G  + I    + +N         V    E V++   ++ ++ AF +  +L++        VD+ LL       I +    ST    Y+  N ++    G   +  ++ ++ I Q++ Q+  I  A    S +     N+PG+  +  L+  N  L++  +F+    +  F HK S V S+         + ++ PL + YR+HSS+CLA+++   Y
Sbjct:  139 GEGAGTLYLRLGTVLFGTLGSVLWGCEIFLCFFTETRHN---------IYVVKYILAFLFTYLQMHFLCCNSKIDLPKNNFLASFGMMHCVAVNLWVWFSLCLAKAVYKSDKKTLKLQKAEEKYKKKNMTITEAVAETITTTIASIVSSESSSGFRADEKQLRSLYKLGSAANFLLTTMVEFSLIAAAVYFIVWKHEGEQT---PQDARKKHVRF----DCKSTSVGIFAAIVLLIGSFISIAMHYIYNNSDMPRTADEVIGIAETVLFCVCLLAVFGAFIRMRKLQYRLHAHGQVVDEILLIVGLAGEIVYC---STGLDLYL--NGRLENTPGTSCLTVVAFVMRIVQVVVQSVFILVASRLRSLSASNISNQPGKQIVTFLVVCNINLFIYHTFETIESNFGFPHKMSSVYSA--------LLNISSPLVVFYRFHSSACLAEIWKHAY 561          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLc (gene:FBgn0259150 transcript:FBtr0346834)

HSP 1 Score: 65.855 bits (159), Expect = 1.474e-10
Identity = 92/451 (20.40%), Postives = 179/451 (39.69%), Query Frame = 1
Query:  400 RFGVVLIGTLSLIYLGFSSARNNPMDPN--CLNLTTIFSCAAEILFFIIQGAFI-LKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKIKYAPLT-------------------KNH----------------------------NNCTNAEIQSIILYFLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTEKDHLVFWRIPRXXXXXXX--XXXXXXLCVGFTVFII---------VMDNQPS-NNWIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFAS---CFLSIAFSVIISTCCFQYITENSQIGIQMGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPV-LSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQ 1554
            R G V  G  S+IY G    +   ++P+  C N+    + A  + F  IQ  FI L    I + +   + +FGL +++  N+ +W    + + K+  LT                   + H                             N     +Q    +  P   E+ +IC AI Y + +    +S  +T   ++  ++   + R+     +        L VG  + ++         V+ ++P       T  +  E++IY  + +   +   +   L++   Y S ++D  LL  +    FL   F+VI     F   +++  +        I+AL  I Q   QT  I DA  R + + E  + KPG+  +  ++ VN  +W + + +    +       P+ L+    +  T   ++++PL+I YR+HS+ CL +++ + Y+
Sbjct: 1017 RMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWR---SISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYD-AYRSFSLDDILLVGAQTGSFLYNIFTVIAGH--FTLRSDDMLV-------PINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAE-----SHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAYK 1449          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLc (gene:FBgn0259150 transcript:FBtr0331167)

HSP 1 Score: 65.4698 bits (158), Expect = 1.835e-10
Identity = 92/451 (20.40%), Postives = 179/451 (39.69%), Query Frame = 1
Query:  400 RFGVVLIGTLSLIYLGFSSARNNPMDPN--CLNLTTIFSCAAEILFFIIQGAFI-LKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKIKYAPLT-------------------KNH----------------------------NNCTNAEIQSIILYFLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTEKDHLVFWRIPRXXXXXXX--XXXXXXLCVGFTVFII---------VMDNQPS-NNWIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFAS---CFLSIAFSVIISTCCFQYITENSQIGIQMGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPV-LSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQ 1554
            R G V  G  S+IY G    +   ++P+  C N+    + A  + F  IQ  FI L    I + +   + +FGL +++  N+ +W    + + K+  LT                   + H                             N     +Q    +  P   E+ +IC AI Y + +    +S  +T   ++  ++   + R+     +        L VG  + ++         V+ ++P       T  +  E++IY  + +   +   +   L++   Y S ++D  LL  +    FL   F+VI     F   +++  +        I+AL  I Q   QT  I DA  R + + E  + KPG+  +  ++ VN  +W + + +    +       P+ L+    +  T   ++++PL+I YR+HS+ CL +++ + Y+
Sbjct: 1017 RMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWR---SISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYD-AYRSFSLDDILLVGAQTGSFLYNIFTVIAGH--FTLRSDDMLV-------PINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAE-----SHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAYK 1449          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLc (gene:FBgn0259150 transcript:FBtr0331168)

HSP 1 Score: 65.0846 bits (157), Expect = 2.085e-10
Identity = 92/451 (20.40%), Postives = 179/451 (39.69%), Query Frame = 1
Query:  400 RFGVVLIGTLSLIYLGFSSARNNPMDPN--CLNLTTIFSCAAEILFFIIQGAFI-LKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKIKYAPLT-------------------KNH----------------------------NNCTNAEIQSIILYFLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTEKDHLVFWRIPRXXXXXXX--XXXXXXLCVGFTVFII---------VMDNQPS-NNWIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFAS---CFLSIAFSVIISTCCFQYITENSQIGIQMGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPV-LSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQ 1554
            R G V  G  S+IY G    +   ++P+  C N+    + A  + F  IQ  FI L    I + +   + +FGL +++  N+ +W    + + K+  LT                   + H                             N     +Q    +  P   E+ +IC AI Y + +    +S  +T   ++  ++   + R+     +        L VG  + ++         V+ ++P       T  +  E++IY  + +   +   +   L++   Y S ++D  LL  +    FL   F+VI     F   +++  +        I+AL  I Q   QT  I DA  R + + E  + KPG+  +  ++ VN  +W + + +    +       P+ L+    +  T   ++++PL+I YR+HS+ CL +++ + Y+
Sbjct: 1017 RMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWR---SISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYD-AYRSFSLDDILLVGAQTGSFLYNIFTVI--AGHFTLRSDDMLV-------PINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAE-----SHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAYK 1449          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLa (gene:FBgn0259994 transcript:FBtr0300465)

HSP 1 Score: 51.9878 bits (123), Expect = 2.246e-6
Identity = 74/325 (22.77%), Postives = 128/325 (39.38%), Query Frame = 1
Query:  685 TKNHNNCTNAEIQSIILY-----FLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTEKDHLVFWRIPRXXXXXXXXXXXXXLCVGFT-------------------VFIIVMDNQPSNNWIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFASCFLSIAFSV--IISTCCFQYITENSQIGIQMGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPVLSSDPQFLLTFFV------YLTLPLSILYRYHSSSCLADVFSKIYQGEV 1563
            T N   C   +I   I+Y       P + E+ +I   + Y + K +G+          +  L      RA+          V CVG +                    F++V   Q S   I+   +S  I++  F+I+ + + F +   LKF     SN ++  LL  S F    +SV  II+       +E S +    G       + +FQ+I Q   I D   R     E  ++KPG+  +  L+  N  ++ + +F+ +           V ++  Q     FV       +TLPL I +R+HS+  LA+++   Y+  +
Sbjct:  684 TLNSTACGRIDIMGTIVYDSAPYLYPFIIEYSLIGAVVLYVMWKHIGRYPGRMNDEDLEHRLEVMLSRRAVAMAQQARSGRVDCVGSSKGLFFGLLLLVGALICLILFFVLVRHQQFSLLAIYLADASHCILM-AFAILAIIVGFIRVKNLKFRCEEQSN-LNDILLRISAFGLFTYSVFSIIAGSLKVLESEPSLLVTTTG------GVAVFQVILQLLFIADVSRRRVHLPEHDRSKPGRQIVTFLLICNVAMFAIYTFEAQK----------VFANPVQLEFYGFVPWSIIQRITLPLCIFHRFHSAVTLAEIWKTTYKARL 990          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLa (gene:FBgn0259994 transcript:FBtr0300466)

HSP 1 Score: 51.6026 bits (122), Expect = 2.965e-6
Identity = 74/325 (22.77%), Postives = 128/325 (39.38%), Query Frame = 1
Query:  685 TKNHNNCTNAEIQSIILY-----FLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTEKDHLVFWRIPRXXXXXXXXXXXXXLCVGFT-------------------VFIIVMDNQPSNNWIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFASCFLSIAFSV--IISTCCFQYITENSQIGIQMGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPVLSSDPQFLLTFFV------YLTLPLSILYRYHSSSCLADVFSKIYQGEV 1563
            T N   C   +I   I+Y       P + E+ +I   + Y + K +G+          +  L      RA+          V CVG +                    F++V   Q S   I+   +S  I++  F+I+ + + F +   LKF     SN ++  LL  S F    +SV  II+       +E S +    G       + +FQ+I Q   I D   R     E  ++KPG+  +  L+  N  ++ + +F+ +           V ++  Q     FV       +TLPL I +R+HS+  LA+++   Y+  +
Sbjct:  609 TLNSTACGRIDIMGTIVYDSAPYLYPFIIEYSLIGAVVLYVMWKHIGRYPGRMNDEDLEHRLEVMLSRRAVAMAQQARSGRVDCVGSSKGLFFGLLLLVGALICLILFFVLVRHQQFSLLAIYLADASHCILM-AFAILAIIVGFIRVKNLKFRCEEQSN-LNDILLRISAFGLFTYSVFSIIAGSLKVLESEPSLLVTTTG------GVAVFQVILQLLFIADVSRRRVHLPEHDRSKPGRQIVTFLLICNVAMFAIYTFEAQK----------VFANPVQLEFYGFVPWSIIQRITLPLCIFHRFHSAVTLAEIWKTTYKARL 915          
BLAST of Otopetrin vs. UniProt/SwissProt
Match: sp|B7Z0W9|OTOP_DROME (Proton channel OtopLc OS=Drosophila melanogaster OX=7227 GN=OtopLc PE=3 SV=2)

HSP 1 Score: 65.4698 bits (158), Expect = 1.839e-9
Identity = 92/451 (20.40%), Postives = 179/451 (39.69%), Query Frame = 1
Query:  400 RFGVVLIGTLSLIYLGFSSARNNPMDPN--CLNLTTIFSCAAEILFFIIQGAFI-LKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKIKYAPLT-------------------KNH----------------------------NNCTNAEIQSIILYFLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTEKDHLVFWRIPRXXXXXXX--XXXXXXLCVGFTVFII---------VMDNQPS-NNWIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFAS---CFLSIAFSVIISTCCFQYITENSQIGIQMGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPV-LSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQ 1554
            R G V  G  S+IY G    +   ++P+  C N+    + A  + F  IQ  FI L    I + +   + +FGL +++  N+ +W    + + K+  LT                   + H                             N     +Q    +  P   E+ +IC AI Y + +    +S  +T   ++  ++   + R+     +        L VG  + ++         V+ ++P       T  +  E++IY  + +   +   +   L++   Y S ++D  LL  +    FL   F+VI     F   +++  +        I+AL  I Q   QT  I DA  R + + E  + KPG+  +  ++ VN  +W + + +    +       P+ L+    +  T   ++++PL+I YR+HS+ CL +++ + Y+
Sbjct: 1017 RMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWR---SISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYD-AYRSFSLDDILLVGAQTGSFLYNIFTVIAGH--FTLRSDDMLV-------PINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAE-----SHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAYK 1449          
BLAST of Otopetrin vs. TrEMBL
Match: A0A183A6V6 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2691 PE=4 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 1.684e-63
Identity = 162/573 (28.27%), Postives = 294/573 (51.31%), Query Frame = 1
Query:  274 LIALFIYLHMNRHQTFXXXXXXXXXXXXIHYSMCGEKVGLYLRFGVVLIGTLSLIYLGFSSARNNPMDPNCLNLTTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKIKYAPLTKNHNNCTNAEIQSIIL----YFLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTEKDHLVFWRIPRXXXXXXXXXXXXXLCVGFTVFIIVMD--NQPSNNWIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFASCFLSIAFSVIISTCCFQYITEN---SQIGIQMGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPVLSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQGEVCRFEGILR------AEGFI---KCGMNEKKESECSIPKIIVDEDGSPKFSRPRAITLPVIXXXXXXXXXXXXX----------------------------XXMTRRETIKNLEAAKLRVMSSHLSHNMVSKKL 1854
            +I +  Y+  NRH T E   K +  ++ I +SM GE V LYLR  + +   +++++    +   +    + L L +I++  ++ILFF+IQ  F L  H +V+L N R+    L +I+ +N+ +W  S++ K+     T+   +  +++ +   L    YFLP + E+C + +A+ YE+ +R+G+L  IE AH EK      R P+    + + +    LCV   V I+ ++  +   + +    H S+ I++YI S+++         +LKFS  +  N++D+ LL  + FL++ F V     C  Y+T     ++   +M  + ++ ++E+ Q++ QTY+I D FYRC  +    K +PG+  + +L  +NF LW++ SFQ+K+ D+ F   + +     Q  L  F+ + LP+ +L+RYHSS CLA  F +IY+ EV R+E +LR       + F+   K  ++ + ++E  +P  I  +  S   +R RA + PV+   ++  ++ ++                             ++  RR T  NLE A++RV +S   H M  +KL
Sbjct:   55 MIYMLWYVAHNRHATIEAIEKGDLSATRILFSMRGEPVSLYLRIAICIFAAMAIVFASCRAYEVSVTKSDRL-LISIYT-TSKILFFVIQPIFFLVLHRLVVLANVRIFSVILLHILTVNLCVWVESAIEKVSMTINTERSTDGHSSDKRGYTLAATHYFLPAIPEYCAVAVAVTYEMAQRIGQLKQIE-AHHEKAEKQEKR-PQLQTYVGLMLGSI-LCVLVLVIILYLETADHGIDYYRPIWHLSETILLYICSLILSVAGIITIRKLKFSVNFAKNSLDEKLLLVTFFLTVNFFVACCVLCVAYLTSGHLTTKEMYKMTAQLVALIMELIQVMVQTYLIHDMFYRCCHHESYWKTRPGRGIIAVLSAINFSLWMIYSFQVKHNDVLFTMSATLYQQAEQRGLHMFIVVMLPMVMLFRYHSSVCLAISFERIYEDEVTRYESMLRWIKQDTTKQFLHSQKLSLDSRWDTEIEMPSQI-SKGESQVGTRQRAASHPVLKCMSAIDREVSSLGERNQTSTDKVDRTESEYNPQDTISSLYREQGRRGTRINLEMARIRVAASEFEHRMTEQKL 621          
BLAST of Otopetrin vs. TrEMBL
Match: A0A4E0RKK5 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_002020 PE=4 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 1.321e-60
Identity = 158/579 (27.29%), Postives = 288/579 (49.74%), Query Frame = 1
Query:  268 GILIALFIYLHMNRHQTFXXXXXXXXXXXXIHYSMCGEKVGLYLRFGVVLIGTLSLIYLGFSSARNNPMDPNCLN--LTTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKIKYAPLTKNHNNCTNAEIQSIIL----YFLPTVSEFCVICMAIFYELQKRLGKLSLIETAH--TEKDHLVFWRIPRXXXXXXXXXXXXXLCVGFTVFIIVMDNQPSNNWIFTV-HSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFASCFLSIAFSVIISTCCFQYITEN---SQIGIQMGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPVLSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQGEVCRFEGILR------AEGFI---KCGMNEKKESECSIPKIIVDEDGSPKFSRPRAITLPVIXXXXXXXXXXXXXXXMT-----------------------------RRETIKNLEAAKLRVMSSHLSHNMVSKKL 1854
            G+   L+  +H NRH T E   + +  ++ I +SM GE V LYLRF + +   +++    F+S R   +     N  L +I++ A++I FFI+Q  F L  H +V+L N R+    L + + +N+ +W  S++ K+  A + ++ +     + +   L    YFLP + E+C I +A+ YE+ +R+G+L  IE  H  TEK      + P+    + + +   +  +   + + +       ++   + H ++ I+++I ++++         +LKFS  +  N++D+ LL  + FL++ F V     C  Y+T      +   +M  + ++ ++E+ QI+ QTY+I D FYRC  +    K +PG+  + IL  +NF LW++ SFQ K+ D+     + +     Q  L  F+ + LP+ +L+RYHSS CLA  F ++Y+ EV R+E +LR       + F+   K  +  + ++E  +P  I   D     +RPRA + PV+   ++  ++ ++  + +                             RR T  NLE A++RV +S   H M  +KL
Sbjct:   88 GLAYMLWYVVH-NRHATIEAIERGDLSATRILFSMRGEPVSLYLRFAICIFAIMAI---AFASCRAYEVSMRKSNYLLVSIYT-ASKISFFIVQTVFFLVLHRLVVLANVRMFSVILLHTLTVNLCVWVESAIEKVSLAMIVEHSSENIADDSRGYTLAATHYFLPAIPEYCAIGVAVTYEMAQRIGQLKQIEAHHEKTEKHE----KRPQLQTYVGLMLGSILSVLVLVIVLYLETAGHGIDYHRPIWHLTETILLFICALILSVAGIVTVRKLKFSVNFAKNSLDEKLLLVTFFLTVNFFVACCVLCVAYLTSGLLTEKETYKMAAQLVNLIMELIQIMVQTYLIHDMFYRCCHHESYWKTRPGRGIIAILSAINFCLWMIYSFQTKHNDVLLTLSAKLYQKAEQQGLHMFIVVMLPMVMLFRYHSSVCLAVSFERVYEDEVTRYESMLRWIKQDTTKEFLHSQKLALEPRWDTELEMPSQISKADSQGPGTRPRASSHPVLKCMSTIDREVSSLGEQSNQNSMDMFDRPDPEYNPQDTISSLYKEQGRRGTRINLEMARIRVAASEFEHRMTEQKL 657          
BLAST of Otopetrin vs. TrEMBL
Match: A0A504X7Y3 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_04231 PE=4 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 6.117e-60
Identity = 157/579 (27.12%), Postives = 286/579 (49.40%), Query Frame = 1
Query:  268 GILIALFIYLHMNRHQTFXXXXXXXXXXXXIHYSMCGEKVGLYLRFGVVLIGTLSLIYLGFSSARNNPMDPNCLN--LTTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKIKYAPLTKNHNNCTNAEIQSIIL----YFLPTVSEFCVICMAIFYELQKRLGKLSLIETAH--TEKDHLVFWRIPRXXXXXXXXXXXXXLCVGFTVFIIVMDNQPSNNWIFTV-HSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFASCFLSIAFSVIISTCCFQYITEN---SQIGIQMGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPVLSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQGEVCRFEGILR------AEGFI---KCGMNEKKESECSIPKIIVDEDGSPKFSRPRAITLPVIXXXXXXXXXXXXXXXMT-----------------------------RRETIKNLEAAKLRVMSSHLSHNMVSKKL 1854
            G+   L+  +H NRH T E   + +  ++ I +SM GE V LYLRF + +   +++    F+S R   +     N  L +I++ A++I FFI+Q  F L  H +V+L N R+    L + + +N+ +W  S++ K+  A + ++       + +   L    YFLP + E+C I +A+ YE+ +R+G+L  IE  H  TEK      + P+    + + +   +  +   + + +       ++   + H ++ I+++I ++++         +LKFS  +  N++D+ LL  + FL++ F V     C  Y+T      +   +M  + ++ ++E+ QI+ QTY+I D FYRC  +    K +PG+  + IL  +NF LW++ SFQ K+ D+     + +     Q  L  F+ + LP+ +L+RYHSS CLA  F ++Y+ EV R+E +LR       + F+   K  +  + ++E  +P  I   D     +RPRA + P +   ++  ++ ++  + +                             RR T  NLE A++RV +S   H M  +KL
Sbjct:   88 GLAYMLWYVVH-NRHATIEAIERGDLSATRILFSMRGEPVSLYLRFAICIFAIMAI---AFASCRAYEVSMRKSNYLLVSIYT-ASKISFFIVQTVFFLVLHRLVVLANVRMFSVILLHTLTVNLCVWVESAIEKVSLAMIVEHSAENIADDARGYTLTATHYFLPAIPEYCAIGVAVTYEMAQRIGQLKQIEAHHEKTEKHE----KRPQLQTYVGLMLGSILSVLVLVIVLYLETAGHGIDYHRPIWHLTETILLFICALILSVAGIVTVRKLKFSVNFAKNSLDEKLLLVTFFLTVNFFVACCVLCVAYLTSGLLTEKEMYKMAAQLVNLIMELIQIMVQTYLIHDMFYRCCHHESYWKTRPGRGIIAILSAINFCLWMIYSFQTKHNDVLLTLSAKLYQKAEQRGLHMFIVVMLPMVMLFRYHSSVCLAVSFERVYEDEVTRYESMLRWIKQDTTKEFLHSQKLALEPRWDTELEMPSQISKADSQGPGTRPRASSHPALKCLSTIDREVSSLGEQSNQNSMEMFDRPDPEYNPQDTISSLYKEQGRRGTRINLEMARIRVAASEFEHRMTEQKL 657          
BLAST of Otopetrin vs. TrEMBL
Match: A0A4E0RRU2 (Otopetrin OS=Fasciola hepatica OX=6192 GN=D915_000328 PE=4 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.445e-59
Identity = 164/551 (29.76%), Postives = 268/551 (48.64%), Query Frame = 1
Query:   82 SKKPKYN-ENMWKNMMFIYACLIISLTLSLSVNSINNEMKNGEISNTSRXXXXXXXXXXXXASG-ILIALFIYLHMNRHQTFXXXXXXXXXXX-XIHYSMCGEKVGLYLRFGVVLIGTLSLIYLGFSSARNNPMDPN--CLNLTTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKIK--------------------YAPLTKNHNNCTNAEIQSIIL---------YFLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTEK-----DHLVFWRIPRXXXXXXXXXXXXXLCVGFTVFIIVMD---NQPSNNWIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFASCFLSIAFSVIISTCCFQYITENSQIGIQMGI-------RAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPVLSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQGEVCRFEGILR 1587
            S  P+ N +N  + + F+YA  +++ +LSL+V S+     N   S T+              S  IL+A+  Y   +R +TFE  ++        + +S+ GEKV LYLR G+ + G +S+ ++      + P   N  CL+L +I     E+ FF++Q  FIL+YH +VIL+    +  GL +++  N+ +W   S+ KI                     + P+    N+ T  EI  IIL         Y LPTVSE+C++  A+ YE+  R+G+ S IE   +++      H    R   A  G   GI   +L +  T+            SN W   +  ++E ++ +F I  + +AF +  +LKFS     +++++ LL+ + F S  +++        +  EN                R      E+ QI+FQTY+IQD+F+RCSD ++ Q  KPG+  +  L+G+N   W+ +SFQLKN DI F     ++ SD          +T+P+S+ YRYH + CL+  F+K+Y+ E  RFE I R
Sbjct:   24 SMAPRKNRQNDRQAICFLYASSVVAASLSLAVASMEYADPNDHRSITAEWGRPLFVSSLYATSCLILLAMAGYFESHRSETFEAVHRGTGPVPFSVKFSIKGEKVNLYLRLGLAMFGVMSIGHVAVKFVEDRPTTNNVFCLHLKSIL----EMAFFVLQTLFILRYHRLVILRYNEAMGAGLVHLLTTNLCVWADISVGKIDKTLSYGKQWRTKSSIAAEHYHHPVDYPLNSNTTDEIHPIILSLNLIDISFYLLPTVSEYCLLAAALLYEITVRIGQPSFIEIEKSKEGNQSNGHRKECRDCSASAGSWFGIATVLLVLALTIVTATTPKYVENTSNFWKSIIILAEEAILCLFGIAFVIMAFVQIRKLKFSIATRQSHLEEFLLYTAFFFSANYTISTMILSADFEDENRTFNTTHNTERYLLICRCTLNAFELVQILFQTYMIQDSFHRCSDRVKHQIMKPGRQAIVALLGINLAFWIQQSFQLKNADILF-----LIESDKGAYGWILYVVTMPISLFYRYHCTVCLSQCFNKLYEDETHRFEEIWR 565          
BLAST of Otopetrin vs. TrEMBL
Match: A0A504YVQ8 (Otopetrin OS=Fasciola gigantica OX=46835 GN=FGIG_01056 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 3.002e-59
Identity = 164/551 (29.76%), Postives = 269/551 (48.82%), Query Frame = 1
Query:   82 SKKPKYN-ENMWKNMMFIYACLIISLTLSLSVNSINNEMKNGEISNTSRXXXXXXXXXXXXASG-ILIALFIYLHMNRHQTFXXXXXXXXXXX-XIHYSMCGEKVGLYLRFGVVLIGTLSLIYLGFSSARNNPMDPN--CLNLTTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKIK--------------------YAPLTKNHNNCTNAEIQSIIL---------YFLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTEK-----DHLVFWRIPRXXXXXXXXXXXXXLCVGFTVFIIVMD---NQPSNNWIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFASCFLSIAFSVIISTCCFQYITENSQIGIQMGI-------RAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPVLSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQGEVCRFEGILR 1587
            S  P+ N +N  + + F+YA  +++ +LSL+V S+     N   S T+              S  IL+A+  Y   +R +TFE  ++        + +S+ GEKV LYLR G+ + G +S+ ++      + P   N  CL+L +I     E+ FF++Q  FIL+YH +VIL+    +  GL +++  N+ +W   S+ KI                     + P+    N+ T  EI  IIL         Y LPTVSE+C++  A+ YE+  R+G+ S IE   +++      H    +   A  G   GIV  +L +  T+            SN W   +  ++E ++ +F I  + +AF +  +LKFS     +++++ LL+ + F S  +++        +  EN                R      E+ QI+FQTY+IQD+F+RCSD ++ Q  KPG+  +  L+G+N   W+ +SFQLKN DI F     ++ SD          +T+P+S+ YRYH + CL+  F+K+Y+ E  RFE I R
Sbjct:   24 SMAPRKNRQNDRQAICFLYASSVVAASLSLAVASMEYADPNDHRSITAEWGRPLFVSSLYATSCLILLAMAGYFESHRSETFEAVHRGTGPVPFSVKFSIKGEKVNLYLRLGLAMFGVMSIGHVAVKFVEDRPTTNNVFCLHLKSIL----EMAFFVLQTLFILRYHRLVILRYNEAMGAGLVHLLTTNLCVWADISVGKIDKTLSYGKQWRTKSSIAAEHYHHPVDHPLNSNTTDEIHPIILSLNLIDISFYLLPTVSEYCLLAAALLYEITVRIGQPSFIEIEKSKEGNQSNGHRKECKDCSASAGSWFGIVTVLLVLALTIVTATTPKYVENTSNFWKSIIILAEEAILCLFGIAFVIMAFVQIRKLKFSIATRQSHLEEFLLYTAFFFSANYTISTMILSADFEDENRTFNTMHNTERYLLICRCTLNAFELVQILFQTYMIQDSFHRCSDRVKHQIMKPGRQAIVALLGINLAFWIQQSFQLKNADILF-----LIESDKGAYGWILYVVTMPISLFYRYHCTVCLSQCFNKLYEDETHRFEEIWR 565          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000058901.1 (SMESG000058901.1)

HSP 1 Score: 1299.26 bits (3361), Expect = 0.000e+0
Identity = 694/695 (99.86%), Postives = 694/695 (99.86%), Query Frame = 1
Query:   46 MDEQINIGVTDLSKKPKYNENMWKNMMFIYACLIISLTLSLSVNSINNEMKNGEISNTSRXXXXXXXXXXXXASGILIALFIYLHMNRHQTFXXXXXXXXXXXXIHYSMCGEKVGLYLRFGVVLIGTLSLIYLGFSSARNNPMDPNCLNLTTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKIKYAPLTKNHNNCTNAEIQSIILYFLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTEKDHLVFWRIPRXXXXXXXXXXXXXLCVGFTVFIIVMDNQPSNNWIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFASCFLSIAFSVIISTCCFQYITENSQIGIQMGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPVLSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQGEVCRFEGILRAEGFIKCGMNEKKESECSIPKIIVDEDGSPKFSRPRAITLPVIXXXXXXXXXXXXXXXMTRRETIKNLEAAKLRVMSSHLSHNMVSKKLSATVSPSRNSSSHTLNESDYETSPRPNKKKISFQTNAAYSDSEMPTIKNLIMSYPFNFGMRKRNSEDDILNMTSKSYTLAAKPISEHKDEEV 2130
            MDEQINIGVTDLSKKPKYNENMWKNMMFIYACLIISLTLSLSVNSINNEMK GEISNTSRVLDVFLTVLFVLASGILIALFIYLHMNRHQTFEEANKENSKSSEIHYSMCGEKVGLYLRFGVVLIGTLSLIYLGFSSARNNPMDPNCLNLTTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKIKYAPLTKNHNNCTNAEIQSIILYFLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTEKDHLVFWRIPRAIIGIVIGIVIAVLCVGFTVFIIVMDNQPSNNWIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFASCFLSIAFSVIISTCCFQYITENSQIGIQMGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPVLSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQGEVCRFEGILRAEGFIKCGMNEKKESECSIPKIIVDEDGSPKFSRPRAITLPVIPPFNSKPKKNNTSKKMTRRETIKNLEAAKLRVMSSHLSHNMVSKKLSATVSPSRNSSSHTLNESDYETSPRPNKKKISFQTNAAYSDSEMPTIKNLIMSYPFNFGMRKRNSEDDILNMTSKSYTLAAKPISEHKDEEV
Sbjct:    1 MDEQINIGVTDLSKKPKYNENMWKNMMFIYACLIISLTLSLSVNSINNEMKKGEISNTSRVLDVFLTVLFVLASGILIALFIYLHMNRHQTFEEANKENSKSSEIHYSMCGEKVGLYLRFGVVLIGTLSLIYLGFSSARNNPMDPNCLNLTTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKIKYAPLTKNHNNCTNAEIQSIILYFLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTEKDHLVFWRIPRAIIGIVIGIVIAVLCVGFTVFIIVMDNQPSNNWIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFASCFLSIAFSVIISTCCFQYITENSQIGIQMGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPVLSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQGEVCRFEGILRAEGFIKCGMNEKKESECSIPKIIVDEDGSPKFSRPRAITLPVIPPFNSKPKKNNTSKKMTRRETIKNLEAAKLRVMSSHLSHNMVSKKLSATVSPSRNSSSHTLNESDYETSPRPNKKKISFQTNAAYSDSEMPTIKNLIMSYPFNFGMRKRNSEDDILNMTSKSYTLAAKPISEHKDEEV 695          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000043827.1 (SMESG000043827.1)

HSP 1 Score: 306.99 bits (785), Expect = 1.256e-94
Identity = 204/611 (33.39%), Postives = 327/611 (53.52%), Query Frame = 1
Query:   79 LSKKPKYNENMWKNMMFIYACLIISLTLSLSVNSINNEMKNGEISNTSRXXXXXXXXXXXXASGILIALFIYLHMNRHQTFXXXXXXXXXXX----XIHYSMCGEKVGLYLRFGVVLIGTLSLIYLGFSSARNNPMDPNCLNLTTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKIKYAPLTKNHNNCTNAEIQSIILYFLPTVSEFCVICMAIFYELQKRLGKLSLIET---AHTEKDHL--VFWRIPRXXXXXXXXXXXXXLCVGFTVFIIVMDNQPSNNWIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFASCFLSIAFSVIISTCCFQYITENSQIG---IQMGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHK--KSPVLSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQGEVCRFEGILRAEGFIKCGMNEKKESECSIPKIIVDEDGSPKFSRPRAITLPVIXXXXXXXXXXXXXXXMTRRETIKNLEAAKLRVMSSHLSHNMVSKKLSATVS 1869
            L K+PKY++N WK  ++ YAC + S+T+SLS+ S        +  N    L + L  +  ++  IL+   IY+  N+++T+E A    + +     EI +S  GE++  YL+FGV++IG+ S+IY      + + +D NC N   I     E LFF++Q  FI+K++S+VIL   +L +  +  +++ N++IW   S+ K+      K    C  + +  +  YFLP ++EF VI +AI YE+  R+GK++LI+T    + + D+   ++  +P  I+ +++      +    T+++ ++  + S   +  +H  +E   Y+  +  L + F  T  LKFSFTY  + +D NLLF S FLSI F V+I T       E S +    I +  R+++A+ E   ++FQT+VIQD FYRC +    +K KPGQ+ + ILIG+N  LWLLK+ Q+K  DIFF+   K  +       L+ FF+Y T+PLSIL+RYHS+ CLAD+F+K+Y+GE  R E ++R+EGF  C   E                  P +  P+                       + R TI NL  A+ R++SS   H  +  KL A  S
Sbjct:   30 LRKRPKYSKNKWKFFVYTYACFVSSITISLSLIS--------QFINYDLWLRIVLIFMQSVSISILMVFVIYIKWNKNKTYEIAMMATNSNVNKCSEILFSFRGERISRYLQFGVLVIGSCSIIY-SVLRVKESILDVNCRNTFLIIYRLCEFLFFLLQTTFIIKFNSVVILAYHKLTKIAMAQLILTNLSIWIKVSMAKVANTYTVKKM--CKTSMLDYLAFYFLPCLAEFSVISLAILYEMSHRIGKIALIKTNSEMYYKNDNSLSIYELLPGIIVSVLLIFSTFEV----TIYLAILGERISLWILMCIHMLEETCFYLLGLFTLIILFRLTRTLKFSFTYFISTIDINLLFISSFLSITFCVLIFTFTLHLKNERSDLHSFYIIIRARSVTAVFEFCNVVFQTFVIQDCFYRCCERSTIRKKKPGQNCVTILIGINISLWLLKTLQMKRADIFFNSFLKLNIFQDKSNALIYFFIYFTMPLSILFRYHSTVCLADIFTKLYEGESERLECVIRSEGF-TCNAEE-----------------YPNYLDPKE--------------------SKSHRRTIANLYHARKRIVSSQQWHKKLFSKLRADSS 587          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000051187.1 (SMESG000051187.1)

HSP 1 Score: 235.728 bits (600), Expect = 1.836e-67
Identity = 211/708 (29.80%), Postives = 356/708 (50.28%), Query Frame = 1
Query:   46 MDEQINIGVTDLSKKPKYNENMWKNMMFIYACLIISLTLSLSVNSINNEMKNGEISNTSRXXXXXXXXXXXXASGILIALFIYLHMNRHQTFXXXXXXXXXXXXIHYSMCGEKVGLYLRFGVVLIGTLSLIYLGFSSARNNPMDPNCLNLTTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKI-------KYAPLTKNHNNCTNAEIQSIILYFLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTEKDHLVFWRIPRXXXXXXXXXXXXXLCVGFTVFIIVMDNQPSNN-WIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFASCFLSIAFSVIISTCCFQYITENSQIGIQ--MGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPV----LSSDPQ-----FLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQGEVCRFEGILRAEGFIKCG--MNE-KKESECSIPKIIVDE------DGSPKFSRPRAITL-PVIXXXXXXXXXXXXXXXMTRRETIKNLEAAKLRVMSSHLSHNMVSKKLSATVSPSRNSSSHTLNESDYETSPRPNKKKISFQTNAAYSDSEMPTIKNLIMSYPFNFGMRKRNSEDDILNMTSKS 2082
            M+EQI+       K  K NE +    +F+Y+ ++  LT+ +S  S     +N   S     ++V+ +++F+ +S I+I ++IY++ NR QT E A K    + ++  S  GEKV LYLR G+++ G  SL Y+G    R      +  + + I     +  F IIQ  FIL  H ++IL + ++++    ++++ NI IW   S+ KI       ++    K   +C      ++ +YFLP +SE+ VI +AI YE   R+GK  L+   H +     F      I+ ++ G VI + C+  ++  +V      +  WIF  H+ + I++ + SI+IL   +    + KFS +  +N++DKN+L  S   S+ FS++    C   I  +  + I+  + +R  S  +E+ Q   QT+ + DAF RCS +  Q +NKPG++ L IL+G+N G+W L+S Q+KN DI ++K   +       D +      L+ FF+  TLPLS+LYRYHSS+CL+D++SK+YQ E  RFE  LRA    K    M+E  K+S  S+ ++  +       + + +  R +++ + P            +  +KM RR TIKN+E A  +++S+ LS  +  K L                       P+P       Q      +  MP I+N++    F       N ++++ N TS +
Sbjct:    1 MNEQISFESLSHIKNRKNNEKIG---IFLYSSIL--LTIGISSTSYGASFQNA--SENLLFVNVYYSIMFISSSLIMIGMWIYIYRNRFQTSEAAEKGRHANYKLVLSQKGEKVNLYLRLGIIIFGISSLAYIGMR--RGMRFRESNFDASIIIYGVIQGSFIIIQTCFILFNHRLIILTHKKIMKLCFVHLIITNILIWISGSIGKISSDFQKSEFCSKNKYDFSC------NLYIYFLPALSEYAVIVIAIMYEFYTRIGKYKLLRFGHKKSVKPKFSVNSCMIVSMIAGAVIVLFCIFTSISSVVFHVLEIDRIWIFHFHNIEIIILNLLSIIILIFTYLNARKFKFSVSMFNNSLDKNILEVSFIFSLNFSILCLFICGYSIVNSKNMNIRTILIVRIFSGFLEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGINTGMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTESVKQVSFENNDTKLLEDTSRGQRSKSVGMIPA-------NTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNL----------------------KPKPAD-----QYKTKSREKRMPNIQNMVGKGYF-------NRKEELYNKTSDT 652          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000051187.1 (SMESG000051187.1)

HSP 1 Score: 235.728 bits (600), Expect = 4.787e-67
Identity = 211/708 (29.80%), Postives = 356/708 (50.28%), Query Frame = 1
Query:   46 MDEQINIGVTDLSKKPKYNENMWKNMMFIYACLIISLTLSLSVNSINNEMKNGEISNTSRXXXXXXXXXXXXASGILIALFIYLHMNRHQTFXXXXXXXXXXXXIHYSMCGEKVGLYLRFGVVLIGTLSLIYLGFSSARNNPMDPNCLNLTTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKI-------KYAPLTKNHNNCTNAEIQSIILYFLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTEKDHLVFWRIPRXXXXXXXXXXXXXLCVGFTVFIIVMDNQPSNN-WIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNNVDKNLLFASCFLSIAFSVIISTCCFQYITENSQIGIQ--MGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPV----LSSDPQ-----FLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQGEVCRFEGILRAEGFIKCG--MNE-KKESECSIPKIIVDE------DGSPKFSRPRAITL-PVIXXXXXXXXXXXXXXXMTRRETIKNLEAAKLRVMSSHLSHNMVSKKLSATVSPSRNSSSHTLNESDYETSPRPNKKKISFQTNAAYSDSEMPTIKNLIMSYPFNFGMRKRNSEDDILNMTSKS 2082
            M+EQI+       K  K NE +    +F+Y+ ++  LT+ +S  S     +N   S     ++V+ +++F+ +S I+I ++IY++ NR QT E A K    + ++  S  GEKV LYLR G+++ G  SL Y+G    R      +  + + I     +  F IIQ  FIL  H ++IL + ++++    ++++ NI IW   S+ KI       ++    K   +C      ++ +YFLP +SE+ VI +AI YE   R+GK  L+   H +     F      I+ ++ G VI + C+  ++  +V      +  WIF  H+ + I++ + SI+IL   +    + KFS +  +N++DKN+L  S   S+ FS++    C   I  +  + I+  + +R  S  +E+ Q   QT+ + DAF RCS +  Q +NKPG++ L IL+G+N G+W L+S Q+KN DI ++K   +       D +      L+ FF+  TLPLS+LYRYHSS+CL+D++SK+YQ E  RFE  LRA    K    M+E  K+S  S+ ++  +       + + +  R +++ + P            +  +KM RR TIKN+E A  +++S+ LS  +  K L                       P+P       Q      +  MP I+N++    F       N ++++ N TS +
Sbjct:   46 MNEQISFESLSHIKNRKNNEKIG---IFLYSSIL--LTIGISSTSYGASFQNA--SENLLFVNVYYSIMFISSSLIMIGMWIYIYRNRFQTSEAAEKGRHANYKLVLSQKGEKVNLYLRLGIIIFGISSLAYIGMR--RGMRFRESNFDASIIIYGVIQGSFIIIQTCFILFNHRLIILTHKKIMKLCFVHLIITNILIWISGSIGKISSDFQKSEFCSKNKYDFSC------NLYIYFLPALSEYAVIVIAIMYEFYTRIGKYKLLRFGHKKSVKPKFSVNSCMIVSMIAGAVIVLFCIFTSISSVVFHVLEIDRIWIFHFHNIEIIILNLLSIIILIFTYLNARKFKFSVSMFNNSLDKNILEVSFIFSLNFSILCLFICGYSIVNSKNMNIRTILIVRIFSGFLEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGINTGMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTESVKQVSFENNDTKLLEDTSRGQRSKSVGMIPA-------NTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNL----------------------KPKPAD-----QYKTKSREKRMPNIQNMVGKGYF-------NRKEELYNKTSDT 697          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000051187.1 (SMESG000051187.1)

HSP 1 Score: 143.28 bits (360), Expect = 1.178e-35
Identity = 113/372 (30.38%), Postives = 182/372 (48.92%), Query Frame = 1
Query: 1030 ILYLAFSKTNQLKFSFTYLSNNVDKNLLFASCFLSIAFSVIISTCCFQYITENSQIGIQ--MGIRAISALIEIFQIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQLKNGDIFFHKKSPV----LSSDPQ-----FLLTFFVYLTLPLSILYRYHSSSCLADVFSKIYQGEVCRFEGILRAEGFIKCG--MNE-KKESECSIPKIIVDE------DGSPKFSRPRAITL-PVIXXXXXXXXXXXXXXXMTRRETIKNLEAAKLRVMSSHLSHNMVSKKLSATVSPSRNSSSHTLNESDYETSPRPNKKKISFQTNAAYSDSEMPTIKNLIMSYPFNFGMRKRNSEDDILNMTSKS 2082
            +L     K+ + KFS      N  KN+L  S   S+ FS++    C   I  +  + I+  + +R  S  +E+ Q   QT+ + DAF RCS +  Q +NKPG++ L IL+G+N G+W L+S Q+KN DI ++K   +       D +      L+ FF+  TLPLS+LYRYHSS+CL+D++SK+YQ E  RFE  LRA    K    M+E  K+S  S+ ++  +       + + +  R +++ + P            +  +KM RR TIKN+E A  +++S+ LS  +  K L                       P+P     + Q      +  MP I+N++    F       N ++++ N TS +
Sbjct:  251 LLRFGHKKSVKPKFSV-----NSYKNILEVSFIFSLNFSILCLFICGYSIVNSKNMNIRTILIVRIFSGFLEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGINTGMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTESVKQVSFENNDTKLLEDTSRGQRSKSVGMIPA-------NTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNL----------------------KPKP-----ADQYKTKSREKRMPNIQNMVGKGYF-------NRKEELYNKTSDT 576          

HSP 2 Score: 98.5969 bits (244), Expect = 3.506e-21
Identity = 82/269 (30.48%), Postives = 142/269 (52.79%), Query Frame = 1
Query:   46 MDEQINIGVTDLSKKPKYNENMWKNMMFIYACLIISLTLSLSVNSINNEMKNGEISNTSRXXXXXXXXXXXXASGILIALFIYLHMNRHQTFXXXXXXXXXXXXIHYSMCGEKVGLYLRFGVVLIGTLSLIYLGFSSARNNPMDPNCLNLTTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIWQISSLTKIKYAPLTKNHNNCTNAEIQ---SIILYFLPTVSEFCVICMAIFYELQKRLGKLSLIETAHTE 843
            M+EQI+       K  K NE +    +F+Y+ ++  LT+ +S  S     +N   S     ++V+ +++F+ +S I+I ++IY++ NR QT E A K    + ++  S  GEKV LYLR G+++ G  SL Y+G    R      +  + + I     +  F IIQ  FIL  H ++IL + ++++    ++++ NI IW   S+ KI  +   +    C+  +     ++ +YFLP +SE+ VI +AI YE   R+GK  L+   H +
Sbjct:    1 MNEQISFESLSHIKNRKNNEKIG---IFLYSSIL--LTIGISSTSYGASFQNA--SENLLFVNVYYSIMFISSSLIMIGMWIYIYRNRFQTSEAAEKGRHANYKLVLSQKGEKVNLYLRLGIIIFGISSLAYIGMR--RGMRFRESNFDASIIIYGVIQGSFIIIQTCFILFNHRLIILTHKKIMKLCFVHLIITNILIWISGSIGKI--SSDFQKSEFCSKNKYDFSCNLYIYFLPALSEYAVIVIAIMYEFYTRIGKYKLLRFGHKK 258          
The following BLAST results are available for this feature:
BLAST of Otopetrin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otopetrin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
otpl-34.862e-1019.82OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL... [more]
otpl-34.862e-1019.82OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL... [more]
otpl-67.950e-822.12OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q2297... [more]
back to top
BLAST of Otopetrin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OtopLc1.474e-1020.40gene:FBgn0259150 transcript:FBtr0346834[more]
OtopLc1.835e-1020.40gene:FBgn0259150 transcript:FBtr0331167[more]
OtopLc2.085e-1020.40gene:FBgn0259150 transcript:FBtr0331168[more]
OtopLa2.246e-622.77gene:FBgn0259994 transcript:FBtr0300465[more]
OtopLa2.965e-622.77gene:FBgn0259994 transcript:FBtr0300466[more]
back to top
BLAST of Otopetrin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otopetrin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otopetrin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otopetrin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|B7Z0W9|OTOP_DROME1.839e-920.40Proton channel OtopLc OS=Drosophila melanogaster O... [more]
back to top
BLAST of Otopetrin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183A6V61.684e-6328.27Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A4E0RKK51.321e-6027.29Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A504X7Y36.117e-6027.12Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A4E0RRU21.445e-5929.76Otopetrin OS=Fasciola hepatica OX=6192 GN=D915_000... [more]
A0A504YVQ83.002e-5929.76Otopetrin OS=Fasciola gigantica OX=46835 GN=FGIG_0... [more]
back to top
BLAST of Otopetrin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otopetrin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otopetrin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otopetrin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otopetrin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otopetrin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058901.10.000e+099.86SMESG000058901.1[more]
SMESG000043827.11.256e-9433.39SMESG000043827.1[more]
SMESG000051187.11.836e-6729.80SMESG000051187.1[more]
SMESG000051187.14.787e-6729.80SMESG000051187.1[more]
SMESG000051187.11.178e-3530.38SMESG000051187.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025256 ID=SMED30025256|Name=Otopetrin|organism=Schmidtea mediterranea sexual|type=transcript|length=2288bp
CGTTTTTTGATAGTCTCTTAAAATATTTAACATCAAATAGGTTTTATGGA
TGAACAAATTAATATTGGAGTGACTGACTTGTCAAAAAAGCCAAAATACA
ATGAAAACATGTGGAAAAATATGATGTTTATCTATGCTTGCCTAATCATA
TCTCTCACACTATCTCTTTCTGTCAATTCAATTAACAACGAAATGAAAAA
TGGCGAAATAAGTAACACCAGCCGTGTTTTAGATGTATTTTTAACTGTAC
TTTTTGTTCTTGCCAGTGGAATTCTGATAGCTCTATTCATCTATCTCCAC
ATGAATCGCCATCAAACCTTTGAAGAAGCCAATAAAGAAAACTCCAAATC
TTCGGAAATCCATTATTCAATGTGTGGAGAAAAAGTCGGTCTGTACCTTC
GTTTTGGTGTTGTATTAATTGGAACTTTGTCACTTATTTACCTTGGATTC
TCGAGTGCAAGGAACAATCCAATGGATCCAAATTGTTTGAATTTAACTAC
TATTTTTAGTTGTGCTGCAGAAATTCTATTTTTTATAATTCAGGGAGCCT
TTATCCTAAAATATCATTCGATTGTTATCTTAAAAAATACTCGACTTATT
CAGTTTGGGTTGTATAATATTGTCGTCCTAAATATAACAATATGGCAGAT
ATCATCACTGACGAAAATCAAGTATGCTCCACTAACTAAAAACCATAATA
ATTGCACCAACGCGGAAATTCAAAGTATAATTTTGTATTTTTTACCGACA
GTATCTGAATTTTGCGTCATTTGTATGGCGATTTTTTATGAACTTCAGAA
GCGGTTAGGAAAATTATCATTAATTGAAACTGCTCACACGGAAAAAGATC
ACTTGGTATTTTGGAGAATACCCAGAGCAATAATTGGTATTGTAATTGGG
ATAGTTATAGCAGTGCTTTGTGTTGGGTTTACAGTTTTTATAATAGTAAT
GGATAATCAACCAAGCAATAATTGGATATTTACGGTGCATAGTTCACAGG
AAATAGTTATTTATATTTTCTCCATAGTCATTCTCTACTTGGCATTTTCC
AAAACAAACCAACTGAAATTTAGTTTCACTTATCTTTCTAATAATGTGGA
CAAAAATCTATTATTTGCTTCATGTTTTCTTTCTATAGCTTTCTCAGTAA
TAATAAGCACTTGTTGCTTTCAATATATAACTGAAAACTCCCAAATCGGC
ATCCAAATGGGTATTAGGGCAATATCGGCATTAATAGAAATTTTTCAAAT
AATTTTTCAAACTTATGTGATTCAAGACGCCTTTTATCGTTGCAGTGACA
ACATTGAACAGCAGAAAAATAAGCCTGGTCAAAGTTATTTAGGAATATTA
ATTGGTGTTAATTTCGGATTATGGCTTCTAAAAAGTTTCCAATTGAAAAA
TGGTGATATTTTCTTTCACAAGAAGTCTCCGGTGTTGTCAAGTGATCCAC
AATTTCTTCTAACATTTTTTGTATATTTAACTTTGCCTTTGTCAATATTA
TACAGATATCATTCAAGTTCCTGTTTGGCTGATGTTTTTTCGAAAATTTA
TCAAGGTGAAGTGTGTAGGTTTGAAGGAATTTTACGAGCTGAAGGTTTTA
TTAAATGTGGAATGAACGAAAAGAAAGAATCCGAATGTAGCATTCCAAAA
ATAATTGTAGATGAAGATGGGTCACCGAAATTTAGTAGACCAAGAGCAAT
AACTCTTCCTGTTATTCCGCCTTTTAATTCTAAACCGAAGAAAAATAATA
CCTCTAAAAAAATGACAAGAAGGGAAACTATTAAAAATTTAGAAGCGGCA
AAATTAAGAGTAATGTCATCTCATTTGTCTCATAATATGGTGAGTAAAAA
ATTATCTGCAACAGTTTCTCCTTCTCGTAATTCTTCATCTCATACTCTCA
ATGAAAGTGACTACGAAACTAGTCCTAGACCAAACAAGAAAAAGATATCT
TTTCAAACCAATGCTGCTTATTCAGATTCCGAAATGCCCACTATTAAAAA
TCTAATCATGTCTTATCCTTTCAATTTCGGCATGCGGAAAAGAAATTCTG
AAGACGATATATTAAATATGACTTCAAAATCTTATACTCTGGCTGCCAAA
CCTATTAGTGAACATAAAGATGAGGAAGTTTAGATATTATTTGTAACTTT
ACAACAAAAATCATTTTCAGTGATATTTCAAAAAGATGATGATATTTTAT
ATATTAATCAAATTGAAATTATTTTTTACCATTTACAATAATTTTAAAAA
TATTTGAAACATAATATATTTGTCAGCTAATCAAAAAA
back to top

protein sequence of SMED30025256-orf-1

>SMED30025256-orf-1 ID=SMED30025256-orf-1|Name=SMED30025256-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=696bp
MDEQINIGVTDLSKKPKYNENMWKNMMFIYACLIISLTLSLSVNSINNEM
KNGEISNTSRVLDVFLTVLFVLASGILIALFIYLHMNRHQTFEEANKENS
KSSEIHYSMCGEKVGLYLRFGVVLIGTLSLIYLGFSSARNNPMDPNCLNL
TTIFSCAAEILFFIIQGAFILKYHSIVILKNTRLIQFGLYNIVVLNITIW
QISSLTKIKYAPLTKNHNNCTNAEIQSIILYFLPTVSEFCVICMAIFYEL
QKRLGKLSLIETAHTEKDHLVFWRIPRAIIGIVIGIVIAVLCVGFTVFII
VMDNQPSNNWIFTVHSSQEIVIYIFSIVILYLAFSKTNQLKFSFTYLSNN
VDKNLLFASCFLSIAFSVIISTCCFQYITENSQIGIQMGIRAISALIEIF
QIIFQTYVIQDAFYRCSDNIEQQKNKPGQSYLGILIGVNFGLWLLKSFQL
KNGDIFFHKKSPVLSSDPQFLLTFFVYLTLPLSILYRYHSSSCLADVFSK
IYQGEVCRFEGILRAEGFIKCGMNEKKESECSIPKIIVDEDGSPKFSRPR
AITLPVIPPFNSKPKKNNTSKKMTRRETIKNLEAAKLRVMSSHLSHNMVS
KKLSATVSPSRNSSSHTLNESDYETSPRPNKKKISFQTNAAYSDSEMPTI
KNLIMSYPFNFGMRKRNSEDDILNMTSKSYTLAAKPISEHKDEEV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR004878Otopetrin
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004878OtopetrinPFAMPF03189Otopetrincoord: 219..488
e-value: 1.7E-19
score: 70.0
coord: 117..207
e-value: 7.7E-10
score: 38.2
IPR004878OtopetrinPANTHERPTHR21522OTOPETRINcoord: 24..503
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 598..635
NoneNo IPR availableTMHMMTMhelixcoord: 61..83
NoneNo IPR availableTMHMMTMhelixcoord: 279..301
NoneNo IPR availableTMHMMTMhelixcoord: 183..205
NoneNo IPR availableTMHMMTMhelixcoord: 27..46
NoneNo IPR availableTMHMMTMhelixcoord: 148..170
NoneNo IPR availableTMHMMTMhelixcoord: 116..138
NoneNo IPR availableTMHMMTMhelixcoord: 316..335
NoneNo IPR availableTMHMMTMhelixcoord: 431..450
NoneNo IPR availableTMHMMTMhelixcoord: 225..247
NoneNo IPR availableTMHMMTMhelixcoord: 388..410
NoneNo IPR availableTMHMMTMhelixcoord: 356..378
NoneNo IPR availableTMHMMTMhelixcoord: 470..489