SMED30025246

Overview
NameSMED30025246
Smed IDSMED30025246
Length (bp)1175
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30025246 (SMED30025246) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30025246 (SMED30025246) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30025246 (SMED30025246) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30025246 (SMED30025246) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025246

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30025246SMESG000077669.1 SMESG000077668.1 dd_Smed_v4_7171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025246SMESG000077669.1 SMESG000077668.1 dd_Smed_v4_7171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025246SMESG000077669.1 SMESG000077668.1 dd_Smed_v6_7171_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30025246SMESG000077670.1 SMESG000077669.1 OX_Smed_1.0.11946ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30025246SMESG000077669.1 SMESG000077668.1 SMESG000077667.1 Contig49355newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025246SMESG000077669.1 SMESG000077668.1 SMESG000077667.1 Contig49355uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30025246 vs. TrEMBL
Match: A0A267DQ25 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031449g3 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 2.387e-21
Identity = 96/368 (26.09%), Postives = 176/368 (47.83%), Query Frame = 3
Query:   63 IDVEML--NEALQLPESLLPFINGNQLA-IDCGISSSKIVFSVQLEN-----HEQVFRSLGLLNEELKTVLLEIQETFGQKAFEKIFVVGF-KNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSEI-EIKNEESLSLYDKYKIDLKNPMFQKVIQAMRISTPNETKSGEGIIHFPSIIVLGGSALKFYLLNSDGSAKLIAYSMFAGETLKGLFKCLVDSNNFKENILLASIGDREKIDTQVYEVLSENLNSPYGQFPPDLPIFSFGKCADYNKGKEDVNPNDXXXXXXXXXXXXTNNQVNTLCKAFKTKYVYFCGDIFNYQL-------FSKILQLGEILLPRLIETKILNVNYILALGT 1115
            +D E L  +++L++  +LL  +  +  A ID G + +KI+++V + +     H   FR     N+  ++ L  ++      A  ++ V G   NL+   + K     +   ++E ++   G+  +  +  L  I     + S  ++D+ +   +   FQ++  A R++   E  SGE    FP +  + GS+    L+  DGS ++    + AG++  G  + LV + +++  + +A+ G R  IDTQV ++L+++ NSPYG+ P  +P F FGK  D+NK  ED  P D+ +SL   F+I   N V  L      + V+F G+ F ++        FSK+     ++         L   +  ALG 
Sbjct:    1 MDEEHLVQDDSLRVDAALLTKMRDSSFAAIDRGSTLTKILYTVDIGDGNYDLHFATFR-----NKHFESALNYLKAKLQLNADRRLHVTGVGSNLYGDRI-KETLGVNTVFIDEAASQFVGLYFLLRHLPLETICHPLPQCSDPIFDQIQ---RGETFQRLRDA-RVALIKEQASGE---KFPCLFAIFGSSAGVVLVREDGSIEVKHRHLLAGKSFLGACQLLVGTGDYQRVLDMAAAGKRGNIDTQVRDILADSPNSPYGKMPATMPFFPFGKAVDFNKSLEDCRPEDVAQSLVSSFIINFMNVVTFLACFEGIRNVFFGGNFFQHEFARQEVVKFSKLFGASSVM-----SFNFLKTGHTAALGA 350          
BLAST of SMED30025246 vs. TrEMBL
Match: A0A267GK06 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031449g2 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 8.519e-21
Identity = 95/368 (25.82%), Postives = 176/368 (47.83%), Query Frame = 3
Query:   63 IDVEML--NEALQLPESLLPFINGNQLA-IDCGISSSKIVFSVQLEN-----HEQVFRSLGLLNEELKTVLLEIQETFGQKAFEKIFVVGF-KNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSEI-EIKNEESLSLYDKYKIDLKNPMFQKVIQAMRISTPNETKSGEGIIHFPSIIVLGGSALKFYLLNSDGSAKLIAYSMFAGETLKGLFKCLVDSNNFKENILLASIGDREKIDTQVYEVLSENLNSPYGQFPPDLPIFSFGKCADYNKGKEDVNPNDXXXXXXXXXXXXTNNQVNTLCKAFKTKYVYFCGDIFNYQL-------FSKILQLGEILLPRLIETKILNVNYILALGT 1115
            +D E L  +++L++  +LL  +  +  A ID G + +KI+++V + +     H   FR     N+  ++ L  ++      A  ++ V G   NL+   + K     +   ++E ++   G+  +  +  L  I     + +  ++D+ +   +   FQ++  A R++   E  SGE    FP +  + GS+    L+  DGS ++    + AG++  G  + LV + +++  + +A+ G R  IDTQV ++L+++ NSPYG+ P  +P F FGK  D+NK  ED  P D+ +SL   F+I   N V  L      + V+F G+ F ++        FSK+     ++         L   +  ALG 
Sbjct:    1 MDEEHLVQDDSLRVDAALLTKMRDSSFAAIDRGSTLTKILYTVDIGDGNYDLHFATFR-----NKHFESALNYLKAKLQLNADRRLHVTGVGSNLYGDRI-KETLGVNTVFIDEAASQFVGLYFLLRHLPLETICHPLPQCNDPIFDQIQ---RGETFQRLRDA-RVALIKEQASGE---KFPCLFAIFGSSAGVVLVREDGSIEVKHRHLLAGKSFLGACQLLVGTGDYQRVLDMAAAGKRGNIDTQVRDILADSPNSPYGKMPATMPFFPFGKAVDFNKSLEDCRPEDVAQSLVSSFIINFMNVVTFLACFEGIRNVFFGGNFFQHEFARQEVVKFSKLFGASSVM-----SFNFLKTGHTAALGA 350          
BLAST of SMED30025246 vs. TrEMBL
Match: A0A1I8GE91 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031449g1 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.607e-20
Identity = 92/363 (25.34%), Postives = 172/363 (47.38%), Query Frame = 3
Query:   63 IDVEML--NEALQLPESLLPFINGNQLA-IDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQKAFEKIFVVGF-KNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSEI-EIKNEESLSLYDKYKIDLKNPMFQKVIQAMRISTPNETKSGEGIIHFPSIIVLGGSALKFYLLNSDGSAKLIAYSMFAGETLKGLFKCLVDSNNFKENILLASIGDREKIDTQVYEVLSENLNSPYGQFPPDLPIFSFGKCADYNKGKEDVNPNDXXXXXXXXXXXXTNNQVNTLCKAFKTKYVYFCGDIFNYQL-------FSKILQLGEILLPRLIETKILNVNYILALGT 1115
            +D E L  +++L++  +LL  +  +  A ID G + +KI+++V + +           N+  ++ L  ++      A  ++ V G   NL+   + K     +   ++E ++   G   +  +  L  I     + +  ++D+ +   +   FQ++  A R++   E  SGE    FP +  + GS+    L+  DGS ++    + AG++  G  + LV + +++  + +A+ G R  IDTQV ++L+++ NSPYG+ P  +P F FGK  D+NK  ED  P D+ +SL   F+I   N V  L      + V+F G+ F ++        FSK+     ++         L   +  ALG 
Sbjct:    1 MDEEHLVQDDSLRVDAALLTKMRDSSFAAIDRGSTLTKILYTVDIGDGNYDLHFATFRNKHFESALNYLKAKLQLNADRRLHVTGVGSNLYGDRI-KETLGVNTVFIDEAASQFVGFYFLLRHLPLETICHPLPQCNDPIFDQIQ---RGETFQRLRDA-RVALIKEQASGE---KFPCLFAIFGSSAGVVLVREDGSIEVKHRHLLAGKSFLGACQLLVGTGDYQRVLDMAAAGKRGNIDTQVRDILADSPNSPYGKMPATMPFFPFGKAVDFNKSLEDCRPEDVAQSLVSSFIINFMNVVTFLACFEGIRNVFFGGNFFQHEFARQEVVKFSKLFGASSVM-----SFNFLKTGHTAALGA 350          
BLAST of SMED30025246 vs. TrEMBL
Match: A0A1I8GKH7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.110e-18
Identity = 55/166 (33.13%), Postives = 93/166 (56.02%), Query Frame = 3
Query:  624 LNSDGSAKLIAYSMFAGETLKGLFKCLVDSNNFKENILLASIGDREKIDTQVYEVLSENLNSPYGQFPPDLPIFSFGKCADYNKGKEDVNPNDXXXXXXXXXXXXTNNQVNTLCKAFKTKYVYFCGDIFNYQLF-SKILQLGEILLPRLIETKILNVNYILALGTL 1118
            +  +G + ++    FAG +  GL K L+ ++++ E + LAS G R  +DT+V +V++ + NSPYGQFPP+LPIFSFGK  D +K   D++  DL  SL F F     +Q+  + +  K   +Y  G+ F ++L  S+I++   +     I    +   +  A+G +
Sbjct:    1 IEENGMSDMVGGVWFAGRSFLGLSKLLLGTDDYDEILELASKGKRNSVDTEVKDVIANDPNSPYGQFPPNLPIFSFGKVIDTDKKLSDLSREDLANSLVFSFAYNAFSQLALVAQTSKVSKLYMGGNFFRHELIRSEIVKTMRLFTGDAIAVNFVKTGHTGAIGAM 166          
BLAST of SMED30025246 vs. TrEMBL
Match: A0A1I8IVK5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 4.680e-18
Identity = 66/215 (30.70%), Postives = 108/215 (50.23%), Query Frame = 3
Query:  492 KNPMFQKVIQAMRISTPNETKSGEGIIHFPSIIVLGGSALKFYLLNSDGSAKLIAYSMFAGETLKGLFKCLVDSNNFKENILLASIGDREKIDTQVYEVLSENLNSPYGQFPPDLPIFSFGKCADYNKGKEDVNPNDXXXXXXXXXXXXTNNQVNTLCKAFKTKYVYFCGDIFNYQL-------FSKILQLGEILLPRLIETKILNVNYILALGT 1115
            +   FQ++  A R++   E  SGE    FP +  + GS+    L+  DGS ++    + AG++  G  + LV + +++  + +A+ G R  IDTQV ++L+++ NSPYG+ P  +P F FGK  D+NK  ED  P D+ +SL   F+I   N V  L      + V+F G+ F ++        FSK+     ++         L   +  ALG 
Sbjct:  170 RGETFQRLRDA-RVALIKEQASGE---KFPCLFAIFGSSAGVVLVREDGSIEVKHRHLLAGKSFLGACQLLVGTGDYQRVLDMAAAGKRGNIDTQVRDILADSPNSPYGKMPATMPFFPFGKAVDFNKSLEDCRPEDVAQSLVSSFIINFMNVVTFLACFEGIRNVFFGGNFFQHEFARQEVVKFSKLFGASSVM-----SFNFLKTGHTAALGA 375          
BLAST of SMED30025246 vs. Planmine SMEST
Match: SMESG000077669.1 (SMESG000077669.1)

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 345/350 (98.57%), Postives = 347/350 (99.14%), Query Frame = 3
Query:   75 MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQKAFEKIFVVGFKNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSEIEIKNEESLSLYDKYKIDLKNPMFQKVIQAMRISTPNETKSGEGIIHFPSIIVLGGSALKFYLLNSDGSAKLIAYSMFAGETLKGLFKCLVDSNNFKENILLASIGDREKIDTQVYEVLSENLNSPYGQFPPDLPIFSFGKCADYNKGKEDVNPNDXXXXXXXXXXXXTNNQVNTLCKAFKTKYVYFCGDIFNYQLFSKILQLGEILLPRLIETKILNVNYILALGTLKK 1124
            MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQK FEKIFVVGFKNLWA TVVKSVFD DANVVEEISALSNGVQL+SDNFQLSEIEIKNEESLSLYDKYKIDLKNPMFQKVIQAM+ISTPNETKSGEGIIHFPSIIVLGGSALKFYLLNSDGSAKLIAYSMFAGETLKGLFKCLVDSNNFKENILLASIGDREKIDTQVYEVLSENLNSPYGQFPPDLPIFSFGKCADYNKGKEDVNPNDLLESLSFLFLIETNNQVNTLCKAFKTKYVYFCGDIFNYQLFSKILQLGEILLPRLIETKILNVNYILALGTLKK
Sbjct:    1 MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQKVFEKIFVVGFKNLWATTVVKSVFDVDANVVEEISALSNGVQLVSDNFQLSEIEIKNEESLSLYDKYKIDLKNPMFQKVIQAMQISTPNETKSGEGIIHFPSIIVLGGSALKFYLLNSDGSAKLIAYSMFAGETLKGLFKCLVDSNNFKENILLASIGDREKIDTQVYEVLSENLNSPYGQFPPDLPIFSFGKCADYNKGKEDVNPNDLLESLSFLFLIETNNQVNTLCKAFKTKYVYFCGDIFNYQLFSKILQLGEILLPRLIETKILNVNYILALGTLKK 350          
BLAST of SMED30025246 vs. Planmine SMEST
Match: SMESG000077667.1 (SMESG000077667.1)

HSP 1 Score: 301.212 bits (770), Expect = 6.501e-100
Identity = 167/352 (47.44%), Postives = 232/352 (65.91%), Query Frame = 3
Query:   75 MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQKAFEKIFVVGFKNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSEIE--IKNEESLSLYDKYKIDLKNPMFQKVIQAMRISTPNETKSGEGIIHFPSIIVLGGSALKFYLLNSDGSAKLIAYSMFAGETLKGLFKCLVDSNNFKENILLASIGDREKIDTQVYEVLSENLNSPYGQFPPDLPIFSFGKCADYNKGKEDVNPNDXXXXXXXXXXXXTNNQVNTLCKAFKTKYVYFCGDIFNYQLFSKILQLGEILLPRLIETKILNVNYILALGTLKK 1124
            ML E   L ES LPFI+ N LAIDCGI  +KIVF  + +     F ++   N++L + LLEI E F ++   KI++ GFKNL  + +VK++F+ DA +V+E  A+ NG  LIS N +LSEIE  I NE +    DKYK+D+ NPMF++ I+ M+I T NET S E  I+ P I++L GS +K++L+  D S +L+  S   GET +G  KCLVDSNN+ E +  A+ G+RE  DTQV+EV+S+N  SPYG+ P  LPIFSFGK ADYNKGKED +P+D+LESL  LF  ET   V  LCK  K K +YFCG +F   +  K L++   +    ++ K+++ +Y++ALG +KK
Sbjct:    1 MLIEGAVLLESFLPFIDENSLAIDCGIVLAKIVFICRTDKVSLRFSTVA--NDKLDSFLLEIHEGFDRQTINKIYLTGFKNLSIRKIVKAIFNIDAILVDESFAVFNGFDLISKNMKLSEIEYKIDNESTTENVDKYKVDMNNPMFKQFIKGMQIKTDNETPSDEDCINVPHILILAGSTIKYFLVKKDKSVQLLDSSFCGGETFRGFCKCLVDSNNYGELMEKANKGNRENTDTQVWEVMSDNEKSPYGKLPQQLPIFSFGKSADYNKGKEDFSPDDILESLCSLFFNETMIHVIQLCKTHKLKTIYFCGGMFKAPVILKFLRIRNKIFSVDLKIKVIDCDYLIALGAMKK 350          
BLAST of SMED30025246 vs. Planmine SMEST
Match: SMESG000077668.1 (SMESG000077668.1)

HSP 1 Score: 273.478 bits (698), Expect = 9.034e-92
Identity = 138/159 (86.79%), Postives = 147/159 (92.45%), Query Frame = 3
Query:   75 MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQKAFEKIFVVGFKNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSEIEIKNEESLSLYDKYKIDLKNPMFQKVIQAMRISTPNET 551
            MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQK FEKIFVVGFKNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSEIEIK EE L LY+KYKI+  NP++ K +QAM+  + ++ 
Sbjct:    1 MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQKVFEKIFVVGFKNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSEIEIKIEEGLHLYEKYKINFANPLWNKFLQAMKFPSTDDA 159          
BLAST of SMED30025246 vs. Planmine SMEST
Match: SMESG000077674.1 (SMESG000077674.1)

HSP 1 Score: 120.168 bits (300), Expect = 2.907e-30
Identity = 83/282 (29.43%), Postives = 145/282 (51.42%), Query Frame = 3
Query:  294 IFVVGFKNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSEIEIKNEESLSLYDKY-KIDLKNPMFQKVIQAMRISTPNETKSGEGIIHFPSIIVLGGSALKFYLLNSDGSAKLIAYSMFAGETLKGLFKCLVDSNNFKENILLASIGDREKIDTQVYEVLSENLNSPYGQFPPDLPIFSFGKCADYNKG------KEDVNPNDXXXXXXXXXXXXTNNQVNTLCKAFKTKYVYFCGDIFNYQLFSKILQLGEILLPRLIETKILNVNYILALGTL 1118
            I + G +    ++ V  VF     VV E++A++NGV+   ++    E +      +SL DKY ++++K  + +K+++  +       K+      +P + V GGS  ++ L+   G  K ++++ + G T +GL KCL+D NN  + + +A IG+RE IDTQV EVL ++  SPYG++PP+LP+F+FGK  DY          ED++ + +   +             T CK      +YF G++F ++ F        + LP +I+T  L   +   +G L
Sbjct:  120 ILICGIQCKHFQSEVSKVFGCGVKVVSEMAAIANGVRYFINH---QERDTFFHLPVSLSDKYEQVNIK--ILEKLLETWKAKRELLLKNSTSK-EYPCLYVNGGSVCRYVLVEEYGKGKEVSFNSYGGSTFQGLAKCLLDENNINKLLEMAEIGNRENIDTQVKEVL-DDYESPYGKYPPNLPVFAFGKAMDYASSDKITCQNEDISQSLVSMIVDNSVFFALRIASMTSCKK-----IYFGGNLFQHKSFLVEYSRFCVRLPEIIKTHFLKCGFETNIGLL 389          
BLAST of SMED30025246 vs. Planmine SMEST
Match: SMESG000077416.1 (SMESG000077416.1)

HSP 1 Score: 118.627 bits (296), Expect = 8.936e-30
Identity = 95/338 (28.11%), Postives = 162/338 (47.93%), Query Frame = 3
Query:  135 LAIDCGISSSKIVF-----SVQL---ENHEQVFRSLGLLNEELKTVLLEIQET--FGQKAFEKIFVVGFKNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSEIEIKNEESLSLYDKYKIDLKNPMFQKVIQAMRISTPNETKSGEGIIHFPSIIVLGGSALKFYLLNSDGSAKLIAYSMFAGETLKGLFKCLVDSNNFKENILLASIGDREKIDTQVYEVLSENLNSPYGQFPPDLPIFSFGKCADYNKGKEDVNPNDXXXXXXXXXXXXTNNQVNTLCKAFKTKYVYFCGDIFNYQLFSKILQLGEILLPRLIETKILNVNYILALGTL 1118
            + ID G S SK +F       QL     H   F+     NE+++  L  ++E     +    +I   G   L  K  ++S F+     V+E  AL  G ++  ++  L  +      +  LY+     + N + + ++  M+     +T S +  + +P ++   GS    +  + DG A+ I      G++  G+ KCL+DSN++ E I  AS G+R+ IDT + ++L  +  SPYG+FPP+LP+F FGKCA+ N+  +  + +DL  SL  L   + ++         KTK +Y  G+ F   LF K +    +  P  +E   L++ Y  ALG +
Sbjct:   25 IGIDIGSSLSKFIFVNKQNRCQLYDESTHHINFQYSIFKNEDIEKALEWLKENAYIQEGTRYEIHCTGTGCLRNKKQIESTFELGLIFVQEGLALIAGHKIALEHCPLENLIHPPTSADELYE-----IDNNILKTMLTRMQKRINTDTNSNKTSL-YPFVLGYWGSGSSIFFFDDDGKAQQIGSFQNGGKSFLGMAKCLIDSNDYDEIIASASKGNRKNIDTLIKDILISDEKSPYGKFPPELPVFQFGKCAENNQDLKYYSKDDLAMSLICLESSQISSNCRNAALTTKTKKIYLSGNTFKSSLFHKEILNRNLRHPIGVEYTFLDLGYATALGAM 356          
The following BLAST results are available for this feature:
BLAST of SMED30025246 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025246 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025246 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025246 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025246 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025246 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025246 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025246 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DQ252.387e-2126.09Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GK068.519e-2125.82Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GE911.607e-2025.34Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GKH71.110e-1833.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IVK54.680e-1830.70Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30025246 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025246 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025246 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025246 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025246 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025246 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077669.10.000e+098.57SMESG000077669.1[more]
SMESG000077667.16.501e-10047.44SMESG000077667.1[more]
SMESG000077668.19.034e-9286.79SMESG000077668.1[more]
SMESG000077674.12.907e-3029.43SMESG000077674.1[more]
SMESG000077416.18.936e-3028.11SMESG000077416.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025246 ID=SMED30025246|Name=SMED30025246|organism=Schmidtea mediterranea sexual|type=transcript|length=1175bp
ACGTAATATTCTTCGGATTTTGAACTTTGACCTTAAATTTTACTAATTGG
TCACAATTTTCAATTGACGTTGAAATGTTAAATGAAGCTTTACAGTTACC
GGAATCGTTATTGCCATTTATTAATGGTAATCAGTTGGCCATTGACTGTG
GGATTTCTTCGTCGAAAATAGTTTTCAGTGTTCAGCTTGAAAATCATGAA
CAAGTATTTCGTTCTCTAGGTCTTCTCAATGAAGAATTGAAAACTGTTCT
TTTGGAAATTCAAGAAACATTTGGACAAAAAGCGTTTGAGAAAATATTTG
TAGTTGGTTTCAAAAATCTATGGGCAAAAACGGTGGTAAAATCTGTATTT
GATGCCGATGCAAATGTTGTTGAGGAGATTTCAGCACTTTCTAATGGAGT
GCAATTGATTTCGGATAATTTTCAATTGAGTGAAATTGAAATAAAAAACG
AAGAAAGTTTATCTCTTTATGACAAATATAAAATAGATTTGAAAAATCCA
ATGTTTCAAAAAGTTATTCAAGCTATGCGGATTTCAACGCCGAATGAAAC
AAAATCCGGTGAAGGAATTATACATTTTCCGAGCATCATTGTATTGGGTG
GCTCAGCTTTAAAATTTTATTTATTGAACAGTGATGGGTCAGCGAAATTA
ATTGCCTATTCCATGTTTGCAGGAGAAACCTTGAAGGGTTTGTTTAAATG
TCTTGTCGATTCAAATAATTTCAAGGAAAACATTTTGCTTGCATCTATAG
GCGACAGAGAGAAAATAGATACACAAGTATATGAAGTTTTGTCTGAAAAT
CTAAATTCACCATACGGACAATTTCCTCCTGATCTTCCAATATTCTCTTT
TGGTAAATGCGCTGATTATAATAAAGGCAAAGAGGATGTCAACCCGAATG
ACTTGTTGGAGTCCTTGAGTTTTTTATTCTTAATTGAAACAAATAATCAA
GTAAATACATTATGCAAGGCTTTCAAGACAAAATATGTTTATTTTTGTGG
AGATATATTTAATTACCAATTATTTTCCAAAATTCTTCAACTTGGAGAAA
TCTTATTGCCAAGACTAATAGAAACGAAAATTTTAAATGTGAATTATATT
CTTGCTTTAGGTACCCTGAAGAAATGATATCCAAATTCAATTGTAATTTG
AGGACTTTTAGTGGTTAAATTTTCG
back to top

protein sequence of SMED30025246-orf-1

>SMED30025246-orf-1 ID=SMED30025246-orf-1|Name=SMED30025246-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=351bp
MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGL
LNEELKTVLLEIQETFGQKAFEKIFVVGFKNLWAKTVVKSVFDADANVVE
EISALSNGVQLISDNFQLSEIEIKNEESLSLYDKYKIDLKNPMFQKVIQA
MRISTPNETKSGEGIIHFPSIIVLGGSALKFYLLNSDGSAKLIAYSMFAG
ETLKGLFKCLVDSNNFKENILLASIGDREKIDTQVYEVLSENLNSPYGQF
PPDLPIFSFGKCADYNKGKEDVNPNDLLESLSFLFLIETNNQVNTLCKAF
KTKYVYFCGDIFNYQLFSKILQLGEILLPRLIETKILNVNYILALGTLKK
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000418head
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR004567Type_II_PanK
Vocabulary: molecular function
TermDefinition
GO:0004594pantothenate kinase activity
GO:0005524ATP binding
Vocabulary: biological process
TermDefinition
GO:0015937coenzyme A biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.8.780coord: 237..282
e-value: 2.7E-15
score: 58.4
NoneNo IPR availableGENE3DG3DSA:3.30.420.510coord: 31..148
e-value: 2.7E-15
score: 58.4
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 149..320
e-value: 2.7E-15
score: 58.4
NoneNo IPR availablePANTHERPTHR12280:SF20PANTOTHENATE KINASE 4coord: 95..320
NoneNo IPR availablePANTHERPTHR12280PANTOTHENATE KINASEcoord: 95..320
IPR004567Type II pantothenate kinasePFAMPF03630Fumblecoord: 83..319
e-value: 7.1E-13
score: 48.4
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 103..330