THAP domain containing 4

Overview
NameTHAP domain containing 4
Smed IDSMED30025250
Length (bp)684
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of THAP domain containing 4 (SMED30025250) t-SNE clustered cells

Violin plots show distribution of expression levels for THAP domain containing 4 (SMED30025250) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of THAP domain containing 4 (SMED30025250) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for THAP domain containing 4 (SMED30025250) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025250

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025250SMESG000061518.1 dd_Smed_v6_5940_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of THAP domain containing 4 vs. Ensembl Human
Match: THAP4 (THAP domain containing 4 [Source:HGNC Symbol;Acc:HGNC:23187])

HSP 1 Score: 126.331 bits (316), Expect = 5.449e-36
Identity = 67/166 (40.36%), Postives = 101/166 (60.84%), Query Frame = 2
Query:   80 MIADKVNANIKELAWMLGKWVG-KNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            M   K+N  ++ L+WMLG W+    G G YPT++PF+Y E + I+ +GQP  NF +NS   + +    MHRECGF+RL PD + ++ + AQN+  V   E    N + L   S  + RIS+AKEP V ++ R F L  + KL Q + M+TT T  +T+HL++ Y++
Sbjct:    1 MEPPKMNPVVEPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSF--HPDTRKPMHRECGFIRLKPDTNKVAFVSAQNT-GVVEVEEGEVNGQELCIASHSIARISFAKEPHVEQITRKFRLNSEGKLEQTVSMATT-TQPMTQHLHVTYKK 162          
BLAST of THAP domain containing 4 vs. Ensembl Human
Match: THAP4 (THAP domain containing 4 [Source:HGNC Symbol;Acc:HGNC:23187])

HSP 1 Score: 126.331 bits (316), Expect = 6.679e-33
Identity = 66/162 (40.74%), Postives = 100/162 (61.73%), Query Frame = 2
Query:   92 KVNANIKELAWMLGKWVG-KNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            K+N  ++ L+WMLG W+    G G YPT++PF+Y E + I+ +GQP  NF +NS   + +    MHRECGF+RL PD + ++ + AQN+  V   E    N + L   S  + RIS+AKEP V ++ R F L  + KL Q + M+TT T  +T+HL++ Y++
Sbjct:  417 KMNPVVEPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSF--HPDTRKPMHRECGFIRLKPDTNKVAFVSAQNT-GVVEVEEGEVNGQELCIASHSIARISFAKEPHVEQITRKFRLNSEGKLEQTVSMATT-TQPMTQHLHVTYKK 574          
BLAST of THAP domain containing 4 vs. Ensembl Human
Match: THAP4 (THAP domain containing 4 [Source:HGNC Symbol;Acc:HGNC:23187])

HSP 1 Score: 112.464 bits (280), Expect = 2.275e-30
Identity = 68/193 (35.23%), Postives = 101/193 (52.33%), Query Frame = 2
Query:   80 MIADKVNANIKELAWMLGKWVG-KNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVK---------------------------RVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            M   K+N  ++ L+WMLG W+    G G YPT++PF+Y E + I+ +GQP  NF +NS   + +    MHRECGF+RL PD + ++ + AQN+  V   E    N + L   S  + RIS+AKEP V +V                            R F L  + KL Q + M+TT T  +T+HL++ Y++
Sbjct:    1 MEPPKMNPVVEPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSF--HPDTRKPMHRECGFIRLKPDTNKVAFVSAQNT-GVVEVEEGEVNGQELCIASHSIARISFAKEPHVEQVSPALLPARSCLLFAAVCGVSLFLFREITRKFRLNSEGKLEQTVSMATT-TQPMTQHLHVTYKK 189          
BLAST of THAP domain containing 4 vs. Ensembl Human
Match: THAP4 (THAP domain containing 4 [Source:HGNC Symbol;Acc:HGNC:23187])

HSP 1 Score: 77.411 bits (189), Expect = 2.865e-17
Identity = 36/79 (45.57%), Postives = 51/79 (64.56%), Query Frame = 2
Query:   92 KVNANIKELAWMLGKWVG-KNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKS 319
            K+N  ++ L+WMLG W+    G G YPT++PF+Y E + I+ +GQP  NF +NS   + +    MHRECGF+RL P  S
Sbjct:   92 KMNPVVEPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSF--HPDTRKPMHRECGFIRLKPGSS 168          
BLAST of THAP domain containing 4 vs. Ensembl Celegans
Match: C28H8.5 (pep chromosome:WBcel235:III:5884330:5885848:1 gene:WBGene00016196.1 transcript:C28H8.5b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C28H8.5)

HSP 1 Score: 85.5001 bits (210), Expect = 5.353e-20
Identity = 54/171 (31.58%), Postives = 95/171 (55.56%), Query Frame = 2
Query:  101 ANIKELAWMLGKWVGK-NGKGVYPTIKPFKYNETLEIT------EMGQPNFHYNSVTH--NAENGNL--MHRECGFVRLSPDKST----ISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            A +K +AWM+G+W  +  GK  +PTI  F Y E ++IT      +   P  +Y +     N  +G+   +H E G++ +  DK      +SL  A ++G +TIEEG+ +    + F  + +GRIS++ +  V  + R +TL+D+ +L  ++ M+TT T  L EH  ++Y++
Sbjct:   82 AKLKSIAWMVGRWRSEFGGKAFFPTIPKFTYGEQVDITIADNSQDTHTPLLNYTAFAWDINMPDGDPTEIHSENGYIAVEYDKEQEKEYVSLNTAMSNGFMTIEEGE-SGPNQVKFRLQRIGRISFSHDSAVRIMFREWTLLDENRLEARLLMTTTITRRLMEHTAVIYKK 251          
BLAST of THAP domain containing 4 vs. Ensembl Celegans
Match: C28H8.5 (pep chromosome:WBcel235:III:5884451:5885848:1 gene:WBGene00016196.1 transcript:C28H8.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C28H8.5)

HSP 1 Score: 85.5001 bits (210), Expect = 5.353e-20
Identity = 54/171 (31.58%), Postives = 95/171 (55.56%), Query Frame = 2
Query:  101 ANIKELAWMLGKWVGK-NGKGVYPTIKPFKYNETLEIT------EMGQPNFHYNSVTH--NAENGNL--MHRECGFVRLSPDKST----ISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            A +K +AWM+G+W  +  GK  +PTI  F Y E ++IT      +   P  +Y +     N  +G+   +H E G++ +  DK      +SL  A ++G +TIEEG+ +    + F  + +GRIS++ +  V  + R +TL+D+ +L  ++ M+TT T  L EH  ++Y++
Sbjct:   82 AKLKSIAWMVGRWRSEFGGKAFFPTIPKFTYGEQVDITIADNSQDTHTPLLNYTAFAWDINMPDGDPTEIHSENGYIAVEYDKEQEKEYVSLNTAMSNGFMTIEEGE-SGPNQVKFRLQRIGRISFSHDSAVRIMFREWTLLDENRLEARLLMTTTITRRLMEHTAVIYKK 251          
BLAST of THAP domain containing 4 vs. Ensembl Celegans
Match: C28H8.5 (pep chromosome:WBcel235:III:5884307:5885848:1 gene:WBGene00016196.1 transcript:C28H8.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C28H8.5)

HSP 1 Score: 85.5001 bits (210), Expect = 1.408e-19
Identity = 54/171 (31.58%), Postives = 95/171 (55.56%), Query Frame = 2
Query:  101 ANIKELAWMLGKWVGK-NGKGVYPTIKPFKYNETLEIT------EMGQPNFHYNSVTH--NAENGNL--MHRECGFVRLSPDKST----ISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            A +K +AWM+G+W  +  GK  +PTI  F Y E ++IT      +   P  +Y +     N  +G+   +H E G++ +  DK      +SL  A ++G +TIEEG+ +    + F  + +GRIS++ +  V  + R +TL+D+ +L  ++ M+TT T  L EH  ++Y++
Sbjct:  130 AKLKSIAWMVGRWRSEFGGKAFFPTIPKFTYGEQVDITIADNSQDTHTPLLNYTAFAWDINMPDGDPTEIHSENGYIAVEYDKEQEKEYVSLNTAMSNGFMTIEEGE-SGPNQVKFRLQRIGRISFSHDSAVRIMFREWTLLDENRLEARLLMTTTITRRLMEHTAVIYKK 299          
BLAST of THAP domain containing 4 vs. Ensembl Celegans
Match: C15F1.1 (pep chromosome:WBcel235:II:6989880:6991797:1 gene:WBGene00015794.1 transcript:C15F1.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C15F1.1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.334e-18
Identity = 47/165 (28.48%), Postives = 90/165 (54.55%), Query Frame = 2
Query:   92 KVNANIKELAWMLGKWVGKNG-KGVYPTIKPFKYNETLEITEMGQP-----NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            +++  +  + +++GKW  ++G K ++PTI  F + E +EI+  G         +Y +   +  + + +H E G++ + P+   ++L    N+G VT+EEG + N   + F  KD+GRIS++++  V  + R +TL+D   L  ++ M T  T  + EH  I Y +
Sbjct:   72 RLSQELTPIGFLVGKWRSEHGGKAIFPTIPKFTFGEEIEISIPGDAMQSAQALNYTAFAWSINDKDELHSEYGYISVKPNTKEVALTTVMNNGFVTVEEGPV-NGNQIRFRLKDIGRISFSRDLPVHDLVREWTLLDRSTLQARLNMETL-THGMQEHTFIRYNK 234          
BLAST of THAP domain containing 4 vs. Ensembl Celegans
Match: T28H10.2 (pep chromosome:WBcel235:V:12510645:12512201:-1 gene:WBGene00012143.1 transcript:T28H10.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T28H10.2)

HSP 1 Score: 76.6406 bits (187), Expect = 8.056e-17
Identity = 46/165 (27.88%), Postives = 95/165 (57.58%), Query Frame = 2
Query:   92 KVNANIKELAWMLGKWVGKN-GKGVYPTIKPFKYNETLEITEMGQPN---FHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYERQA 574
            ++N  ++ +  ++G+W G++ GK  +PTI  FKY E +EI+     N    +Y +   +++  +L HRE G++ + P+   + L    ++G +T+EEG +    ++ F+ KD+GRIS+ ++  +  + R +TL D+  L  ++ + T  +  + EH +I+Y + +
Sbjct:   67 RLNPQLQPIHQLVGRWKGEHTGKVTFPTIPTFKYTEEVEISIPEGSNIRSLNYTAAAWSSDKEDL-HRESGYIIIKPNTREVILTTVMSNGFITVEEGSMVG-NNIKFMLKDIGRISFVRDEHLHNLIREWTL-DNGYLRARLSIQTL-SHRMQEHTSILYTKTS 227          
BLAST of THAP domain containing 4 vs. Ensembl Zebrafish
Match: thap4 (THAP domain containing 4 [Source:ZFIN;Acc:ZDB-GENE-070912-5])

HSP 1 Score: 137.887 bits (346), Expect = 1.046e-40
Identity = 70/171 (40.94%), Postives = 106/171 (61.99%), Query Frame = 2
Query:   65 LRIEFMIADKVNANIKELAWMLGKWVG-KNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            +   F  +  +N  +  L W+LG W   + G+G +P+I PF+Y ETL  + +GQP  NF +N+   +AE+   +HRECGF+RL P  + ++ IIAQNSG+V IEEG++T ++ LT  S  L R S+AK+P V ++ R   L  D +L Q + M+  +   LT+HL+I Y R
Sbjct:    1 MSCPFNYSADLNPAVLPLDWLLGTWQSDEPGEGSFPSIAPFRYTETLHFSHVGQPVVNFMFNAF--HAESKKPLHRECGFIRLQPGTNRVAFIIAQNSGLVEIEEGELTGQQ-LTLQSTALARTSFAKQPHVQQISRHIQLRADGRLEQTVCMA-LEGQPLTQHLHITYRR 167          
BLAST of THAP domain containing 4 vs. Ensembl Zebrafish
Match: thap4 (THAP domain containing 4 [Source:ZFIN;Acc:ZDB-GENE-070912-5])

HSP 1 Score: 137.887 bits (346), Expect = 1.046e-40
Identity = 70/171 (40.94%), Postives = 106/171 (61.99%), Query Frame = 2
Query:   65 LRIEFMIADKVNANIKELAWMLGKWVG-KNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            +   F  +  +N  +  L W+LG W   + G+G +P+I PF+Y ETL  + +GQP  NF +N+   +AE+   +HRECGF+RL P  + ++ IIAQNSG+V IEEG++T ++ LT  S  L R S+AK+P V ++ R   L  D +L Q + M+  +   LT+HL+I Y R
Sbjct:    1 MSCPFNYSADLNPAVLPLDWLLGTWQSDEPGEGSFPSIAPFRYTETLHFSHVGQPVVNFMFNAF--HAESKKPLHRECGFIRLQPGTNRVAFIIAQNSGLVEIEEGELTGQQ-LTLQSTALARTSFAKQPHVQQISRHIQLRADGRLEQTVCMA-LEGQPLTQHLHITYRR 167          
BLAST of THAP domain containing 4 vs. Ensembl Xenopus
Match: thap4 (THAP domain containing 4 [Source:NCBI gene;Acc:780282])

HSP 1 Score: 130.568 bits (327), Expect = 8.521e-35
Identity = 70/167 (41.92%), Postives = 106/167 (63.47%), Query Frame = 2
Query:   71 IEFMIADKVNANIKELAWMLGKWVGKN-GKGVYPTIKPFKYNETLEITEMGQPNFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            +E   +  +N  + +LAWMLG WV +  G+G +PTI PF+Y E   IT +GQP  ++     NAE G  MHRECGF+R+ P  + ++ I AQN+G+V +EEG++  E+ L+  S  + RIS+AKEP VT++ R F L  + KL Q ++M+T  +  L  HL++ Y +
Sbjct:  335 LELQSSPPLNPVVSQLAWMLGTWVSEPAGEGQFPTIPPFRYMEEATITHVGQPMLNFMFCASNAETGKPMHRECGFIRIKPGTNHVAFISAQNTGVVEVEEGEVEGEQ-LSLTSNSVSRISFAKEPHVTQISRKFRLTPEGKLEQTVFMATA-SQSLAPHLHVTYRK 499          
BLAST of THAP domain containing 4 vs. Ensembl Mouse
Match: Thap4 (THAP domain containing 4 [Source:MGI Symbol;Acc:MGI:1914276])

HSP 1 Score: 142.51 bits (358), Expect = 1.865e-42
Identity = 72/166 (43.37%), Postives = 108/166 (65.06%), Query Frame = 2
Query:   80 MIADKVNANIKELAWMLGKWVG-KNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            M   K+N  ++ L+WMLG W+    G G +PT++PF+Y E + I+ +GQP  NF +NS   + E    MHRECGF+RL PD + ++ + AQN+GIV +EEG++ N + L   S  + RIS+AKEP V ++ R F L  + KL Q + M+TT T  +T+HL+I Y++
Sbjct:    1 MEPPKLNPVVEPLSWMLGTWLSDPPGVGTFPTLQPFQYLEEVHISHVGQPMLNFSFNSF--HPETHKPMHRECGFIRLKPDTNKVAFVSAQNTGIVEVEEGEV-NGQELCVSSHSVSRISFAKEPHVEQITRKFRLNSEGKLEQTVSMATT-TQPMTQHLHITYKK 162          
BLAST of THAP domain containing 4 vs. Ensembl Mouse
Match: Thap4 (THAP domain containing 4 [Source:MGI Symbol;Acc:MGI:1914276])

HSP 1 Score: 142.51 bits (358), Expect = 4.928e-39
Identity = 71/162 (43.83%), Postives = 107/162 (66.05%), Query Frame = 2
Query:   92 KVNANIKELAWMLGKWVG-KNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            K+N  ++ L+WMLG W+    G G +PT++PF+Y E + I+ +GQP  NF +NS   + E    MHRECGF+RL PD + ++ + AQN+GIV +EEG++ N + L   S  + RIS+AKEP V ++ R F L  + KL Q + M+TT T  +T+HL+I Y++
Sbjct:  409 KLNPVVEPLSWMLGTWLSDPPGVGTFPTLQPFQYLEEVHISHVGQPMLNFSFNSF--HPETHKPMHRECGFIRLKPDTNKVAFVSAQNTGIVEVEEGEV-NGQELCVSSHSVSRISFAKEPHVEQITRKFRLNSEGKLEQTVSMATT-TQPMTQHLHITYKK 566          
BLAST of THAP domain containing 4 vs. Ensembl Mouse
Match: Thap4 (THAP domain containing 4 [Source:MGI Symbol;Acc:MGI:1914276])

HSP 1 Score: 118.242 bits (295), Expect = 8.269e-33
Identity = 57/128 (44.53%), Postives = 84/128 (65.62%), Query Frame = 2
Query:   86 ADKVNANIKELAWMLGKWVG-KNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKV 460
              K+N  ++ L+WMLG W+    G G +PT++PF+Y E + I+ +GQP  NF +NS   + E    MHRECGF+RL PD + ++ + AQN+GIV +EEG++ N + L   S  + RIS+AKEP V +V
Sbjct:   38 PPKLNPVVEPLSWMLGTWLSDPPGVGTFPTLQPFQYLEEVHISHVGQPMLNFSFNSF--HPETHKPMHRECGFIRLKPDTNKVAFVSAQNTGIVEVEEGEV-NGQELCVSSHSVSRISFAKEPHVEQV 162          
BLAST of THAP domain containing 4 vs. UniProt/SwissProt
Match: sp|Q6P3Z3|THAP4_MOUSE (THAP domain-containing protein 4 OS=Mus musculus OX=10090 GN=Thap4 PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 3.447e-38
Identity = 71/162 (43.83%), Postives = 107/162 (66.05%), Query Frame = 2
Query:   92 KVNANIKELAWMLGKWVG-KNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            K+N  ++ L+WMLG W+    G G +PT++PF+Y E + I+ +GQP  NF +NS   + E    MHRECGF+RL PD + ++ + AQN+GIV +EEG++ N + L   S  + RIS+AKEP V ++ R F L  + KL Q + M+TT T  +T+HL+I Y++
Sbjct:  409 KLNPVVEPLSWMLGTWLSDPPGVGTFPTLQPFQYLEEVHISHVGQPMLNFSFNSF--HPETHKPMHRECGFIRLKPDTNKVAFVSAQNTGIVEVEEGEV-NGQELCVSSHSVSRISFAKEPHVEQITRKFRLNSEGKLEQTVSMATT-TQPMTQHLHITYKK 566          
BLAST of THAP domain containing 4 vs. UniProt/SwissProt
Match: sp|Q2TBI2|THAP4_BOVIN (THAP domain-containing protein 4 OS=Bos taurus OX=9913 GN=THAP4 PE=2 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 1.081e-36
Identity = 67/162 (41.36%), Postives = 106/162 (65.43%), Query Frame = 2
Query:   92 KVNANIKELAWMLGKWVGKN-GKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            K++  ++ L+WMLG W+ +  G G +PT++PF+Y E   I+ +GQP  NF +N+   + +    MHRECGF+RL PD + ++ + AQN+GIV +EEG++ N + L   S  + RIS+AKEP V ++ R F L  +  L Q + M+TT T  LT+HL++ Y++
Sbjct:  424 KMSPVVEPLSWMLGTWLSEPPGAGTFPTLQPFRYLEEAHISHVGQPMLNFSFNAF--HPDTHKPMHRECGFIRLEPDTNKVAFVSAQNTGIVEVEEGEV-NGQELCIASHSIARISFAKEPHVEQITRKFRLNSEGNLEQTVSMATT-TQPLTQHLHVTYKK 581          
BLAST of THAP domain containing 4 vs. UniProt/SwissProt
Match: sp|Q8WY91|THAP4_HUMAN (THAP domain-containing protein 4 OS=Homo sapiens OX=9606 GN=THAP4 PE=1 SV=2)

HSP 1 Score: 126.331 bits (316), Expect = 3.207e-32
Identity = 66/162 (40.74%), Postives = 100/162 (61.73%), Query Frame = 2
Query:   92 KVNANIKELAWMLGKWVG-KNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            K+N  ++ L+WMLG W+    G G YPT++PF+Y E + I+ +GQP  NF +NS   + +    MHRECGF+RL PD + ++ + AQN+  V   E    N + L   S  + RIS+AKEP V ++ R F L  + KL Q + M+TT T  +T+HL++ Y++
Sbjct:  417 KMNPVVEPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSF--HPDTRKPMHRECGFIRLKPDTNKVAFVSAQNT-GVVEVEEGEVNGQELCIASHSIARISFAKEPHVEQITRKFRLNSEGKLEQTVSMATT-TQPMTQHLHVTYKK 574          
BLAST of THAP domain containing 4 vs. UniProt/SwissProt
Match: sp|Q642B6|THAP4_RAT (THAP domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Thap4 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 6.072e-32
Identity = 67/162 (41.36%), Postives = 101/162 (62.35%), Query Frame = 2
Query:   92 KVNANIKELAWMLGKWVGKN-GKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            K+N  ++ L+WMLG W+ +  G G +PT++PF+Y E + I+ +GQP  NF +NS   + E    MHRECGF+RL PD + ++ + AQN+  V   E    N + L   S  + RIS+AKEP V ++ R F L  + KL Q + M+TT T  +T+HL+I Y++
Sbjct:  409 KLNPVVEPLSWMLGTWLSEPPGVGTFPTLQPFQYLEEVHISHVGQPMLNFSFNSF--HPETHKPMHRECGFIRLKPDTNKVAFVSAQNT-GVVEVEEGEVNGQELCVSSHSISRISFAKEPHVQQITRKFRLNSEGKLEQTVSMATT-TQPMTQHLHITYKK 566          
BLAST of THAP domain containing 4 vs. UniProt/SwissProt
Match: sp|A1T297|Y449_MYCVP (UPF0678 fatty acid-binding protein-like protein Mvan_0449 OS=Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / NRRL B-24157 / PYR-1) OX=350058 GN=Mvan_0449 PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.605e-22
Identity = 62/169 (36.69%), Postives = 90/169 (53.25%), Query Frame = 2
Query:   83 IADKVNA---NIKELAWMLGKWVGKNGKGVYPTIKPFKYNETLEITEMGQPNFHYNSVTHNAENGNLMHRECGFVRLS-PDKSTISLIIAQNSGIVTIEEGKITNEKS---LTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            +AD V A   ++  LA +LG WVG+ G G YPTI+PF Y E +    +G+P   Y   T  A++G  +H E G++R S PD+  I  I+A  +GI  I+EG++T +     +  +S  +GR   AKE  VT V R   L  D  L+  + M+      L  HL+ V  R
Sbjct:    1 MADSVPALHPDVAALAPLLGTWVGE-GSGEYPTIEPFGYTEEITFGHVGKPFLTYAQRTRAADDGRPLHAETGYLRASAPDR--IEWILAHPTGITEIQEGQLTADGDGLRMELVSSSIGRSGSAKE--VTDVGRSIELRGD-TLTYTLRMAAVGQ-PLQHHLSAVLRR 162          
BLAST of THAP domain containing 4 vs. TrEMBL
Match: W5MHD4 (THAP domain containing 4 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.570e-42
Identity = 74/159 (46.54%), Postives = 110/159 (69.18%), Query Frame = 2
Query:   95 VNANIKELAWMLGKWVG-KNGKGVYPTIKPFKYNETLEITEMGQPNFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            +N  ++ LAW+LG W   + G+G YP+I+PF+Y ETL I+ +GQP  ++     +AE    +HRECGF+RL      ++LI+AQNSG+V IEEG++T ++ LT  SKDL RIS+AKEP+V ++ RVF L +D +L Q + M+ T +  L++HL+I Y R
Sbjct:  335 LNPAVQPLAWLLGTWQSDEPGEGSYPSIQPFRYTETLHISHVGQPVLNFMFSAFHAETKRPLHRECGFIRLQAGTQRVALIVAQNSGLVEIEEGELTGQQ-LTLQSKDLARISFAKEPYVQQISRVFQLKEDGRLEQTVSMA-TGSQPLSQHLHITYRR 491          
BLAST of THAP domain containing 4 vs. TrEMBL
Match: A0A3B3YJA1 (THAP domain containing 4 OS=Poecilia mexicana OX=48701 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 2.795e-42
Identity = 77/166 (46.39%), Postives = 110/166 (66.27%), Query Frame = 2
Query:   86 ADKVNANIKELAWMLGKW-VGKNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYERQA 574
            A ++N  +K L+W+LG W   + G+G +PTIKPF+Y E L  + +GQP  NF +N+   +AE+   +HRECGF+R+ P  + ++ IIAQNSG+V IEEG++T E  L   S+ LGRIS+AKEP V ++ RV  L  D KL Q + M+T     LT+HL+I Y R +
Sbjct:    9 AVELNPILKPLSWLLGTWESDEPGEGTFPTIKPFRYTEKLHFSHVGQPVINFTFNAF--HAESNKPLHRECGFIRIQPGTNKVAFIIAQNSGLVEIEEGELT-ENQLKLQSQSLGRISFAKEPHVQQIGRVLQLRPDGKLEQTVSMATNNQP-LTQHLSITYSRSS 170          
BLAST of THAP domain containing 4 vs. TrEMBL
Match: A0A3P8SE00 (THAP domain containing 4 OS=Amphiprion percula OX=161767 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.030e-41
Identity = 73/162 (45.06%), Postives = 108/162 (66.67%), Query Frame = 2
Query:   92 KVNANIKELAWMLGKW-VGKNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            ++N  +  L W+LG W   + G+G +PTIKPF+Y ETL  + +GQP  NF +N+   +AE+   +HRECGF+R+ P  + ++ IIAQNSG+V IEEG++T ++ L   S+ L R+S+A+EP V ++ RVF L  D KL Q + M+T     L +HL+IVY R
Sbjct:   10 ELNPGLLPLDWLLGTWECDEPGEGCFPTIKPFRYTETLHFSHVGQPVINFMFNAF--HAESKKPLHRECGFIRMQPGTNRVAFIIAQNSGLVEIEEGELTGQQ-LNLQSQSLARVSFAREPHVQQICRVFQLRPDGKLEQTVSMATDNQP-LVQHLHIVYRR 167          
BLAST of THAP domain containing 4 vs. TrEMBL
Match: A0A3Q1B370 (THAP domain containing 4 OS=Amphiprion ocellaris OX=80972 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.030e-41
Identity = 73/162 (45.06%), Postives = 108/162 (66.67%), Query Frame = 2
Query:   92 KVNANIKELAWMLGKW-VGKNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            ++N  +  L W+LG W   + G+G +PTIKPF+Y ETL  + +GQP  NF +N+   +AE+   +HRECGF+R+ P  + ++ IIAQNSG+V IEEG++T ++ L   S+ L R+S+A+EP V ++ RVF L  D KL Q + M+T     L +HL+IVY R
Sbjct:   10 ELNPGLLPLDWLLGTWECDEPGEGCFPTIKPFRYTETLHFSHVGQPVINFMFNAF--HAESKKPLHRECGFIRMQPGTNRVAFIIAQNSGLVEIEEGELTGQQ-LNLQSQSLARVSFAREPHVQQICRVFQLRPDGKLEQTVSMATDNQP-LVQHLHIVYRR 167          
BLAST of THAP domain containing 4 vs. TrEMBL
Match: A0A087XVX4 (THAP domain containing 4 OS=Poecilia formosa OX=48698 PE=4 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 1.170e-41
Identity = 76/166 (45.78%), Postives = 110/166 (66.27%), Query Frame = 2
Query:   86 ADKVNANIKELAWMLGKW-VGKNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYERQA 574
            A ++N  +K L+W+LG W   + G+G +PTIKPF+Y E L  + +GQP  NF +N+   +AE+   +HRECGF+R+ P  + ++ IIAQNSG+V IEEG++T  + L   S+ LGRIS+AKEP V ++ RV  L  D KL Q + M+T     LT+HL+I Y R +
Sbjct:    9 AVELNPILKPLSWLLGTWESDEPGEGTFPTIKPFRYTEKLHFSHVGQPVINFTFNAF--HAESNKPLHRECGFIRIQPGTNKVAFIIAQNSGLVEIEEGELTGNQ-LKLQSQSLGRISFAKEPHVQQIGRVLQLRPDGKLEQTVSMATDNQP-LTQHLSITYSRSS 170          
BLAST of THAP domain containing 4 vs. Ensembl Cavefish
Match: thap4 (THAP domain containing 4 [Source:NCBI gene;Acc:103038959])

HSP 1 Score: 137.502 bits (345), Expect = 1.210e-40
Identity = 68/164 (41.46%), Postives = 105/164 (64.02%), Query Frame = 2
Query:   86 ADKVNANIKELAWMLGKW-VGKNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            A  +N  +  L W+LG W   + G+G +P+I PF+Y ETL  + +GQP  NF +N+   +AE+   +HRECGF+R+ P  + ++ IIAQNSG+V IEEG++  ++ +   S+ L R S+AKEP V ++ R+F L  D +L Q + M+  +   LT+HL+I Y R
Sbjct:    9 AVDLNVAVLPLEWLLGSWESDEPGEGSFPSIAPFRYTETLHFSHVGQPVINFMFNAF--HAESRKPLHRECGFIRIQPGTNNLAFIIAQNSGLVEIEEGELIGQQ-VILQSRALARTSFAKEPHVQQISRLFQLRPDGRLEQTVSMA-LENQPLTQHLHITYRR 168          
BLAST of THAP domain containing 4 vs. Ensembl Cavefish
Match: thap4 (THAP domain containing 4 [Source:NCBI gene;Acc:103038959])

HSP 1 Score: 134.806 bits (338), Expect = 1.154e-39
Identity = 66/158 (41.77%), Postives = 103/158 (65.19%), Query Frame = 2
Query:  104 NIKELAWMLGKW-VGKNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            ++  L W+LG W   + G+G +P+I PF+Y ETL  + +GQP  NF +N+   +AE+   +HRECGF+R+ P  + ++ IIAQNSG+V IEEG++  ++ +   S+ L R S+AKEP V ++ R+F L  D +L Q + M+  +   LT+HL+I Y R
Sbjct:    6 SVLPLEWLLGSWESDEPGEGSFPSIAPFRYTETLHFSHVGQPVINFMFNAF--HAESRKPLHRECGFIRIQPGTNNLAFIIAQNSGLVEIEEGELIGQQ-VILQSRALARTSFAKEPHVQQISRLFQLRPDGRLEQTVSMA-LENQPLTQHLHITYRR 159          
BLAST of THAP domain containing 4 vs. Ensembl Nematostella
Match: EDO40635 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6K2])

HSP 1 Score: 115.546 bits (288), Expect = 1.880e-32
Identity = 57/154 (37.01%), Postives = 94/154 (61.04%), Query Frame = 2
Query:  107 IKELAWMLGKWVGKNGKGVYPTIKPFKYNETLEITEMGQPNFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYER 568
            +  ++W++G+W G+ G+G YPTI+PF Y ET+E    GQPN  ++S + N++    MH E GF+R+ P  + ++L++AQN G VT         + L   ++ +GR+S+ K P V K +RV+ L+D+  L  + +M  T+T   T+HL   Y+R
Sbjct:   15 LAPVSWLVGRWEGE-GRGEYPTIQPFTYRETVEFNNFGQPNLAFSSKSWNSKTNAPMHFESGFLRIMPSTTKVALMLAQNIG-VTELLEGEVEGEVLHLTAQAIGRMSFGKPPAVLKTERVYMLVDENTLEFKQFME-TETTPRTQHLQATYKR 165          
BLAST of THAP domain containing 4 vs. Ensembl Medaka
Match: thap4 (THAP domain containing 4 [Source:NCBI gene;Acc:101157568])

HSP 1 Score: 145.591 bits (366), Expect = 8.755e-44
Identity = 76/192 (39.58%), Postives = 113/192 (58.85%), Query Frame = 2
Query:    8 MECLFNPNMC*FFKQNLYLLRIEFMIADKVNANIKELAWMLGKW-VGKNGKGVYPTIKPFKYNETLEITEMGQP--NFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYERQA 574
            M C F PN                  + ++N  ++ L W+LG W   + G+G + +IKPF+Y E L  + +GQP  NF +N+   NAE+   +HRECGF+R+ P  + ++ IIAQNSG+V IEEG++T ++ L   SK + RIS+AKEP V ++ RVF L  D +L Q + M+T     L +HL+I Y R +
Sbjct:    1 MACPFEPNA-----------------SAELNPAVRSLEWLLGSWESDEPGEGTFSSIKPFRYTEKLHFSHVGQPVINFMFNAF--NAESNKPLHRECGFIRMQPGTNKVAFIIAQNSGLVEIEEGELTGQQ-LNLQSKSVARISFAKEPHVLQICRVFKLQSDGRLEQTVSMATDNQP-LAQHLHITYRRSS 171          
BLAST of THAP domain containing 4 vs. Planmine SMEST
Match: SMESG000061518.1 (SMESG000061518.1)

HSP 1 Score: 342.813 bits (878), Expect = 9.402e-122
Identity = 164/165 (99.39%), Postives = 165/165 (100.00%), Query Frame = 2
Query:   80 MIADKVNANIKELAWMLGKWVGKNGKGVYPTIKPFKYNETLEITEMGQPNFHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYERQA 574
            MIADKVNANIKELAWMLGKWVGKNGKGVYPTIKPFKYNETLEITEMGQPNFHYNSVTHNAENGN+MHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYERQA
Sbjct:    1 MIADKVNANIKELAWMLGKWVGKNGKGVYPTIKPFKYNETLEITEMGQPNFHYNSVTHNAENGNVMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKITNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKTAELTEHLNIVYERQA 165          
The following BLAST results are available for this feature:
BLAST of THAP domain containing 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
THAP45.449e-3640.36THAP domain containing 4 [Source:HGNC Symbol;Acc:H... [more]
THAP46.679e-3340.74THAP domain containing 4 [Source:HGNC Symbol;Acc:H... [more]
THAP42.275e-3035.23THAP domain containing 4 [Source:HGNC Symbol;Acc:H... [more]
THAP42.865e-1745.57THAP domain containing 4 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of THAP domain containing 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C28H8.55.353e-2031.58pep chromosome:WBcel235:III:5884330:5885848:1 gene... [more]
C28H8.55.353e-2031.58pep chromosome:WBcel235:III:5884451:5885848:1 gene... [more]
C28H8.51.408e-1931.58pep chromosome:WBcel235:III:5884307:5885848:1 gene... [more]
C15F1.11.334e-1828.48pep chromosome:WBcel235:II:6989880:6991797:1 gene:... [more]
T28H10.28.056e-1727.88pep chromosome:WBcel235:V:12510645:12512201:-1 gen... [more]
back to top
BLAST of THAP domain containing 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of THAP domain containing 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
thap41.046e-4040.94THAP domain containing 4 [Source:ZFIN;Acc:ZDB-GENE... [more]
thap41.046e-4040.94THAP domain containing 4 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of THAP domain containing 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
thap48.521e-3541.92THAP domain containing 4 [Source:NCBI gene;Acc:780... [more]
back to top
BLAST of THAP domain containing 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Thap41.865e-4243.37THAP domain containing 4 [Source:MGI Symbol;Acc:MG... [more]
Thap44.928e-3943.83THAP domain containing 4 [Source:MGI Symbol;Acc:MG... [more]
Thap48.269e-3344.53THAP domain containing 4 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of THAP domain containing 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P3Z3|THAP4_MOUSE3.447e-3843.83THAP domain-containing protein 4 OS=Mus musculus O... [more]
sp|Q2TBI2|THAP4_BOVIN1.081e-3641.36THAP domain-containing protein 4 OS=Bos taurus OX=... [more]
sp|Q8WY91|THAP4_HUMAN3.207e-3240.74THAP domain-containing protein 4 OS=Homo sapiens O... [more]
sp|Q642B6|THAP4_RAT6.072e-3241.36THAP domain-containing protein 4 OS=Rattus norvegi... [more]
sp|A1T297|Y449_MYCVP2.605e-2236.69UPF0678 fatty acid-binding protein-like protein Mv... [more]
back to top
BLAST of THAP domain containing 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W5MHD41.570e-4246.54THAP domain containing 4 OS=Lepisosteus oculatus O... [more]
A0A3B3YJA12.795e-4246.39THAP domain containing 4 OS=Poecilia mexicana OX=4... [more]
A0A3P8SE001.030e-4145.06THAP domain containing 4 OS=Amphiprion percula OX=... [more]
A0A3Q1B3701.030e-4145.06THAP domain containing 4 OS=Amphiprion ocellaris O... [more]
A0A087XVX41.170e-4145.78THAP domain containing 4 OS=Poecilia formosa OX=48... [more]
back to top
BLAST of THAP domain containing 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
thap41.210e-4041.46THAP domain containing 4 [Source:NCBI gene;Acc:103... [more]
thap41.154e-3941.77THAP domain containing 4 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of THAP domain containing 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of THAP domain containing 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of THAP domain containing 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO406351.880e-3237.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of THAP domain containing 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
thap48.755e-4439.58THAP domain containing 4 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of THAP domain containing 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000061518.19.402e-12299.39SMESG000061518.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025250 ID=SMED30025250|Name=THAP domain containing 4|organism=Schmidtea mediterranea sexual|type=transcript|length=684bp
ATTGTTTATGGAATGCCTGTTTAATCCAAATATGTGTTAATTTTTTAAAC
AAAATTTATATTTACTAAGAATTGAATTTATGATTGCAGATAAAGTTAAT
GCAAATATTAAAGAACTTGCTTGGATGTTAGGCAAGTGGGTTGGTAAAAA
CGGAAAAGGAGTATATCCAACTATTAAACCATTTAAGTATAATGAAACAC
TTGAAATTACCGAAATGGGTCAACCAAATTTCCATTACAACTCAGTTACT
CACAATGCTGAAAATGGTAACTTAATGCATAGAGAATGTGGCTTCGTCCG
TTTGAGTCCCGATAAATCAACCATATCATTGATAATTGCTCAGAACTCTG
GAATCGTTACAATTGAAGAAGGGAAAATTACGAATGAAAAAAGCTTAACA
TTTCTATCCAAGGATTTAGGAAGAATATCGTATGCCAAAGAGCCGTTTGT
GACAAAGGTCAAACGGGTTTTCACTTTGATTGACGATAAAAAATTATCCC
AACAAATGTGGATGTCGACAACGAAGACTGCAGAATTGACCGAACATTTA
AACATAGTATATGAACGACAAGCCTGAAGACAGCCCATTCCGATTTTGAA
TAATGAGCTTCTGAATTATTAATTTATATTATCTTGAACATTATTTAAAA
TGCTTTTAATTTAATTTATTAATTTAAATTGTTT
back to top

protein sequence of SMED30025250-orf-1

>SMED30025250-orf-1 ID=SMED30025250-orf-1|Name=SMED30025250-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=166bp
MIADKVNANIKELAWMLGKWVGKNGKGVYPTIKPFKYNETLEITEMGQPN
FHYNSVTHNAENGNLMHRECGFVRLSPDKSTISLIIAQNSGIVTIEEGKI
TNEKSLTFLSKDLGRISYAKEPFVTKVKRVFTLIDDKKLSQQMWMSTTKT
AELTEHLNIVYERQA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR012674Calycin
IPR014878DUF1794
IPR011038Calycin-like
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014878Domain of unknown function DUF1794PFAMPF08768DUF1794coord: 10..163
e-value: 4.2E-37
score: 127.4
IPR014878Domain of unknown function DUF1794CDDcd07828nitrobindincoord: 13..163
e-value: 3.77229E-54
score: 166.241
IPR012674CalycinGENE3DG3DSA:2.40.128.20coord: 3..164
e-value: 1.6E-53
score: 182.9
IPR012674CalycinSUPERFAMILYSSF50814Lipocalinscoord: 6..164
NoneNo IPR availablePANTHERPTHR15854THAP4 PROTEINcoord: 4..163
NoneNo IPR availablePANTHERPTHR15854:SF4THAP DOMAIN-CONTAINING PROTEIN 4coord: 4..163