G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30025247
Length (bp)1432
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30025247) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30025247) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30025247) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30025247) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025247

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30025247h1SMcG0021482 SmedASXL_019377SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30025247h1SMcG0021482 SmedASXL_000927SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30025247h1SMcG0021482 dd_Smed_v4_24483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025247h1SMcG0021482 dd_Smed_v4_24483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30025247h1SMcG0021482 dd_Smed_v4_24483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30025247h1SMcG0021482 dd_Smed_v6_24483_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30025247h1SMcG0021482 OX_Smed_1.0.12686ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A3S4ZYD9 (Uncharacterized protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS767 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.039e-21
Identity = 86/301 (28.57%), Postives = 122/301 (40.53%), Query Frame = 3
Query:   69 PAMIINITNISQCEIWSENHRQMYNRFYIIDISSQILCGINIITNLAAYLIFYQDRSVSTFN-------------RLLMNLSLCECFFQVCYILYSLVENSL------------------LLQSRLVFSSYNK-----AAAFSVGYLFIIVPGVTASHISRNWAVILISLYRFESLVRAFSTKWLIFRKGRDIKICIFVFLFSVLISLPRSIERNAFICVTE------------------------------------------ETYTVTIVGFGYRAILLESYKYIYVVTTLFLFQNGGP 737
            P  ++ + N ++ +  S     M   F +      +L  +NIITNL AY +F +    S                RLL  LSL E FFQ C+++ + +E                     LL +    SSYN      A  + V +L I +P   ASHI RNW V+LIS+YRFE+++    T+       R    C+ +   ++L SLPR +ERN  IC                                             E +   I+GFG R +   SY Y YV+TTLF+ Q GGP
Sbjct:  103 PPPLLGLDNQTKVDAVSP----MMRLFQLTTTVLYVLNILNIITNLFAYAVFRRQIQTSASQTSGGVMVSQHVLFRLLQALSLAEVFFQFCFLVSTYLEEQPYKGNLAFYSRTPRTLSLHLLHNSSASSSYNDTEFPFAKVYCVLFLQIFIPLFAASHIYRNWLVVLISIYRFEAVMWPVLTRKRFVSPNRVTSFCVGIAACAILASLPRMVERNCLICPIRIPCIFPDNNSLTLPPKRSLSGFPVLKTIGQIDKTSQAGLPQMEVHGNVIIGFGKRGLGWRSYNYAYVITTLFVLQTGGP 399          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3TYW4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS13037 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.479e-12
Identity = 81/280 (28.93%), Postives = 140/280 (50.00%), Query Frame = 3
Query:  315 SLVENSLLLQSRLVFSSYNKAAAFSVGYLFIIVPGVTASHISRNWAVILISLYRFESLVRAFSTKWLIFRKGRDIKICIFVFLFSVLISLPRSIERNAFICVTEETYTVTIVGFGYRAILLES--YKYIYVVTTLFLFQNGGPAXXXXXXXXXXXXKLADRKKIKEKLTGKDTKNLMLSGDEKISEKRTFSFFNRNPKNHQRNPSRKHQNSTRGGKXXXXXXXXXXXXXXPSFFNKLFGIFSIFSDYIFTDYLVISSNFATLLDSFVNFFIYLLSNQRFR 1148
            +L +   + +++LV S        S G+LF       A  ++RNW+V+L++ YR++++ R   T    F + R   I     + S L +LPR  E  +FICV       T++ +    +L ++  Y+ +Y+    F+ Q+GGP + VC +   +I K+A R+K + +   K T  ++ SG+E  S           P+   +   RK  +   G KL++ L  +F V E P+FF+K+   ++  +      Y+ + +NF   LDS VN F+Y+ SN  FR
Sbjct:  109 TLTDKERMTRTKLVASMTVSHQILS-GFLF-------AFQVARNWSVVLLAAYRYDAICRKLGTVS-SFPRERIPWIMTATMVLSGLFALPRLFEIKSFICVP------TVIIYNEEPLLAKNLMYQLLYLGIGTFIVQSGGPVLCVCILSFFVIRKIALRRKFRRQ--NKRTVFILSSGNEDNS--------CVEPQTATKTVERKLPS---GDKLMLALCFMFFVLETPAFFSKILSSYTSTNYPTLDVYMSVIANFLIYLDSTVNVFVYMGSNPTFR 360          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183P9C9 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS10965 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 5.846e-12
Identity = 72/256 (28.12%), Postives = 124/256 (48.44%), Query Frame = 3
Query:  420 VTASHISRNWAVILISLYRFESLVRAFSTKWLIFRKGRDIKICIFVFLFSVLISLPRSIERNAFICVTEETYTVTIVGFGYRAIL-LESYKYIYVVTTLFLFQNGGPAXXXXXXXXXXXXKLADRKKIKEKLTGKDTKNLMLSGDEKISEKRT----------FSFFNRNPKNHQRNPSRKHQNSTRGGKXXXXXXXXXXXXXXPSFFNKLFGIFSIFSDYIFTDY-LVISSNFATLLDSFVNFFIYLLSNQRFRQ 1151
            + A  ISRNW+V+L++ YR++ + R   T    F + R   I I +F  + LI +PR  E    +C     Y    V   Y  ++  + Y+ +Y+   +F+ Q+GGP I VC + + +I  +A R+K   +   +  +NL+     +I   ++           +F  RN     +  + +   S  G KL+  + + F + E P+FF+K+   + +  DY   D  L + +N    LDS +N FIY+ SN  FR+
Sbjct:  163 LVAFQISRNWSVVLLAAYRYDQICRPIGTSS-AFPRERIRYILIIIFFLACLIVIPRIFESGIVVC-----YISGNVSKDYPLLINYKLYQILYLGLVMFIVQSGGPVICVCVLSAFVIRIIAKRRKFHREKEQRSARNLLRRQTMEIENNQSNLKNNTNNNNTNFLQRNSNGLTKELTERPAPS--GDKLMFAVCITFFILETPAFFSKILNPY-LEQDYPLIDLTLSVIANLLIYLDSTLNAFIYMASNPLFRK 409          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A095AUU7 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma haematobium OX=6185 GN=MS3_06666 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 4.840e-11
Identity = 71/256 (27.73%), Postives = 123/256 (48.05%), Query Frame = 3
Query:  420 VTASHISRNWAVILISLYRFESLVRAFSTKWLIFRKGRDIKICIFVFLFSVLISLPRSIERNAFICVTEETYTVTIVGFGYRAIL-LESYKYIYVVTTLFLFQNGGPAXXXXXXXXXXXXKLADRKKIKEKLTGKDTKNLMLSGDEKISEKRT----------FSFFNRNPKNHQRNPSRKHQNSTRGGKXXXXXXXXXXXXXXPSFFNKLFGIFSIFSDYIFTDY-LVISSNFATLLDSFVNFFIYLLSNQRFRQ 1151
            + A  ISRNW+V+L++ YR++ + R   T    F + R   I I +F  + LI +PR  E    +C     Y    V   Y  ++  + Y+ +Y+   +F+ Q+GGP I VC + + +I  +A R+K   +   +  +NL+     +I   ++           +   RN     +  + +   S  G KL+  + + F + E P+FF+K+   + +  DY   D  L + +N    LDS +N FIY+ SN  FR+
Sbjct:  163 LVAFQISRNWSVVLLAAYRYDQICRPIGTSS-AFSRERIRYILIIIFFLACLIVIPRIFESGIVVC-----YISGNVSKDYPLLINYKLYQILYLGLVMFIVQSGGPVICVCVLSAFVIRIIAKRRKFHREKEQRSARNLLRRQTMEIENNQSNLKNNIIIDNNNLLQRNSNGLTKELTERPAPS--GDKLMFAVCITFFILETPAFFSKILNPY-LEQDYPLIDLTLSVIANLLIYLDSTLNAFIYMASNPLFRK 409          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A430QF00 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0004667 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 7.608e-11
Identity = 71/260 (27.31%), Postives = 123/260 (47.31%), Query Frame = 3
Query:  420 VTASHISRNWAVILISLYRFESLVRAFSTKWLIFRKGRDIKICIFVFLFSVLISLPRSIERNAFICVTEETYTVTIVGFGYRAIL-LESYKYIYVVTTLFLFQNGGPAXXXXXXXXXXXXKLADRKKIKEKLTGKDTKNLMLSGDEKISEKRT--------------FSFFNRNPKNHQRNPSRKHQNSTRGGKXXXXXXXXXXXXXXPSFFNKLFGIFSIFSDYIFTDY-LVISSNFATLLDSFVNFFIYLLSNQRFRQ 1151
            + A  ISRNW+V+L++ YR++ + R   T    F + R   I I +F  + LI +PR  E    +C     Y    V   Y  ++  + Y+ +Y+   +F+ Q+GGP I VC + + +I  +A R+K   +   +  +NL+     +I   ++               +   RN     +  + +   S  G KL+  + + F + E P+FF+K+   + +  DY   D  L + +N    LDS +N FIY+ SN  FR+
Sbjct:  163 LVAFQISRNWSVVLLAAYRYDQICRPIGTSS-AFPRERIRYILIIIFFLACLIVIPRIFESGIVVC-----YISGNVSKDYPLLINYKLYQILYLGLVMFIVQSGGPVICVCVLSAFVIRIIAKRRKFHREKEQRSARNLLRRQTMEIENNQSNLKNNIITDNNNNNTNLLQRNSNGLTKELTERPAPS--GDKLMFAVCITFFILETPAFFSKILNPY-LEQDYPLIDLTLSVIANLLIYLDSTLNAFIYMASNPLFRK 413          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000078431.1 (SMESG000078431.1)

HSP 1 Score: 723.776 bits (1867), Expect = 0.000e+0
Identity = 400/400 (100.00%), Postives = 400/400 (100.00%), Query Frame = 3
Query:   69 PAMIINITNISQCEIWSENHRQMYNRFYIIDISSQILCGINIITNLAAYLIFYQDRSVSTFNRLLMNLSLCECFFQVCYILYSLVENSLLLQSRLVFSSYNKAAAFSVGYLFIIVPGVTASHISRNWAVILISLYRFESLVRAFSTKWLIFRKGRDIKICIFVFLFSVLISLPRSIERNAFICVTEETYTVTIVGFGYRAILLESYKYIYVVTTLFLFQNGGPAXXXXXXXXXXXXKLADRKKIKEKLTGKDTKNLMLSGDEKISEKRTFSFFNRNPKNHQRNPSRKHQNSTRGGKXXXXXXXXXXXXXXPSFFNKLFGIFSIFSDYIFTDYLVISSNFATLLDSFVNFFIYLLSNQRFRQHXXXXXXXXXXXXXFPTINRRRYSNEMSIVSPQRMTTFE 1268
            PAMIINITNISQCEIWSENHRQMYNRFYIIDISSQILCGINIITNLAAYLIFYQDRSVSTFNRLLMNLSLCECFFQVCYILYSLVENSLLLQSRLVFSSYNKAAAFSVGYLFIIVPGVTASHISRNWAVILISLYRFESLVRAFSTKWLIFRKGRDIKICIFVFLFSVLISLPRSIERNAFICVTEETYTVTIVGFGYRAILLESYKYIYVVTTLFLFQNGGPAIIVCSIGSLIIIKLADRKKIKEKLTGKDTKNLMLSGDEKISEKRTFSFFNRNPKNHQRNPSRKHQNSTRGGKLVIILSVLFVVFELPSFFNKLFGIFSIFSDYIFTDYLVISSNFATLLDSFVNFFIYLLSNQRFRQHLLIKLNNVLIKLNFPTINRRRYSNEMSIVSPQRMTTFE
Sbjct:    8 PAMIINITNISQCEIWSENHRQMYNRFYIIDISSQILCGINIITNLAAYLIFYQDRSVSTFNRLLMNLSLCECFFQVCYILYSLVENSLLLQSRLVFSSYNKAAAFSVGYLFIIVPGVTASHISRNWAVILISLYRFESLVRAFSTKWLIFRKGRDIKICIFVFLFSVLISLPRSIERNAFICVTEETYTVTIVGFGYRAILLESYKYIYVVTTLFLFQNGGPAIIVCSIGSLIIIKLADRKKIKEKLTGKDTKNLMLSGDEKISEKRTFSFFNRNPKNHQRNPSRKHQNSTRGGKLVIILSVLFVVFELPSFFNKLFGIFSIFSDYIFTDYLVISSNFATLLDSFVNFFIYLLSNQRFRQHLLIKLNNVLIKLNFPTINRRRYSNEMSIVSPQRMTTFE 407          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000081473.1 (SMESG000081473.1)

HSP 1 Score: 220.32 bits (560), Expect = 2.471e-66
Identity = 156/423 (36.88%), Postives = 239/423 (56.50%), Query Frame = 3
Query:   81 INITNISQCEIWSENHRQMYNRFYIIDISSQILCGINIITNLAAYLIFYQDRSVSTFNRLLMNLSLCECFFQVCYILYSLVENSLLLQSRLVFSSYNKAAAFSVGYLFIIVPGVTASHISRNWAVILISLYRFESLVRAFSTKWLIFRKGRDIKICIFVFLFSVLISLPRSIERNAFICVTEETYTVT-----IVGFGYRAILLES-YKYIYVVTTLFLFQNGGPAXXXXXXXXXXXXKLADRKKIKEKL-----------------------------------TGKDTKNLMLSGDE-KISEKRTFSFFNRN-PK------------------NHQRNPSRKHQNS---TRGGKXXXXXXXXXXXXXXPSFFNK-LFGIFSIFSDY--IFTDYLVISSNFATLLDSFVNFFIYLLSNQRFR 1148
            IN  N + CE+W   H  M+ +++ I ++S IL  +N+ TN+ A++IF++D + +  N LLM LSLCE FFQ+ Y +   ++  LLL S L+F S+N+  +F  GYL+II+P  TASHI+RNW V++IS YRFE L+R FS KW++F+K R   IC  +   +++IS+PR++ERN   C  ++    +     ++GFG  +   +S Y Y Y + TLFLFQNGGP  +VC +  ++++KL +RKK++E+L                                     + T N   S DE ++ EK  FS    + P+                   +Q+   RK+QNS     GG+L+I+L +LF + E+P F +K ++G+   F     + T+ L I +NFAT +DSF N FIYLLSN++FR
Sbjct:    6 INNVNSTVCEVWIVKHGLMHQKYWPITLASMILSFVNMSTNMIAFVIFFRDSTDTILNNLLMALSLCEVFFQLFYFVQLYIDLHLLLSSSLIFPSFNRVLSFVGGYLWIIIPLFTASHIARNWMVVMISFYRFEVLIRTFSKKWILFQKERIAAICWIIVFLAIIISVPRTVERNMIYCKMDDLSNNSQTKYILIGFGQWSYPYKSYYTYGYSIVTLFLFQNGGPTFLVCFVSVMVLLKLQERKKVRERLRNFTVNEQSVKNSNKKKSNLWSWKEIRLPNFNNNSKNRQTNNERSSIDETQVFEKCPFSSNKSDTPQLLEITEETACTSPPIQFVKNQKQSKRKYQNSNSKNSGGRLIIMLCLLFCICEMPLFISKFIYGVNVFFQKKMNLTTEILGIIANFATSIDSFANIFIYLLSNRQFR 428          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000010665.1 (SMESG000010665.1)

HSP 1 Score: 202.216 bits (513), Expect = 1.153e-59
Identity = 156/414 (37.68%), Postives = 224/414 (54.11%), Query Frame = 3
Query:   69 PAMIINITNISQCEIWSENHRQMYNRFYIIDISSQILCGINIITNLAAYLIFYQDRSVSTFNRLLMNLSLCECFFQVCYILYSLVENSLLLQSRLVFSSYNKAAAFSVGYLFIIVPGVTASHISRNWAVILISLYRFESLVRAFSTKWLIFRKGRDIKICIFVFLFSVLISLPRSIERNAFIC-VTEETYTVTIVGFGYRAILLESYKYIYVVTTLFLFQNGGPAXXXXXXXXXXXXKLADRKKIKEKLTGKDTKNL---------MLSGDEKISEK-----RTFSFFNRNPK----------------NHQRNP-----------SRKHQNSTR---------GGKXXXXXXXXXXXXXXPSFFNKLF-GIFSIFSDYIFTDYLVIS--SNFATLLDSFVNFFIYLLSNQRFR 1148
            P  +I I+N   C  W   H +M+ +++ I ++S ++C INIITN  A++IFYQD   +  N+LL+ LS  E   Q+ YI++ ++E   +L   +V ++ N    F V YL +I+P +T+ HI RNW ++LISLYRFE LVRAFST  L+FRK +   I   V + S +IS PR +ERN F C V    Y   IV  G RA+ +  Y+Y Y + TLF+FQNGGP IIVC + S++I +L  R KI  +L   + K+L         + +   K+S K       F     +P+                N  ++P           ++  Q STR         G +LV+IL + FVV E P F +KL   +  I    +     +IS  +NFAT++DSF NFFIYLLSN+ FR
Sbjct:    8 PEFLIFISN-KTCSKWLSIHEEMHLKYWSIFVASLVICTINIITNSIAFIIFYQDTMKNVLNKLLIALSASEVMLQILYIIHVVIEKHFVLLGEIVSTNVNGLLPFGVVYLCVIIPLLTSFHIMRNWLIVLISLYRFEKLVRAFSTHCLMFRKNQISLIIGVVVILSAIISFPRIVERNVFYCQVNYSKY--LIVALGTRALTISWYRYAYSIITLFIFQNGGPIIIVCVVSSMLINELRYRHKIHCRLKQSNHKDLSSTFSNSNCIENKASKVSPKSNKQHEQFLMIPNSPRTSRLSYSAFQDEAECENFIKSPRFSIKSIGNNFTKTRQKSTRRSSYNSSVDGSRLVMILCITFVVCETPIFLSKLLHALQKIMPSKLKYSLELISEIANFATIIDSFFNFFIYLLSNKSFR 418          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000063294.1 (SMESG000063294.1)

HSP 1 Score: 76.2554 bits (186), Expect = 8.640e-15
Identity = 98/357 (27.45%), Postives = 168/357 (47.06%), Query Frame = 3
Query:   96 ISQCEIWSENHRQMYNRFYIIDISSQILCGINIITNLAAYLIFYQD-RSVSTFNRLLMNLSLCECFFQVCYILYSLVENSLLLQS----RLVFSSYNKAAAFSVGYLFIIVPGVTASHISRNWAVILISLYRFESLVRAFSTKWLIFRKGRDIKICIFVFLFSVLISLPRSIERNAFICVTEETYTVTIVGFGYRAILLESYKYIYVVTTLFLFQNGGPAXXXXXXXXXXXXKLADRKKIKEKLTGKDTKNLMLSGDEKISEKRTFSFFNRNPKNHQRNPSRKHQNSTRGGKXXXXXXXXXXXXXXPSFFNKLFGIFSIFSDYIFTD-YLVISSNFATLLDSFVNFFIYLLSNQRFR 1148
            +++C   S+N  +    +  I +   IL  ++I++N  A+++F +     S  +++L  LSL E  F V  +L + + + +  Q      LV   Y   AA  +  +F+I         +RNW V++++ YR+E++ R   +   I     ++  C F+F  S+LI+LPR +E    IC      T+++  F    I  + Y Y++    LFL QNGGP I+VC + S ++  +   KKI++                        S FN   K     PS        G +L++ILS  F V E P+FF+K+   +  +  Y   D ++ + +N    LDS +N  +Y++SN  FR
Sbjct:   17 VTKCNFSSQNSIETDTIYKYITL---ILTPLSILSNTFAFVVFKESIWKKSVMSKILRMLSLFEILFNVNVLLEASIRHKIEEQHPSMVELVIFIYVITAAKVLMIVFLI---------ARNWTVVILAGYRYEAVCRPVGSCKYIRYNNINLAFC-FIFALSILIALPRMMETKIEICQP----TLSVNRFVPFLISYKWYLYLHTGILLFLIQNGGPVILVCFLSSCVLKVIRKMKKIRK------------------------SNFNLADKKGSPQPS--------GDRLIVILSAAFFVLETPAFFSKILHHYFEYQGYYNLDIHIGLLANTLIYLDSIINVAVYVISNPTFR 324          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000076138.1 (SMESG000076138.1)

HSP 1 Score: 73.1738 bits (178), Expect = 7.793e-14
Identity = 90/337 (26.71%), Postives = 158/337 (46.88%), Query Frame = 3
Query:  174 ILCGINIITNLAAYLIFYQDRSVSTFNR-LLMNLSLCECFFQVCYILYSLVENSLLLQSRL-VFSSYNKAAAFSVGYLFIIVPGVTAS-HISRNWAVILISLYRFESLVRAFSTKWL-----IFRKGRDIKICIFVFLFSVLISLPRSIERNAFICVTEETYTVTIVGFGYRAILLESYKYIYVVTTLFLFQNGGPAXXXXXXXXXXXXKLADRKKIKEKLTGKDTKNLMLSGDEKISEKRTFSFFNRNPKNHQRNPSRKHQNSTRGGKXXXXXXXXXXXXXXPSFFNKLFGIFSIFSDYIFTD---YLVISSNFATLLDSFVNFFIYLLSNQRFRQ 1151
            +L   NI+ N+ A +I     S S +N+ +L  +     +F++ + L + + N   L   L  F  +   A  +V  L +I   +     ++RNW+V +++L+R++ + R+ + + L      F      KI  F+ +F + ++LPR  E    IC+     T  I  +     + + ++Y Y+   +F+FQ+GGP II   +  ++I K+ +R  I+++ T   +                   F R+    QRNP          G LV+ + + F+V E PSFF+KL       + Y F +   ++ I  N    LDS +N FIYL SN+ FR+
Sbjct:   44 VLVVTNILGNMFAVIIL----SDSVWNKSVLTTILKAISYFEILFNLLNFINNICQLTEPLKPFQYFGLKALATVEILLLICDSLMIGFQMARNWSVTILALFRYDMVCRSKTVRRLNNQSNFFSNENLPKIFTFLMIFCIGLALPRMFEVTPQICIN----TAVICHYADFLSVRKVFQYGYLGVVMFIFQSGGPIIITSCVSLMLIRKIQNRHAIRKRQTNATSNR-----------------FQRS----QRNP----------GTLVMAVCITFMVLEFPSFFSKL-------AFYAFDNNNIHIGIIPNLLIYLDSCLNLFIYLASNKTFRK 334          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S4ZYD92.039e-2128.57Uncharacterized protein (Fragment) OS=Protopolysto... [more]
A0A0R3TYW41.479e-1228.93G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183P9C95.846e-1228.13G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A095AUU74.840e-1127.73G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A430QF007.608e-1127.31G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078431.10.000e+0100.00SMESG000078431.1[more]
SMESG000081473.12.471e-6636.88SMESG000081473.1[more]
SMESG000010665.11.153e-5937.68SMESG000010665.1[more]
SMESG000063294.18.640e-1527.45SMESG000063294.1[more]
SMESG000076138.17.793e-1426.71SMESG000076138.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025247 ID=SMED30025247|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1432bp
CTCGAAATTAATATTTTTCTCCCAGATTTTCACTTCAATAATAAAACATG
CTTAGCAATTCTTCTTTGCCAGCAATGATAATTAATATAACTAATATTTC
TCAATGCGAAATATGGAGTGAAAACCATAGACAAATGTACAATCGGTTTT
ATATAATTGATATATCATCCCAGATTCTTTGTGGTATCAATATTATTACA
AATCTTGCCGCTTATTTGATATTTTACCAAGACCGTTCAGTCAGCACATT
TAATAGACTTCTGATGAATCTCTCTCTCTGTGAATGTTTTTTCCAGGTTT
GCTATATTTTATATTCTTTAGTTGAAAACTCTTTGCTTCTTCAAAGTAGA
CTTGTTTTTTCAAGTTACAATAAAGCTGCCGCATTTTCAGTTGGATATTT
ATTTATCATCGTTCCGGGCGTAACGGCAAGCCATATATCAAGAAATTGGG
CAGTCATTCTAATCAGTCTCTACAGATTCGAATCTTTAGTTCGTGCATTC
AGTACGAAATGGCTGATTTTTAGAAAAGGTAGAGATATCAAAATTTGTAT
ATTCGTGTTTCTTTTCTCCGTTTTAATTAGCCTCCCACGATCAATTGAAC
GGAACGCATTCATTTGCGTTACAGAGGAAACCTATACCGTAACAATTGTC
GGTTTCGGATATCGAGCAATACTTTTAGAAAGTTATAAATACATTTATGT
TGTAACCACGTTATTTTTATTTCAAAACGGAGGTCCCGCAATAATTGTCT
GTTCAATCGGATCGTTAATTATTATAAAATTAGCCGACCGAAAGAAAATT
AAAGAAAAACTCACAGGAAAAGATACGAAAAATCTTATGCTGTCAGGAGA
TGAAAAGATTTCTGAAAAGCGAACATTTTCATTTTTTAACAGAAACCCTA
AAAACCACCAACGAAACCCTTCACGAAAACATCAAAATTCAACTAGAGGC
GGCAAATTGGTGATCATATTGTCGGTTTTGTTTGTCGTTTTTGAATTGCC
GTCTTTTTTTAATAAACTATTTGGTATCTTTAGCATTTTCTCTGATTACA
TCTTTACTGACTATCTCGTGATTTCGAGCAATTTTGCGACTTTACTCGAC
AGTTTTGTCAACTTTTTCATTTATCTCCTTTCAAATCAAAGATTCAGGCA
ACACTTATTGATAAAACTCAACAATGTTTTGATAAAGTTGAATTTCCCAA
CAATAAATCGTCGAAGATATTCGAACGAAATGTCAATTGTTAGTCCACAG
AGAATGACAACATTTGAATAGGCCTATTTTAGCACTGTTATTATTGATTG
ATTGTTATTTTTAAAATCAATTGTTAAACAATAATCGTTGTTTATTTTCA
GTGCAAATCTATAAATGTGATTGTTAAATTAAACATTTTCTTTTCTCAAA
TTATTTAAAATTTCTTTCAATGACAGACAGAC
back to top

protein sequence of SMED30025247-orf-1

>SMED30025247-orf-1 ID=SMED30025247-orf-1|Name=SMED30025247-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=408bp
MLSNSSLPAMIINITNISQCEIWSENHRQMYNRFYIIDISSQILCGINII
TNLAAYLIFYQDRSVSTFNRLLMNLSLCECFFQVCYILYSLVENSLLLQS
RLVFSSYNKAAAFSVGYLFIIVPGVTASHISRNWAVILISLYRFESLVRA
FSTKWLIFRKGRDIKICIFVFLFSVLISLPRSIERNAFICVTEETYTVTI
VGFGYRAILLESYKYIYVVTTLFLFQNGGPAIIVCSIGSLIIIKLADRKK
IKEKLTGKDTKNLMLSGDEKISEKRTFSFFNRNPKNHQRNPSRKHQNSTR
GGKLVIILSVLFVVFELPSFFNKLFGIFSIFSDYIFTDYLVISSNFATLL
DSFVNFFIYLLSNQRFRQHLLIKLNNVLIKLNFPTINRRRYSNEMSIVSP
QRMTTFE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR24238G-PROTEIN COUPLED RECEPTORcoord: 43..372
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 35..368
e-value: 9.31209E-17
score: 78.0584
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 18..379
NoneNo IPR availableTMHMMTMhelixcoord: 304..321
NoneNo IPR availableTMHMMTMhelixcoord: 341..363
NoneNo IPR availableTMHMMTMhelixcoord: 110..132
NoneNo IPR availableTMHMMTMhelixcoord: 71..90
NoneNo IPR availableTMHMMTMhelixcoord: 221..243
NoneNo IPR availableTMHMMTMhelixcoord: 36..58
NoneNo IPR availableTMHMMTMhelixcoord: 166..183
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 51..359
score: 13.13