Kinesin-like protein

Overview
NameKinesin-like protein
Smed IDSMED30025245
Length (bp)3219
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin-like protein (SMED30025245) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30025245) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin-like protein (SMED30025245) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30025245) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025245

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025245h1SMcG0007120 SmedASXL_016228SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025245h1SMcG0007120 SmedASXL_016228SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30025245h1SMcG0007120 Contig39875uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025245h1SMcG0007120 Contig39875newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30025245h1SMcG0007120 dd_Smed_v4_13972_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025245h1SMcG0007120 dd_Smed_v4_13972_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30025245h1SMcG0007120 dd_Smed_v6_13972_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30025245h1SMcG0007120 dd_Smed_v4_13972_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF20B (kinesin family member 20B [Source:HGNC Symbol;Acc:HGNC:7212])

HSP 1 Score: 248.44 bits (633), Expect = 9.956e-67
Identity = 195/596 (32.72%), Postives = 302/596 (50.67%), Query Frame = 3
Query:  153 DTMKIFLRFRPLNINQ----AESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK------FSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXD------VLHMFSNGEFVDENVLSNNELSDIN--NNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGS-EYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVN--------PSKGGQRLSI-----YRRLGMKTP---------------------KTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIRE 1781
            D +++ LR RP   ++    +E    I D  T+    P Q +  +     +G+  QKFSFSKVF P + Q+  F       ++D +KG  RL+FTYG T+SGKT+T  G + N+GI+PR L  LF       ++K++  P           + +K +          + +++    SD      + +  +  EF  E  + + E +++N  N+ + + W+S+ EIYNE IYDL  PVS      +   KR +L +     G S++K L+   V  ++EAYRLL +G + Q +  TKLN  SSRSH+I T++ ++        + +V   S CDLAGSERT K Q  G   +E  NIN+SLL LG+CI+VLK N       + VP+R+SKLT  FQ++  G GK  MIV ++Q    +DET+ VLKFSA+A+KV +     P  +N        P K  Q +S+      + L +K                       + A +   +E+ L  +D D           EE + +    + ++LLD+IE LK +LI  KKEK+  E K+RE++  +++Q   Q E D  + + + RE
Sbjct:   57 DYLQVCLRIRPFTQSEKELESEGCVHILDSQTVVLKEP-QCILGRLSEKSSGQMAQKFSFSKVFGPATTQKEFFQGCIMQPVKDLLKGQSRLIFTYGLTNSGKTYTFQGTEENIGILPRTLNVLFDSLQERLYTKMNLKPHRSREYLRLSSEQEKEEIASKSALLRQIKEVTVHNDSDDTLYGSLTNSLNISEF--EESIKDYEQANLNMANSIKFSVWVSFFEIYNEYIYDLFVPVS------SKFQKRKMLRLSQDVKGYSFIKDLQWIQVSDSKEAYRLLKLGIKHQSVAFTKLNNASSRSHSIFTVKILQIEDSEMSRVIRVSELSLCDLAGSERTMKTQNEGERLRETGNINTSLLTLGKCINVLK-NSEKSKFQQHVPFRESKLTHYFQSFFNGKGKICMIVNISQCYLAYDETLNVLKFSAIAQKVCV-----PDTLNSSQEKLFGPVKSSQDVSLDSNSNSKILNVKRATISWENSLEDLMEDEDLVEELENAEETQNVETKLLDEDLDK--------TLEENKAFISHEEKRKLLDLIEDLKKKLINEKKEKLTLEFKIREEVTQEFTQYWAQREADFKETLLQERE 629          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF20B (kinesin family member 20B [Source:HGNC Symbol;Acc:HGNC:7212])

HSP 1 Score: 247.284 bits (630), Expect = 2.230e-66
Identity = 195/596 (32.72%), Postives = 302/596 (50.67%), Query Frame = 3
Query:  153 DTMKIFLRFRPLNINQ----AESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK------FSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXD------VLHMFSNGEFVDENVLSNNELSDIN--NNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGS-EYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVN--------PSKGGQRLSI-----YRRLGMKTP---------------------KTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIRE 1781
            D +++ LR RP   ++    +E    I D  T+    P Q +  +     +G+  QKFSFSKVF P + Q+  F       ++D +KG  RL+FTYG T+SGKT+T  G + N+GI+PR L  LF       ++K++  P           + +K +          + +++    SD      + +  +  EF  E  + + E +++N  N+ + + W+S+ EIYNE IYDL  PVS      +   KR +L +     G S++K L+   V  ++EAYRLL +G + Q +  TKLN  SSRSH+I T++ ++        + +V   S CDLAGSERT K Q  G   +E  NIN+SLL LG+CI+VLK N       + VP+R+SKLT  FQ++  G GK  MIV ++Q    +DET+ VLKFSA+A+KV +     P  +N        P K  Q +S+      + L +K                       + A +   +E+ L  +D D           EE + +    + ++LLD+IE LK +LI  KKEK+  E K+RE++  +++Q   Q E D  + + + RE
Sbjct:   57 DYLQVCLRIRPFTQSEKELESEGCVHILDSQTVVLKEP-QCILGRLSEKSSGQMAQKFSFSKVFGPATTQKEFFQGCIMQPVKDLLKGQSRLIFTYGLTNSGKTYTFQGTEENIGILPRTLNVLFDSLQERLYTKMNLKPHRSREYLRLSSEQEKEEIASKSALLRQIKEVTVHNDSDDTLYGSLTNSLNISEF--EESIKDYEQANLNMANSIKFSVWVSFFEIYNEYIYDLFVPVS------SKFQKRKMLRLSQDVKGYSFIKDLQWIQVSDSKEAYRLLKLGIKHQSVAFTKLNNASSRSHSIFTVKILQIEDSEMSRVIRVSELSLCDLAGSERTMKTQNEGERLRETGNINTSLLTLGKCINVLK-NSEKSKFQQHVPFRESKLTHYFQSFFNGKGKICMIVNISQCYLAYDETLNVLKFSAIAQKVCV-----PDTLNSSQEKLFGPVKSSQDVSLDSNSNSKILNVKRATISWENSLEDLMEDEDLVEELENAEETQNVETKLLDEDLDK--------TLEENKAFISHEEKRKLLDLIEDLKKKLINEKKEKLTLEFKIREEVTQEFTQYWAQREADFKETLLQERE 629          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF23 (kinesin family member 23 [Source:HGNC Symbol;Acc:HGNC:6392])

HSP 1 Score: 212.231 bits (539), Expect = 2.702e-56
Identity = 151/462 (32.68%), Postives = 231/462 (50.00%), Query Frame = 3
Query:  102 AETPL-TLFNNNSENAVDDTMKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK-----------FSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDV-LHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDI-RIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRT---YPGSEYLSK-----VCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPV 1421
            A+TP        S+  + D + ++ R RPL     E    + +  T+    PE    Y+   +G+ K  Q +SF +VF   + Q+ +F+  +  L+ D I G + LLFTYG T SGKTHTM G+    G++PR L  +F            F     N + +  +   + + +K ++    K  S   ++  + +  + +  F   E VDE+ +                ++SY EIYN  IYDLL+ V    I    K K P   + R  +N   YV G     V S EEA+ +   G++ + I +T LN+ SSRSH++  I+ V+      G   L +     +   S  DLAGSERT++ +  G   +EA NIN SL+ L  C+DVL+ NQ+   N ++VPYRDSKLT LF+ Y  G GK  MIVCVN     ++E +QV++F+ + ++V   E  +PV
Sbjct:    6 AKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPE---GYRLNRNGDYKETQ-YSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMPNPKTSSSKRQVDPEFADMITVQEFCKAEEVDEDSVYG-------------VFVSYIEIYNNYIYDLLEEVPFDPI----KPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTN-KMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEV---EVARPV 442          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF23 (kinesin family member 23 [Source:HGNC Symbol;Acc:HGNC:6392])

HSP 1 Score: 212.231 bits (539), Expect = 7.169e-56
Identity = 151/462 (32.68%), Postives = 231/462 (50.00%), Query Frame = 3
Query:  102 AETPL-TLFNNNSENAVDDTMKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK-----------FSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDV-LHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDI-RIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRT---YPGSEYLSK-----VCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPV 1421
            A+TP        S+  + D + ++ R RPL     E    + +  T+    PE    Y+   +G+ K  Q +SF +VF   + Q+ +F+  +  L+ D I G + LLFTYG T SGKTHTM G+    G++PR L  +F            F     N + +  +   + + +K ++    K  S   ++  + +  + +  F   E VDE+ +                ++SY EIYN  IYDLL+ V    I    K K P   + R  +N   YV G     V S EEA+ +   G++ + I +T LN+ SSRSH++  I+ V+      G   L +     +   S  DLAGSERT++ +  G   +EA NIN SL+ L  C+DVL+ NQ+   N ++VPYRDSKLT LF+ Y  G GK  MIVCVN     ++E +QV++F+ + ++V   E  +PV
Sbjct:    6 AKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPE---GYRLNRNGDYKETQ-YSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMPNPKTSSSKRQVDPEFADMITVQEFCKAEEVDEDSVYG-------------VFVSYIEIYNNYIYDLLEEVPFDPI----KPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTN-KMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEV---EVARPV 442          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF23 (kinesin family member 23 [Source:HGNC Symbol;Acc:HGNC:6392])

HSP 1 Score: 211.846 bits (538), Expect = 8.902e-56
Identity = 151/462 (32.68%), Postives = 231/462 (50.00%), Query Frame = 3
Query:  102 AETPL-TLFNNNSENAVDDTMKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK-----------FSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDV-LHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDI-RIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRT---YPGSEYLSK-----VCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPV 1421
            A+TP        S+  + D + ++ R RPL     E    + +  T+    PE    Y+   +G+ K  Q +SF +VF   + Q+ +F+  +  L+ D I G + LLFTYG T SGKTHTM G+    G++PR L  +F            F     N + +  +   + + +K ++    K  S   ++  + +  + +  F   E VDE+ +                ++SY EIYN  IYDLL+ V    I    K K P   + R  +N   YV G     V S EEA+ +   G++ + I +T LN+ SSRSH++  I+ V+      G   L +     +   S  DLAGSERT++ +  G   +EA NIN SL+ L  C+DVL+ NQ+   N ++VPYRDSKLT LF+ Y  G GK  MIVCVN     ++E +QV++F+ + ++V   E  +PV
Sbjct:    6 AKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPE---GYRLNRNGDYKETQ-YSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMPNPKTSSSKRQVDPEFADMITVQEFCKAEEVDEDSVYG-------------VFVSYIEIYNNYIYDLLEEVPFDPI----KPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTN-KMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEV---EVARPV 442          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: zen-4 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:Q8MQ03])

HSP 1 Score: 189.119 bits (479), Expect = 1.920e-49
Identity = 148/456 (32.46%), Postives = 221/456 (48.46%), Query Frame = 3
Query:  171 LRFRPLNINQAESPFVICD--PFTISAT--------------PPEQSVSYKNLLHGNGKGFQK-FSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNG--NKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAV---------RTYPGSE----YLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPN-NLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSK 1439
            +R + L+I + +S  V+C   P+T S                PP Q          N    +K F F +VF     Q  VF  TS  L+ + +KG + LLFTYG T SGKT+TM G   ++  G++PR L  +F          +         +I+ T                 + ++D L   S    + +      +LS  N++   + +++Y EIYN   YDLL+     + +G+  L +   +IR  R    YV G K   V S+EEA  +  +G   + + ST LN++SSRSH++ TI+ V           YP  +     +S++C     DLAGSER  + Q  G    EA++IN SL+ L +CI+VL+ NQ + + NL  VPYR SKLT LF+ YL GNGK  M++CVN  P  +DE M  L F+  ++ +   E +K V   PS+
Sbjct:   15 VRRKKLSIEETDSIEVVCRLCPYTGSTPSLIAIDEGSIQTVLPPAQ------FRRENAPQVEKVFRFGRVFSENDGQATVFERTSVDLILNLLKGQNSLLFTYGVTGSGKTYTMTGKPTETGTGLLPRTLDVIFNSINNRVEKCIFYPSALNTFEIRAT---------LDAHLKRHQMAADRL---STSREITDRYCEAIKLSGYNDDMVCSVFVTYVEIYNNYCYDLLE----DARNGSRVLTK--REIRHDRQQQMYVDGAKDVEVSSSEEALEVFCLGEERRRVSSTLLNKDSSRSHSVFTIKLVMAPRAYETKSVYPTMDSSQIIVSQLC---LVDLAGSERAKRTQNVGERLAEANSINQSLMTLRQCIEVLRRNQKSSSQNLEQVPYRQSKLTHLFKNYLEGNGKIRMVICVNPKPDDYDENMSALAFAEESQTI---EVKKQVERMPSE 440          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: zen-4 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:Q8MQ03])

HSP 1 Score: 189.119 bits (479), Expect = 2.252e-49
Identity = 148/456 (32.46%), Postives = 221/456 (48.46%), Query Frame = 3
Query:  171 LRFRPLNINQAESPFVICD--PFTISAT--------------PPEQSVSYKNLLHGNGKGFQK-FSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNG--NKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAV---------RTYPGSE----YLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPN-NLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSK 1439
            +R + L+I + +S  V+C   P+T S                PP Q          N    +K F F +VF     Q  VF  TS  L+ + +KG + LLFTYG T SGKT+TM G   ++  G++PR L  +F          +         +I+ T                 + ++D L   S    + +      +LS  N++   + +++Y EIYN   YDLL+     + +G+  L +   +IR  R    YV G K   V S+EEA  +  +G   + + ST LN++SSRSH++ TI+ V           YP  +     +S++C     DLAGSER  + Q  G    EA++IN SL+ L +CI+VL+ NQ + + NL  VPYR SKLT LF+ YL GNGK  M++CVN  P  +DE M  L F+  ++ +   E +K V   PS+
Sbjct:   15 VRRKKLSIEETDSIEVVCRLCPYTGSTPSLIAIDEGSIQTVLPPAQ------FRRENAPQVEKVFRFGRVFSENDGQATVFERTSVDLILNLLKGQNSLLFTYGVTGSGKTYTMTGKPTETGTGLLPRTLDVIFNSINNRVEKCIFYPSALNTFEIRAT---------LDAHLKRHQMAADRL---STSREITDRYCEAIKLSGYNDDMVCSVFVTYVEIYNNYCYDLLE----DARNGSRVLTK--REIRHDRQQQMYVDGAKDVEVSSSEEALEVFCLGEERRRVSSTLLNKDSSRSHSVFTIKLVMAPRAYETKSVYPTMDSSQIIVSQLC---LVDLAGSERAKRTQNVGERLAEANSINQSLMTLRQCIEVLRRNQKSSSQNLEQVPYRQSKLTHLFKNYLEGNGKIRMVICVNPKPDDYDENMSALAFAEESQTI---EVKKQVERMPSE 440          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: zen-4 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:Q8MQ03])

HSP 1 Score: 189.119 bits (479), Expect = 2.252e-49
Identity = 148/456 (32.46%), Postives = 221/456 (48.46%), Query Frame = 3
Query:  171 LRFRPLNINQAESPFVICD--PFTISAT--------------PPEQSVSYKNLLHGNGKGFQK-FSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNG--NKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAV---------RTYPGSE----YLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPN-NLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSK 1439
            +R + L+I + +S  V+C   P+T S                PP Q          N    +K F F +VF     Q  VF  TS  L+ + +KG + LLFTYG T SGKT+TM G   ++  G++PR L  +F          +         +I+ T                 + ++D L   S    + +      +LS  N++   + +++Y EIYN   YDLL+     + +G+  L +   +IR  R    YV G K   V S+EEA  +  +G   + + ST LN++SSRSH++ TI+ V           YP  +     +S++C     DLAGSER  + Q  G    EA++IN SL+ L +CI+VL+ NQ + + NL  VPYR SKLT LF+ YL GNGK  M++CVN  P  +DE M  L F+  ++ +   E +K V   PS+
Sbjct:   15 VRRKKLSIEETDSIEVVCRLCPYTGSTPSLIAIDEGSIQTVLPPAQ------FRRENAPQVEKVFRFGRVFSENDGQATVFERTSVDLILNLLKGQNSLLFTYGVTGSGKTYTMTGKPTETGTGLLPRTLDVIFNSINNRVEKCIFYPSALNTFEIRAT---------LDAHLKRHQMAADRL---STSREITDRYCEAIKLSGYNDDMVCSVFVTYVEIYNNYCYDLLE----DARNGSRVLTK--REIRHDRQQQMYVDGAKDVEVSSSEEALEVFCLGEERRRVSSTLLNKDSSRSHSVFTIKLVMAPRAYETKSVYPTMDSSQIIVSQLC---LVDLAGSERAKRTQNVGERLAEANSINQSLMTLRQCIEVLRRNQKSSSQNLEQVPYRQSKLTHLFKNYLEGNGKIRMVICVNPKPDDYDENMSALAFAEESQTI---EVKKQVERMPSE 440          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: zen-4 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:Q8MQ03])

HSP 1 Score: 188.734 bits (478), Expect = 2.764e-49
Identity = 148/456 (32.46%), Postives = 221/456 (48.46%), Query Frame = 3
Query:  171 LRFRPLNINQAESPFVICD--PFTISAT--------------PPEQSVSYKNLLHGNGKGFQK-FSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNG--NKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAV---------RTYPGSE----YLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPN-NLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSK 1439
            +R + L+I + +S  V+C   P+T S                PP Q          N    +K F F +VF     Q  VF  TS  L+ + +KG + LLFTYG T SGKT+TM G   ++  G++PR L  +F          +         +I+ T                 + ++D L   S    + +      +LS  N++   + +++Y EIYN   YDLL+     + +G+  L +   +IR  R    YV G K   V S+EEA  +  +G   + + ST LN++SSRSH++ TI+ V           YP  +     +S++C     DLAGSER  + Q  G    EA++IN SL+ L +CI+VL+ NQ + + NL  VPYR SKLT LF+ YL GNGK  M++CVN  P  +DE M  L F+  ++ +   E +K V   PS+
Sbjct:   15 VRRKKLSIEETDSIEVVCRLCPYTGSTPSLIAIDEGSIQTVLPPAQ------FRRENAPQVEKVFRFGRVFSENDGQATVFERTSVDLILNLLKGQNSLLFTYGVTGSGKTYTMTGKPTETGTGLLPRTLDVIFNSINNRVEKCIFYPSALNTFEIRAT---------LDAHLKRHQMAADRL---STSREITDRYCEAIKLSGYNDDMVCSVFVTYVEIYNNYCYDLLE----DARNGSRVLTK--REIRHDRQQQMYVDGAKDVEVSSSEEALEVFCLGEERRRVSSTLLNKDSSRSHSVFTIKLVMAPRAYETKSVYPTMDSSQIIVSQLC---LVDLAGSERAKRTQNVGERLAEANSINQSLMTLRQCIEVLRRNQKSSSQNLEQVPYRQSKLTHLFKNYLEGNGKIRMVICVNPKPDDYDENMSALAFAEESQTI---EVKKQVERMPSE 440          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: zen-4 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:Q8MQ03])

HSP 1 Score: 187.963 bits (476), Expect = 4.687e-49
Identity = 148/456 (32.46%), Postives = 219/456 (48.03%), Query Frame = 3
Query:  171 LRFRPLNINQAESPFVICD--PFTISAT--------------PPEQSVSYKNLLHGNGKGFQK-FSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNG--NKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAV---------RTYPGSE----YLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPN-NLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSK 1439
            +R + L+I + +S  V+C   P+T S                PP Q          N    +K F F +VF     Q  VF  TS  L+ + +KG + LLFTYG T SGKT+TM G   ++  G++PR L  +F          +         +I+ T                 + ++D L   S    + +      +LS  N++   + +++Y EIYN   YDLL+      ++     KR   +IR  R    YV G K   V S+EEA  +  +G   + + ST LN++SSRSH++ TI+ V           YP  +     +S++C     DLAGSER  + Q  G    EA++IN SL+ L +CI+VL+ NQ + + NL  VPYR SKLT LF+ YL GNGK  M++CVN  P  +DE M  L F+  ++ +   E +K V   PS+
Sbjct:   15 VRRKKLSIEETDSIEVVCRLCPYTGSTPSLIAIDEGSIQTVLPPAQ------FRRENAPQVEKVFRFGRVFSENDGQATVFERTSVDLILNLLKGQNSLLFTYGVTGSGKTYTMTGKPTETGTGLLPRTLDVIFNSINNRVEKCIFYPSALNTFEIRAT---------LDAHLKRHQMAADRL---STSREITDRYCEAIKLSGYNDDMVCSVFVTYVEIYNNYCYDLLEDARNGVLT-----KR---EIRHDRQQQMYVDGAKDVEVSSSEEALEVFCLGEERRRVSSTLLNKDSSRSHSVFTIKLVMAPRAYETKSVYPTMDSSQIIVSQLC---LVDLAGSERAKRTQNVGERLAEANSINQSLMTLRQCIEVLRRNQKSSSQNLEQVPYRQSKLTHLFKNYLEGNGKIRMVICVNPKPDDYDENMSALAFAEESQTI---EVKKQVERMPSE 438          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: pav (gene:FBgn0011692 transcript:FBtr0073227)

HSP 1 Score: 209.92 bits (533), Expect = 1.190e-55
Identity = 137/435 (31.49%), Postives = 229/435 (52.64%), Query Frame = 3
Query:  132 NSENAVDDTMKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK-FSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLS--------KVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNN---LRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRL--FDETMQVLKFSALAKKV 1394
            ++ +   D + +F R RPL  +   +   + +  TI+  P +Q + +    +G  +  Q + F  VF P++ Q+ V+   ++ L+++ +KG + LLFTYG T SGKT+TM GN  + GI+PR L  LF+  S       +   D     +I   +   L ++  +  + +        H  S+ E   +  +    L  ++ +   + +++Y EIYN  +YDLL+   I        L+  I  IR   N   +V G+    V + E+A  +  +G++ + +G T LN  SSRSH++  IR V+    S+  +         V   S  DLAGSER+ + + +G+  +EA NIN+SL+ L  C++ L+ NQL  +N    + VPYRDSK+T +F+ Y  G G+ SMIVC+N  PR+  +DE MQV+KF+ + ++V
Sbjct:   28 DTSDKARDPVNVFCRVRPLQSDADLTSLRVKNSTTIALNPQDQLLQHHKPHNGAQREVQ-YIFKHVFQPDATQQDVYAAVAQPLVENLLKGRNSLLFTYGVTGSGKTYTMTGNLRHRGIMPRCLDVLFRTISDYQAKKFVFKPDKLNGFEILSEEDALLERQHEMNQRFAGSGRFAFRHKDSDPEIASQASVEPIPLLGLDEDNMYSVFVTYIEIYNNSVYDLLEDSGIQKT-----LQSKI--IREDANRHMFVHGVTEVEVKTVEDALEVFQMGQKRKRMGHTVLNAESSRSHSVFNIRLVQAPTDSQGENVVQDRQNITVSQLSLVDLAGSERSSRTKNTGVRLREAGNINNSLMTLRTCLEYLRENQLAASNGLAPKKVPYRDSKITHMFKNYFDGEGQVSMIVCIN--PRIEDYDENMQVMKFAEMTQEV 452          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: sub (gene:FBgn0003545 transcript:FBtr0340277)

HSP 1 Score: 196.052 bits (497), Expect = 2.051e-52
Identity = 142/429 (33.10%), Postives = 216/429 (50.35%), Query Frame = 3
Query:  162 KIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDT--SKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFS----------KLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKR-PILDIRIARNGGS-YVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFE 1406
            ++FLR RP  +  A   +++ +   +  T  +   +  N+     +  + F F+ +F     Q  +++     K + ++ +      + TYGT+ SGKT+T+ G+    GIIPRAL N+F             KL N  ++   D A + +++       L           K+  D  HMF      D +VL                W+S+ EIYNEL+YDLL     +     +KL   P  +++I  N G  ++KGL S  V S+EEA RLL +G++     ST +N NSSRSH + T+  ++ Y  S   ++  ++ FCDLAGSER +   TSGL  KEA NIN+SL+ LGRC+D     Q    N  I+PYRDSKLT L Q  L G  K +MIV V    + ++E + VL F+++AK ++  E
Sbjct:   89 QVFLRLRP--VKDASKAYIVSEEANVLITSCKVDSTSNNV----NRMEKHFGFTSIFDSTVGQRDIYDTCVGPKIMEEECVT-----IMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFETKASTDVSVL---------------VWVSFVEIYNELVYDLL-----AIPPKQDKLGEVPRKNLKIVGNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILK-YNRSGITTQ-SSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQ-KKKNADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKE 483          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: sub (gene:FBgn0003545 transcript:FBtr0086881)

HSP 1 Score: 196.052 bits (497), Expect = 2.051e-52
Identity = 142/429 (33.10%), Postives = 216/429 (50.35%), Query Frame = 3
Query:  162 KIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDT--SKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFS----------KLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKR-PILDIRIARNGGS-YVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFE 1406
            ++FLR RP  +  A   +++ +   +  T  +   +  N+     +  + F F+ +F     Q  +++     K + ++ +      + TYGT+ SGKT+T+ G+    GIIPRAL N+F             KL N  ++   D A + +++       L           K+  D  HMF      D +VL                W+S+ EIYNEL+YDLL     +     +KL   P  +++I  N G  ++KGL S  V S+EEA RLL +G++     ST +N NSSRSH + T+  ++ Y  S   ++  ++ FCDLAGSER +   TSGL  KEA NIN+SL+ LGRC+D     Q    N  I+PYRDSKLT L Q  L G  K +MIV V    + ++E + VL F+++AK ++  E
Sbjct:   89 QVFLRLRP--VKDASKAYIVSEEANVLITSCKVDSTSNNV----NRMEKHFGFTSIFDSTVGQRDIYDTCVGPKIMEEECVT-----IMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFETKASTDVSVL---------------VWVSFVEIYNELVYDLL-----AIPPKQDKLGEVPRKNLKIVGNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILK-YNRSGITTQ-SSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQ-KKKNADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKE 483          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp31E (gene:FBgn0032243 transcript:FBtr0302039)

HSP 1 Score: 161.77 bits (408), Expect = 4.437e-40
Identity = 131/457 (28.67%), Postives = 197/457 (43.11%), Query Frame = 3
Query:  150 DDTMKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTM---------NGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVR--------TYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRR 1469
            D ++++ +R RP N  +      IC   T++   P+       +  G+ K F   +F  VF   S+Q  +++D  + L+   + G +  +  YG T SGKT+TM         + +   LGIIPRA                                                    V H+FS  E ++ +  S +E      + + +  + Y E+YNE I+DLLDP      + N+  K     I    +G   + G    P+Y   +A + L  G  ++   STK+N  SSRSH + TI   R          P ++  +    F F DLAGSER  + Q +G   +E  +IN  LLALG CI  L        +   VPYRDSKLTRL Q  LGGN +  MI CV+   R F ET+  LK++  A+ +     +  V +N  +  + +S  RR
Sbjct:   11 DSSVRVAVRIRPQNSRELIDMCRIC--TTVTLGEPQ-------IFLGSDKAF---TFDYVFDTNSNQCDIYSDCVEKLVDSTLHGYNATVLAYGQTGSGKTYTMGTGFDHESESSDSVQLGIIPRA----------------------------------------------------VRHIFSGIEQLEGS--STSEHPAAGGSPQFSLAVQYIELYNEDIFDLLDP-----FNKNSNFK-----IHEDASGQITISGASIKPIYQPHDALKYLQQGALARTTASTKMNDQSSRSHALFTIFVRRQRLLTPSDNVPDNDLETLTSKFHFVDLAGSERLKRTQATGERAREGISINCGLLALGNCISALGDKSKRALH---VPYRDSKLTRLLQDSLGGNSQTLMIACVSPSDRDFMETLNTLKYANRARNI-----KNKVKINQDQSSRTISQLRR 383          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp31E (gene:FBgn0032243 transcript:FBtr0080018)

HSP 1 Score: 161.77 bits (408), Expect = 4.437e-40
Identity = 131/457 (28.67%), Postives = 197/457 (43.11%), Query Frame = 3
Query:  150 DDTMKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTM---------NGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVR--------TYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRR 1469
            D ++++ +R RP N  +      IC   T++   P+       +  G+ K F   +F  VF   S+Q  +++D  + L+   + G +  +  YG T SGKT+TM         + +   LGIIPRA                                                    V H+FS  E ++ +  S +E      + + +  + Y E+YNE I+DLLDP      + N+  K     I    +G   + G    P+Y   +A + L  G  ++   STK+N  SSRSH + TI   R          P ++  +    F F DLAGSER  + Q +G   +E  +IN  LLALG CI  L        +   VPYRDSKLTRL Q  LGGN +  MI CV+   R F ET+  LK++  A+ +     +  V +N  +  + +S  RR
Sbjct:   11 DSSVRVAVRIRPQNSRELIDMCRIC--TTVTLGEPQ-------IFLGSDKAF---TFDYVFDTNSNQCDIYSDCVEKLVDSTLHGYNATVLAYGQTGSGKTYTMGTGFDHESESSDSVQLGIIPRA----------------------------------------------------VRHIFSGIEQLEGS--STSEHPAAGGSPQFSLAVQYIELYNEDIFDLLDP-----FNKNSNFK-----IHEDASGQITISGASIKPIYQPHDALKYLQQGALARTTASTKMNDQSSRSHALFTIFVRRQRLLTPSDNVPDNDLETLTSKFHFVDLAGSERLKRTQATGERAREGISINCGLLALGNCISALGDKSKRALH---VPYRDSKLTRLLQDSLGGNSQTLMIACVSPSDRDFMETLNTLKYANRARNI-----KNKVKINQDQSSRTISQLRR 383          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif20a (kinesin family member 20A [Source:ZFIN;Acc:ZDB-GENE-050522-252])

HSP 1 Score: 272.322 bits (695), Expect = 1.328e-76
Identity = 163/445 (36.63%), Postives = 253/445 (56.85%), Query Frame = 3
Query:  153 DTMKIFLRFRPL-----NINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK------FSKLSNNPLL----MPVDFAEV--------CQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELS-----DINNNYETTFWISYTEIYNELIYDLLD-PVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLR-IVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVV 1397
            D +K+FLR RPL     +  + +    +     +    P+ S + K+   G  +   KF+F+K+F P++ Q+ V++ T + +++D ++G +RLL+TYG T+SGKT+T+ G  +  G++PRAL ++F       ++ +   P+L      +D  EV          +K+ +S +      +         S   H+ +  E  D   L  N L      D+    + + W+S+ EIYNE +YDLLD P S+ S       KR  L +   ++G  YVK L    V+SAEEA+++L VG+R+Q   ST LN NSSRSH+I TIR +   P    ++++   S CDLAGSER  KAQ +G   KEA+NIN+SLL LGRCI  L++NQ N +    +VP+RDSKLTR+ Q++  G+G++ M+V +N     +DET+Q LKFSA+A ++V
Sbjct:   77 DKLKVFLRIRPLTEAEKDRGEEQGCVNVQSEDNLLLKAPKDSRNMKSAERGVAQSVHKFTFTKIFGPQTSQQEVYDHTIREMVRDVLRGENRLLYTYGVTNSGKTYTIQGAGAEAGLLPRALVSVFLKLSGRLYTAMDLKPVLSQEVRKLDVGEVRAEEMRRDALLKEDESNQSRLRAGLSWDSGISGLSATSHIATQLEDSDGVCLEANGLCLSGGEDLEEGVQFSVWVSFYEIYNEFLYDLLDAPPSLQS------RKRVTLRLSDDKHGNPYVKDLTWIQVHSAEEAWKVLKVGQRNQSFASTHLNHNSSRSHSIFTIRVLHVKPQLGQVTRISELSVCDLAGSERC-KAQQNGERMKEANNINTSLLTLGRCITALRHNQTNKSRPPVVVPFRDSKLTRVLQSFFCGHGRSCMVVNINPCASTYDETLQALKFSAIATQLV 514          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif20a (kinesin family member 20A [Source:ZFIN;Acc:ZDB-GENE-050522-252])

HSP 1 Score: 272.322 bits (695), Expect = 1.328e-76
Identity = 163/445 (36.63%), Postives = 253/445 (56.85%), Query Frame = 3
Query:  153 DTMKIFLRFRPL-----NINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK------FSKLSNNPLL----MPVDFAEV--------CQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELS-----DINNNYETTFWISYTEIYNELIYDLLD-PVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLR-IVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVV 1397
            D +K+FLR RPL     +  + +    +     +    P+ S + K+   G  +   KF+F+K+F P++ Q+ V++ T + +++D ++G +RLL+TYG T+SGKT+T+ G  +  G++PRAL ++F       ++ +   P+L      +D  EV          +K+ +S +      +         S   H+ +  E  D   L  N L      D+    + + W+S+ EIYNE +YDLLD P S+ S       KR  L +   ++G  YVK L    V+SAEEA+++L VG+R+Q   ST LN NSSRSH+I TIR +   P    ++++   S CDLAGSER  KAQ +G   KEA+NIN+SLL LGRCI  L++NQ N +    +VP+RDSKLTR+ Q++  G+G++ M+V +N     +DET+Q LKFSA+A ++V
Sbjct:   77 DKLKVFLRIRPLTEAEKDRGEEQGCVNVQSEDNLLLKAPKDSRNMKSAERGVAQSVHKFTFTKIFGPQTSQQEVYDHTIREMVRDVLRGENRLLYTYGVTNSGKTYTIQGAGAEAGLLPRALVSVFLKLSGRLYTAMDLKPVLSQEVRKLDVGEVRAEEMRRDALLKEDESNQSRLRAGLSWDSGISGLSATSHIATQLEDSDGVCLEANGLCLSGGEDLEEGVQFSVWVSFYEIYNEFLYDLLDAPPSLQS------RKRVTLRLSDDKHGNPYVKDLTWIQVHSAEEAWKVLKVGQRNQSFASTHLNHNSSRSHSIFTIRVLHVKPQLGQVTRISELSVCDLAGSERC-KAQQNGERMKEANNINTSLLTLGRCITALRHNQTNKSRPPVVVPFRDSKLTRVLQSFFCGHGRSCMVVNINPCASTYDETLQALKFSAIATQLV 514          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: zgc:56231 (zgc:56231 [Source:ZFIN;Acc:ZDB-GENE-040426-1914])

HSP 1 Score: 257.684 bits (657), Expect = 4.206e-72
Identity = 182/585 (31.11%), Postives = 306/585 (52.31%), Query Frame = 3
Query:  108 TPLTLFNNNSENAVDDTMKIFLRFRPLNI-----NQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK------FSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXD---------------VLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPV-AVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIRE 1781
            + +T  + N+E      ++++L+ RP ++     N+ +   V+ D  TI    P+ S S K+   G G+   KFSFS++F P  +Q   F  T  + +Q F+ G + L+F+YG T++GKT+T+ G+  + GI+PRAL  LFK      +  +   P L          ++K DS+ +  E++    L      D                   FSN  + D  V S + ++D  + +  + W+++ EIYNE +YDLL P   S        +R  L +     G SY++ L+   V + EE  ++L VG +++   +TK+NQ+SSRSH+I TI+ +R   G++ +  +   S CDLAGSER +K +T G   KEA NIN+SLL LG+CI  L+ NQ        VP+R+SKLTRLFQ    G G+ASMIV +NQ    +DET+ V+KFSA+AK+V+     + + ++ P   G       + G+   +      + E +L GD+ D                       +EL++++E L+ +L+A +++ +  E ++R+++ +   Q IM+ E  +++ ++ ++E
Sbjct:   35 SSITSQSENAEIHEQQQLRVYLKVRPFSVEELKNNEDQGCVVLEDSETIVLHAPKGSASMKSSEKGIGQQVYKFSFSQIFGPNCNQTEFFEGTISSQVQAFLHGKNALVFSYGVTNAGKTYTIQGSPKDPGILPRALEVLFKHIGGRQYEHMDLKPYLSS-------DVQKLDSELVKLERNAKAALFSLLKEDPEPTKLRKRSSTSSINSLSFSNVSY-DHTVDSADGMADEAHCF-YSVWVAFYEIYNEHVYDLLQPAQSSKTK-----RRAALRVCEDSTGSSYIRDLRWVNVQNTEEFSKVLRVGNKNRSAAATKMNQSSSRSHSIFTIKLIRI-EGAD-VQALSELSLCDLAGSERCNKTKTFGDRLKEAGNINNSLLILGKCIAALRNNQ-GFRTKSYVPFRESKLTRLFQGMFCGRGRASMIVNINQCASTYDETLHVMKFSAVAKQVLQVIPPRSLESLAPRIVGLDGKPLLKNGVIDDQAVDDYLSEEELLDGDEAD-----------------MSILPQEELVNLVESLRVKLLAERRKNLLQEIQIRKEMGDAMLQQIMEAEELHSRQMEDLKE 585          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: BX649437.1 (kinesin family member 20Ba [Source:NCBI gene;Acc:449979])

HSP 1 Score: 253.062 bits (645), Expect = 1.685e-68
Identity = 201/584 (34.42%), Postives = 318/584 (54.45%), Query Frame = 3
Query:  159 MKIFLRFRP---LNINQAES-PFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK------FSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLS--NNELSDINNNYETTF--WISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYP-GSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKK-VVLFEKEKPVAVNPS-------------KGGQRLSIYRRLGMKTPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERL----KTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIREENQLLMEKRA 1811
            +K++LR RP   + I   ES  F + + +T+   PP+ S+S +          Q+F FS+V+ P++ Q+ +F+ T   L+++ ++G + L+FTYG T++GKT T  G  +N GI+PR+L  +F       F+++   P     DF  + + ++ +     +    L K S+ + S   H  S  +  D ++LS  N+ + D+  +  T F  W+S+ EIYNE I+DLL+  + S+ S    L R   D++    G S++K LK   V SAEEA +++ +G+R+Q I STKLN  SSRSH+I ++R ++    G   +  V   + CDLAGSER  K Q  G   KEA NIN+SLL+LG+CI+ L+ NQ    +   VP+R+SKLT   Q Y  G G A MIV +NQ   ++DET+ VLKFSA+A+K VVL  K  PV V  S             +  +R S+ R          S  D  E   + D+++    IE      E+E  E     ++L +  +RL    + +L AV+ E +  EA++R+++  ++S+ I QM+ D ++ + R RE    L+E+R 
Sbjct:   44 LKVYLRIRPFSAVEIENGESQTFFLKNCYTVLLKPPQTSLSARLSDKSVPVTAQRFQFSQVYGPDTTQKDIFDGTVNGLVRNVLEGQNSLVFTYGVTNAGKTFTFLGPDTNPGILPRSLNMIFSSLEGRIFTQMCLKPQRCR-DFIRLTKEQQNEEAASKRNLLKLFKESDAQRSISGH-CSKSDIEDGSMLSDVNSAVLDVEMDMHTRFSIWVSFCEIYNENIHDLLEQHA-SNASRKTNL-RLCQDVK----GNSFIKDLKWVQVSSAEEALKVMKLGKRNQSISSTKLNLLSSRSHSIFSVRILKVEDVGIPRVESVSELALCDLAGSERCAKTQNKGERLKEAGNINTSLLSLGKCINALRNNQQARQH---VPFRESKLTHYLQGYFTGRGSACMIVNINQCSSMYDETLNVLKFSAVAQKVVVLTTKNIPVGVKRSAREVSFIINNADCREMRRSSLVRW-------DPSLEDVQEDSDSEDEYEDQSEIEDTLLNSEDECTETVQINKKLYEGQQRLIVNTQQQLTAVQAELLTLEARVRDEVTKEFSELISQMQEDYSERMSRERE----LIEERC 605          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: BX649437.2 (kinesin family member 20Ba [Source:NCBI gene;Acc:449979])

HSP 1 Score: 253.062 bits (645), Expect = 1.685e-68
Identity = 201/584 (34.42%), Postives = 318/584 (54.45%), Query Frame = 3
Query:  159 MKIFLRFRP---LNINQAES-PFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK------FSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLS--NNELSDINNNYETTF--WISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYP-GSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKK-VVLFEKEKPVAVNPS-------------KGGQRLSIYRRLGMKTPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERL----KTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIREENQLLMEKRA 1811
            +K++LR RP   + I   ES  F + + +T+   PP+ S+S +          Q+F FS+V+ P++ Q+ +F+ T   L+++ ++G + L+FTYG T++GKT T  G  +N GI+PR+L  +F       F+++   P     DF  + + ++ +     +    L K S+ + S   H  S  +  D ++LS  N+ + D+  +  T F  W+S+ EIYNE I+DLL+  + S+ S    L R   D++    G S++K LK   V SAEEA +++ +G+R+Q I STKLN  SSRSH+I ++R ++    G   +  V   + CDLAGSER  K Q  G   KEA NIN+SLL+LG+CI+ L+ NQ    +   VP+R+SKLT   Q Y  G G A MIV +NQ   ++DET+ VLKFSA+A+K VVL  K  PV V  S             +  +R S+ R          S  D  E   + D+++    IE      E+E  E     ++L +  +RL    + +L AV+ E +  EA++R+++  ++S+ I QM+ D ++ + R RE    L+E+R 
Sbjct:   44 LKVYLRIRPFSAVEIENGESQTFFLKNCYTVLLKPPQTSLSARLSDKSVPVTAQRFQFSQVYGPDTTQKDIFDGTVNGLVRNVLEGQNSLVFTYGVTNAGKTFTFLGPDTNPGILPRSLNMIFSSLEGRIFTQMCLKPQRCR-DFIRLTKEQQNEEAASKRNLLKLFKESDAQRSISGH-CSKSDIEDGSMLSDVNSAVLDVEMDMHTRFSIWVSFCEIYNENIHDLLEQHA-SNASRKTNL-RLCQDVK----GNSFIKDLKWVQVSSAEEALKVMKLGKRNQSISSTKLNLLSSRSHSIFSVRILKVEDVGIPRVESVSELALCDLAGSERCAKTQNKGERLKEAGNINTSLLSLGKCINALRNNQQARQH---VPFRESKLTHYLQGYFTGRGSACMIVNINQCSSMYDETLNVLKFSAVAQKVVVLTTKNIPVGVKRSAREVSFIINNADCREMRRSSLVRW-------DPSLEDVQEDSDSEDEYEDQSEIEDTLLNSEDECTETVQINKKLYEGQQRLIVNTQQQLTAVQAELLTLEARVRDEVTKEFSELISQMQEDYSERMSRERE----LIEERC 605          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: marveld2 (MARVEL domain containing 2 [Source:Xenbase;Acc:XB-GENE-5839559])

HSP 1 Score: 273.092 bits (697), Expect = 1.641e-77
Identity = 202/576 (35.07%), Postives = 311/576 (53.99%), Query Frame = 3
Query:  150 DDTMKIFLRFRP-----LNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRAL---FN-----LFKFSKLSNNPL---LMPVDFAEVCQ--IKK-------------TDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFV---------------DENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQ 1739
            +D + +++R RP     L   + +    + +  T+    P+ S + KN   G G+   KF+FS++F PE DQ+  F+ T + +++D + G + L++TYG T+SGKT T+ G   + GI+PR++   FN     L+K S L   PL   +M +D  +V Q  +KK             T  ++   E  +    S    S +  + S  +FV               D+ V+S  E +D+    + + W+SY EIYNE +YDLLD +     SG N+ KR  L +   RNG  YVK L    V+SAEEA+++L VGR++Q   ST LNQNSSRSH+I +IR +     ++   K+   SFCDLAGSER  K Q SG   KEA+NIN+SL  LGRCI VL+ NQ       +VP+RDSKLTR+FQ Y  G GK+ MIV +NQ    +DET+  +KFSA+A ++V   +  PV VN               + + ++  K  T   +LA   +  +E  +  +D E EE    +++ +ELL +IE +K  ++  ++EK+  E ++R+++ ++    + Q
Sbjct:   60 NDKVMVYVRIRPFVDGELEKKEDQGCVEVENEETLVLRAPKDSFAMKNTERGLGQSVHKFTFSQLFGPEVDQKQFFDGTMRQVVKDALNGQNWLIYTYGVTNSGKTFTIQGTSKDRGILPRSIALIFNSAQDRLYKSSDL--KPLSNEVMWLDSKQVRQEELKKVSLLSNLREEELMTPLKRSGNESQVRAGTSVSFDSGIGGLSSTSQFVNQTCSQLEETCSRWNDQEVVSLQEAADV----QLSIWVSYYEIYNEFVYDLLDFMP----SGPNR-KRTTLRLCEDRNGNPYVKDLTWINVHSAEEAWKILRVGRKNQSFASTHLNQNSSRSHSIFSIRILHMQGKNDLTPKISELSFCDLAGSERC-KDQRSGDRLKEATNINTSLHTLGRCITVLRQNQQQKLRQNVVPFRDSKLTRIFQAYFTGRGKSCMIVNINQCASTYDETLYAMKFSAIASQLV---QAPPVKVN---------------IPSIQSLIKEST---MLANRSYTDEEDADENSDEESEETDIAKFNREELLQVIENMKELIVKERQEKLNMEIQIRKEVCSEMMDMMQQ 602          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: marveld2 (MARVEL domain containing 2 [Source:Xenbase;Acc:XB-GENE-5839559])

HSP 1 Score: 274.248 bits (700), Expect = 1.862e-77
Identity = 191/537 (35.57%), Postives = 300/537 (55.87%), Query Frame = 3
Query:  150 DDTMKIFLRFRP-----LNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRAL---FN-----LFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSN-GEFVDENV---LSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKL 1709
            +D + +++R RP     L   + +    + +  T+    P+ S + KN   G G+   KF+FS++F PE DQ+  F+ T + +++D + G + L++TYG T+SGKT T+ G   + GI+PR++   FN     L+K S L   PL   V + +  Q+++ + +K+    ++           +  + S    F   ++   +S  E +D+    + + W+SY EIYNE +YDLLD +     SG N+ KR  L +   RNG  YVK L    V+SAEEA+++L VGR++Q   ST LNQNSSRSH+I +IR +     ++   K+   SFCDLAGSER  K Q SG   KEA+NIN+SL  LGRCI VL+ NQ       +VP+RDSKLTR+FQ Y  G GK+ MIV +NQ    +DET+  +KFSA+A ++V   +  PV VN               + + ++  K  T   +LA   +  +E  +  +D E EE    +++ +ELL +IE +K  ++  ++EK+  E ++R+++
Sbjct:   60 NDKVMVYVRIRPFVDGELEKKEDQGCVEVENEETLVLRAPKDSFAMKNTERGLGQSVHKFTFSQLFGPEVDQKQFFDGTMRQVVKDALNGQNWLIYTYGVTNSGKTFTIQGTSKDRGILPRSIALIFNSAQDRLYKSSDL--KPLSNEVMWLDSKQVRQEELKKVSLLSNLREVSISNIYPKLFSVLSTPCAFFYGSIHYLVSLQEAADV----QLSIWVSYYEIYNEFVYDLLDFMP----SGPNR-KRTTLRLCEDRNGNPYVKDLTWINVHSAEEAWKILRVGRKNQSFASTHLNQNSSRSHSIFSIRILHMQGKNDLTPKISELSFCDLAGSERC-KDQRSGDRLKEATNINTSLHTLGRCITVLRQNQQQKLRQNVVPFRDSKLTRIFQAYFTGRGKSCMIVNINQCASTYDETLYAMKFSAIASQLV---QAPPVKVN---------------IPSIQSLIKEST---MLANRSYTDEEDADENSDEESEETDIAKFNREELLQVIENMKELIVKERQEKLNMEIQIRKEV 563          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: marveld2 (MARVEL domain containing 2 [Source:Xenbase;Acc:XB-GENE-5839559])

HSP 1 Score: 273.478 bits (698), Expect = 2.323e-77
Identity = 201/569 (35.33%), Postives = 309/569 (54.31%), Query Frame = 3
Query:  150 DDTMKIFLRFRP-----LNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRAL---FN-----LFKFSKLSNNPL---LMPVDFAEVCQ--IKK-------------TDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFV---------------DENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNND 1718
            +D + +++R RP     L   + +    + +  T+    P+ S + KN   G G+   KF+FS++F PE DQ+  F+ T + +++D + G + L++TYG T+SGKT T+ G   + GI+PR++   FN     L+K S L   PL   +M +D  +V Q  +KK             T  ++   E  +    S    S +  + S  +FV               D+ V+S  E +D+    + + W+SY EIYNE +YDLLD +     SG N+ KR  L +   RNG  YVK L    V+SAEEA+++L VGR++Q   ST LNQNSSRSH+I +IR +     ++   K+   SFCDLAGSER  K Q SG   KEA+NIN+SL  LGRCI VL+ NQ       +VP+RDSKLTR+FQ Y  G GK+ MIV +NQ    +DET+  +KFSA+A ++V   +  PV VN               + + ++  K  T   +LA   +  +E  +  +D E EE    +++ +ELL +IE +K  ++  ++EK+  E ++R+++ ++
Sbjct:   56 NDKVMVYVRIRPFVDGELEKKEDQGCVEVENEETLVLRAPKDSFAMKNTERGLGQSVHKFTFSQLFGPEVDQKQFFDGTMRQVVKDALNGQNWLIYTYGVTNSGKTFTIQGTSKDRGILPRSIALIFNSAQDRLYKSSDL--KPLSNEVMWLDSKQVRQEELKKVSLLSNLREEELMTPLKRSGNESQVRAGTSVSFDSGIGGLSSTSQFVNQTCSQLEETCSRWNDQEVVSLQEAADV----QLSIWVSYYEIYNEFVYDLLDFMP----SGPNR-KRTTLRLCEDRNGNPYVKDLTWINVHSAEEAWKILRVGRKNQSFASTHLNQNSSRSHSIFSIRILHMQGKNDLTPKISELSFCDLAGSERC-KDQRSGDRLKEATNINTSLHTLGRCITVLRQNQQQKLRQNVVPFRDSKLTRIFQAYFTGRGKSCMIVNINQCASTYDETLYAMKFSAIASQLV---QAPPVKVN---------------IPSIQSLIKEST---MLANRSYTDEEDADENSDEESEETDIAKFNREELLQVIENMKELIVKERQEKLNMEIQIRKEVCSE 591          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: marveld2 (MARVEL domain containing 2 [Source:Xenbase;Acc:XB-GENE-5839559])

HSP 1 Score: 272.322 bits (695), Expect = 4.077e-77
Identity = 201/566 (35.51%), Postives = 307/566 (54.24%), Query Frame = 3
Query:  150 DDTMKIFLRFRP-----LNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRAL---FN-----LFKFSKLSNNPL---LMPVDFAEVCQ--IKK-------------TDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFV---------------DENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKL 1709
            +D + +++R RP     L   + +    + +  T+    P+ S + KN   G G+   KF+FS++F PE DQ+  F+ T + +++D + G + L++TYG T+SGKT T+ G   + GI+PR++   FN     L+K S L   PL   +M +D  +V Q  +KK             T  ++   E  +    S    S +  + S  +FV               D+ V+S  E +D+    + + W+SY EIYNE +YDLLD +     SG N+ KR  L +   RNG  YVK L    V+SAEEA+++L VGR++Q   ST LNQNSSRSH+I +IR +     ++   K+   SFCDLAGSER  K Q SG   KEA+NIN+SL  LGRCI VL+ NQ       +VP+RDSKLTR+FQ Y  G GK+ MIV +NQ    +DET+  +KFSA+A ++V   +  PV VN               + + ++  K  T   +LA   +  +E  +  +D E EE    +++ +ELL +IE +K  ++  ++EK+  E ++R+++
Sbjct:   60 NDKVMVYVRIRPFVDGELEKKEDQGCVEVENEETLVLRAPKDSFAMKNTERGLGQSVHKFTFSQLFGPEVDQKQFFDGTMRQVVKDALNGQNWLIYTYGVTNSGKTFTIQGTSKDRGILPRSIALIFNSAQDRLYKSSDL--KPLSNEVMWLDSKQVRQEELKKVSLLSNLREEELMTPLKRSGNESQVRAGTSVSFDSGIGGLSSTSQFVNQTCSQLEETCSRWNDQEVVSLQEAADV----QLSIWVSYYEIYNEFVYDLLDFMP----SGPNR-KRTTLRLCEDRNGNPYVKDLTWINVHSAEEAWKILRVGRKNQSFASTHLNQNSSRSHSIFSIRILHMQGKNDLTPKISELSFCDLAGSERC-KDQRSGDRLKEATNINTSLHTLGRCITVLRQNQQQKLRQNVVPFRDSKLTRIFQAYFTGRGKSCMIVNINQCASTYDETLYAMKFSAIASQLV---QAPPVKVN---------------IPSIQSLIKEST---MLANRSYTDEEDADENSDEESEETDIAKFNREELLQVIENMKELIVKERQEKLNMEIQIRKEV 592          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: marveld2 (MARVEL domain containing 2 [Source:Xenbase;Acc:XB-GENE-5839559])

HSP 1 Score: 273.863 bits (699), Expect = 4.292e-77
Identity = 201/566 (35.51%), Postives = 307/566 (54.24%), Query Frame = 3
Query:  150 DDTMKIFLRFRP-----LNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRAL---FN-----LFKFSKLSNNPL---LMPVDFAEVCQ--IKK-------------TDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFV---------------DENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKL 1709
            +D + +++R RP     L   + +    + +  T+    P+ S + KN   G G+   KF+FS++F PE DQ+  F+ T + +++D + G + L++TYG T+SGKT T+ G   + GI+PR++   FN     L+K S L   PL   +M +D  +V Q  +KK             T  ++   E  +    S    S +  + S  +FV               D+ V+S  E +D+    + + W+SY EIYNE +YDLLD +     SG N+ KR  L +   RNG  YVK L    V+SAEEA+++L VGR++Q   ST LNQNSSRSH+I +IR +     ++   K+   SFCDLAGSER  K Q SG   KEA+NIN+SL  LGRCI VL+ NQ       +VP+RDSKLTR+FQ Y  G GK+ MIV +NQ    +DET+  +KFSA+A ++V   +  PV VN               + + ++  K  T   +LA   +  +E  +  +D E EE    +++ +ELL +IE +K  ++  ++EK+  E ++R+++
Sbjct:   60 NDKVMVYVRIRPFVDGELEKKEDQGCVEVENEETLVLRAPKDSFAMKNTERGLGQSVHKFTFSQLFGPEVDQKQFFDGTMRQVVKDALNGQNWLIYTYGVTNSGKTFTIQGTSKDRGILPRSIALIFNSAQDRLYKSSDL--KPLSNEVMWLDSKQVRQEELKKVSLLSNLREEELMTPLKRSGNESQVRAGTSVSFDSGIGGLSSTSQFVNQTCSQLEETCSRWNDQEVVSLQEAADV----QLSIWVSYYEIYNEFVYDLLDFMP----SGPNR-KRTTLRLCEDRNGNPYVKDLTWINVHSAEEAWKILRVGRKNQSFASTHLNQNSSRSHSIFSIRILHMQGKNDLTPKISELSFCDLAGSERC-KDQRSGDRLKEATNINTSLHTLGRCITVLRQNQQQKLRQNVVPFRDSKLTRIFQAYFTGRGKSCMIVNINQCASTYDETLYAMKFSAIASQLV---QAPPVKVN---------------IPSIQSLIKEST---MLANRSYTDEEDADENSDEESEETDIAKFNREELLQVIENMKELIVKERQEKLNMEIQIRKEV 592          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif20b (kinesin family member 20B [Source:MGI Symbol;Acc:MGI:2444576])

HSP 1 Score: 260.766 bits (665), Expect = 6.119e-71
Identity = 214/592 (36.15%), Postives = 318/592 (53.72%), Query Frame = 3
Query:  159 MKIFLRFRPLNI----NQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK------FSKLSNNP------LLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVL--HM---FSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEY--LSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFE-----KEKPVAVNPSKGGQRLSIYRRLGMK----TPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDA--------------QELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQ---HIQRIREEN 1787
            +++ LR RP       ++AE    + D  ++    P QS+        +G+  QKFSFSKVF PE+ Q+  F       ++D ++G+ RL+FTYG T+SGKT+T  G + N+GI+PR L  LF       ++K+S  P      L +  D     Q K+  + K    + I       +S DVL  H+    +  EF +E+V S ++ S   +N + + W+S+ EIYNE IYDL  PVS  S     K+ R   DI+    G S++K L+   V  ++EAYRLL +G + Q +  TKLN  SSRSH+I TIR ++    SE   +++V   S CDLAGSER+ K Q  G   +EA NIN+SLL LG+CI+VLK ++   + ++ VP+R+SKLT  FQ++  G GK  MI+ ++Q    +DET+ VLKFS  A++V + +     +EK  A N  K  Q +S+   L  K      KT S  +++E +L  +D   D      T   E E  +E+ D               +ELLD+IE+L   LI   KEK+  E K+RE++  +++Q   Q E D  +   H + I EEN
Sbjct:   59 LQVCLRIRPFTQSEKEHEAEGCVQVLDSQSVLLKDP-QSILGHLSEKSSGQVAQKFSFSKVFGPETSQKEFFLGCIMQPVKDLLEGHSRLIFTYGLTNSGKTYTFQGTEENIGILPRTLNVLFDSLQERLYTKMSFKPHRCREYLKLSSD-----QEKEESANKNTLLRQIKEVTIHNDSYDVLCGHLTNSLTIPEF-EESVNSCDQSSLNVDNIKYSVWVSFFEIYNESIYDLFVPVS--SKFQKRKMLRLSQDIK----GYSFIKDLQWVQVSDSKEAYRLLKLGVKHQSVAFTKLNNASSRSHSIFTIRILQ-IEDSEIPRVTRVSELSLCDLAGSERSMKTQNEGERLREAGNINTSLLTLGKCINVLKNSE--KSKVQHVPFRESKLTHYFQSFFTGKGKICMIINISQSCSAYDETLNVLKFSTTAQRVYVPDTLSSSQEKSFASN--KSLQDVSLDSNLDNKILNVKRKTVSWENSLEDVLENEDLVEDLEENEETQNMETELTDEDSDKSLEECRVSTCHKKNKELLDLIEKLNKRLINENKEKLTLELKIREEVTQEFTQYWSQREADFKETLLHEREILEEN 632          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif20b (kinesin family member 20B [Source:MGI Symbol;Acc:MGI:2444576])

HSP 1 Score: 260.766 bits (665), Expect = 7.740e-71
Identity = 214/592 (36.15%), Postives = 318/592 (53.72%), Query Frame = 3
Query:  159 MKIFLRFRPLNI----NQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK------FSKLSNNP------LLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVL--HM---FSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEY--LSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFE-----KEKPVAVNPSKGGQRLSIYRRLGMK----TPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDA--------------QELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQ---HIQRIREEN 1787
            +++ LR RP       ++AE    + D  ++    P QS+        +G+  QKFSFSKVF PE+ Q+  F       ++D ++G+ RL+FTYG T+SGKT+T  G + N+GI+PR L  LF       ++K+S  P      L +  D     Q K+  + K    + I       +S DVL  H+    +  EF +E+V S ++ S   +N + + W+S+ EIYNE IYDL  PVS  S     K+ R   DI+    G S++K L+   V  ++EAYRLL +G + Q +  TKLN  SSRSH+I TIR ++    SE   +++V   S CDLAGSER+ K Q  G   +EA NIN+SLL LG+CI+VLK ++   + ++ VP+R+SKLT  FQ++  G GK  MI+ ++Q    +DET+ VLKFS  A++V + +     +EK  A N  K  Q +S+   L  K      KT S  +++E +L  +D   D      T   E E  +E+ D               +ELLD+IE+L   LI   KEK+  E K+RE++  +++Q   Q E D  +   H + I EEN
Sbjct:   59 LQVCLRIRPFTQSEKEHEAEGCVQVLDSQSVLLKDP-QSILGHLSEKSSGQVAQKFSFSKVFGPETSQKEFFLGCIMQPVKDLLEGHSRLIFTYGLTNSGKTYTFQGTEENIGILPRTLNVLFDSLQERLYTKMSFKPHRCREYLKLSSD-----QEKEESANKNTLLRQIKEVTIHNDSYDVLCGHLTNSLTIPEF-EESVNSCDQSSLNVDNIKYSVWVSFFEIYNESIYDLFVPVS--SKFQKRKMLRLSQDIK----GYSFIKDLQWVQVSDSKEAYRLLKLGVKHQSVAFTKLNNASSRSHSIFTIRILQ-IEDSEIPRVTRVSELSLCDLAGSERSMKTQNEGERLREAGNINTSLLTLGKCINVLKNSE--KSKVQHVPFRESKLTHYFQSFFTGKGKICMIINISQSCSAYDETLNVLKFSTTAQRVYVPDTLSSSQEKSFASN--KSLQDVSLDSNLDNKILNVKRKTVSWENSLEDVLENEDLVEDLEENEETQNMETELTDEDSDKSLEECRVSTCHKKNKELLDLIEKLNKRLINENKEKLTLELKIREEVTQEFTQYWSQREADFKETLLHEREILEEN 632          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif23 (kinesin family member 23 [Source:MGI Symbol;Acc:MGI:1919069])

HSP 1 Score: 204.142 bits (518), Expect = 1.372e-55
Identity = 145/465 (31.18%), Postives = 233/465 (50.11%), Query Frame = 3
Query:  120 LFNNNSENAVDDTMKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK-----------FSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDE-NVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGN-NKLKRPILD----------IRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRT---YPGSEYLSK-----VCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPV 1421
            +    S+  + D + ++ R RPL+    E    + +  T+    PE    Y+   +G+ K  Q +SF +VF   + Q+ +F+  +  L+ D I G + LLFTYG T SGKT+TM G+  + G++PR L  +F            F     N + +  +   + + +K ++  + K  S   +             ++ EF D  NV    +  +++ +     ++SY EIYN  IYDLL+ V    I    N    P+ +          +R  +N   YV G     V S EEA+ +   G++ + I +T LN+ SSRSH++ +I+ V+      G   L +     +   S  DLAGSERT++ +  G   +EA NIN SL+ L  C++VL+ NQ    N ++VPYRDSKLT LF+ Y  G GK  MIVCVN     ++E++QV++F+ + ++V   E  +PV
Sbjct:   13 VIKKGSQTNLKDPVGVYCRVRPLSFPDQECCVEVINSTTLQLHTPE---GYRLNRNGDYKETQ-YSFKRVFGTHTTQKELFDVVANPLVDDLIHGKNGLLFTYGVTGSGKTYTMTGSPGSGGLLPRCLNMIFNSIGSFQAKRYVFKSNDRNSMEIQCEVDALLERQKREALPIPKTPSSKRQ-------------ADPEFADMINVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVQFDPIKPKWNGCSTPMRNAESVLPQSKTLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFSIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTKAEGNRLREAGNINQSLMTLRTCMEVLRENQTYGTN-KMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEESLQVMRFAEVTQEV---EVARPV 456          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif23 (kinesin family member 23 [Source:MGI Symbol;Acc:MGI:1919069])

HSP 1 Score: 207.994 bits (528), Expect = 9.884e-55
Identity = 146/455 (32.09%), Postives = 232/455 (50.99%), Query Frame = 3
Query:  120 LFNNNSENAVDDTMKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK-----------FSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDE-NVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRP-ILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRT---YPGSEYLSK-----VCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPV 1421
            +    S+  + D + ++ R RPL+    E    + +  T+    PE    Y+   +G+ K  Q +SF +VF   + Q+ +F+  +  L+ D I G + LLFTYG T SGKT+TM G+  + G++PR L  +F            F     N + +  +   + + +K ++  + K  S   +             ++ EF D  NV    +  +++ +     ++SY EIYN  IYDLL+ V    I    K K P    +R  +N   YV G     V S EEA+ +   G++ + I +T LN+ SSRSH++ +I+ V+      G   L +     +   S  DLAGSERT++ +  G   +EA NIN SL+ L  C++VL+ NQ    N ++VPYRDSKLT LF+ Y  G GK  MIVCVN     ++E++QV++F+ + ++V   E  +PV
Sbjct:   13 VIKKGSQTNLKDPVGVYCRVRPLSFPDQECCVEVINSTTLQLHTPE---GYRLNRNGDYKETQ-YSFKRVFGTHTTQKELFDVVANPLVDDLIHGKNGLLFTYGVTGSGKTYTMTGSPGSGGLLPRCLNMIFNSIGSFQAKRYVFKSNDRNSMEIQCEVDALLERQKREALPIPKTPSSKRQ-------------ADPEFADMINVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVQFDPI----KPKLPQSKTLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFSIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTKAEGNRLREAGNINQSLMTLRTCMEVLRENQTYGTN-KMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEESLQVMRFAEVTQEV---EVARPV 442          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif20a (kinesin family member 20A [Source:MGI Symbol;Acc:MGI:1201682])

HSP 1 Score: 204.142 bits (518), Expect = 1.077e-53
Identity = 132/359 (36.77%), Postives = 195/359 (54.32%), Query Frame = 3
Query:  747 TFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTA---SKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIREENQLLMEKRAR 1814
            + WIS+ EIYNEL+YDLL+P S       ++ KR  L +   +NG  YVK L    V   EEA++LL VGR++Q   ST +NQ SSRSH+I +IR +      + + K+   S CDLAGSER  K Q SG   KEA NIN+SL  LGRCI  L+ NQ N +   ++P+RDSKLTR+FQ +  G G++ MIV VN     +DET+   KFSALA ++V      PV +         S++  +   +P+      K D  +S L     D                    Y  +ELL ++E +K  L+  ++EK+  E +LRE++ N+  + + Q E+  ++ +   +E  + L E++ +
Sbjct:  299 SVWISFFEIYNELLYDLLEPPS-------HQHKRQTLRLCEDQNGNPYVKDLNWIHVRDVEEAWKLLKVGRKNQSFASTHMNQQSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERC-KHQKSGERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLIPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCASTYDETLHAAKFSALASQLV---HAPPVHLGIP------SLHSFIKKHSPQVGPGLEKEDKADSDLEDSPEDE--------------ADVSVYGKEELLQVVEAMKALLLKERQEKLQLEIQLREEICNEMVEQMQQREQWCSERLDNQKELMEELYEEKLK 626          

HSP 2 Score: 89.3521 bits (220), Expect = 1.743e-17
Identity = 50/147 (34.01%), Postives = 84/147 (57.14%), Query Frame = 3
Query:  153 DTMKIFLRFRPL---NINQAESPFVIC--DPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKF--SKLSNNPLLMPVDFAEV 572
            + +K++LR RP     +++ E    +C  +  T+    P+ S + K+   G G+   KF+FS++F PE  Q   FN T K +++D +KG + L++TYG T+SGKT+T+ G   + GI+P++L  +F     +L   P L P+   EV
Sbjct:   62 EKVKVYLRIRPFLTSELDRQEDQGCVCIENTETLVLQAPKDSFALKSNERGVGQATHKFTFSQIFGPEVGQVAFFNLTMKEMVKDVLKGQNWLIYTYGVTNSGKTYTIQGTSKDAGILPQSLALIFNSLQGQLHPTPDLKPLLSNEV 208          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q80WE4|KI20B_MOUSE (Kinesin-like protein KIF20B OS=Mus musculus OX=10090 GN=Kif20b PE=1 SV=3)

HSP 1 Score: 260.766 bits (665), Expect = 4.280e-70
Identity = 214/592 (36.15%), Postives = 318/592 (53.72%), Query Frame = 3
Query:  159 MKIFLRFRPLNI----NQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK------FSKLSNNP------LLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVL--HM---FSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEY--LSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFE-----KEKPVAVNPSKGGQRLSIYRRLGMK----TPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDA--------------QELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQ---HIQRIREEN 1787
            +++ LR RP       ++AE    + D  ++    P QS+        +G+  QKFSFSKVF PE+ Q+  F       ++D ++G+ RL+FTYG T+SGKT+T  G + N+GI+PR L  LF       ++K+S  P      L +  D     Q K+  + K    + I       +S DVL  H+    +  EF +E+V S ++ S   +N + + W+S+ EIYNE IYDL  PVS  S     K+ R   DI+    G S++K L+   V  ++EAYRLL +G + Q +  TKLN  SSRSH+I TIR ++    SE   +++V   S CDLAGSER+ K Q  G   +EA NIN+SLL LG+CI+VLK ++   + ++ VP+R+SKLT  FQ++  G GK  MI+ ++Q    +DET+ VLKFS  A++V + +     +EK  A N  K  Q +S+   L  K      KT S  +++E +L  +D   D      T   E E  +E+ D               +ELLD+IE+L   LI   KEK+  E K+RE++  +++Q   Q E D  +   H + I EEN
Sbjct:   59 LQVCLRIRPFTQSEKEHEAEGCVQVLDSQSVLLKDP-QSILGHLSEKSSGQVAQKFSFSKVFGPETSQKEFFLGCIMQPVKDLLEGHSRLIFTYGLTNSGKTYTFQGTEENIGILPRTLNVLFDSLQERLYTKMSFKPHRCREYLKLSSD-----QEKEESANKNTLLRQIKEVTIHNDSYDVLCGHLTNSLTIPEF-EESVNSCDQSSLNVDNIKYSVWVSFFEIYNESIYDLFVPVS--SKFQKRKMLRLSQDIK----GYSFIKDLQWVQVSDSKEAYRLLKLGVKHQSVAFTKLNNASSRSHSIFTIRILQ-IEDSEIPRVTRVSELSLCDLAGSERSMKTQNEGERLREAGNINTSLLTLGKCINVLKNSE--KSKVQHVPFRESKLTHYFQSFFTGKGKICMIINISQSCSAYDETLNVLKFSTTAQRVYVPDTLSSSQEKSFASN--KSLQDVSLDSNLDNKILNVKRKTVSWENSLEDVLENEDLVEDLEENEETQNMETELTDEDSDKSLEECRVSTCHKKNKELLDLIEKLNKRLINENKEKLTLELKIREEVTQEFTQYWSQREADFKETLLHEREILEEN 632          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q96Q89|KI20B_HUMAN (Kinesin-like protein KIF20B OS=Homo sapiens OX=9606 GN=KIF20B PE=1 SV=3)

HSP 1 Score: 247.284 bits (630), Expect = 1.071e-65
Identity = 195/596 (32.72%), Postives = 302/596 (50.67%), Query Frame = 3
Query:  153 DTMKIFLRFRPLNINQ----AESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK------FSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXD------VLHMFSNGEFVDENVLSNNELSDIN--NNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGS-EYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVN--------PSKGGQRLSI-----YRRLGMKTP---------------------KTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIRE 1781
            D +++ LR RP   ++    +E    I D  T+    P Q +  +     +G+  QKFSFSKVF P + Q+  F       ++D +KG  RL+FTYG T+SGKT+T  G + N+GI+PR L  LF       ++K++  P           + +K +          + +++    SD      + +  +  EF  E  + + E +++N  N+ + + W+S+ EIYNE IYDL  PVS      +   KR +L +     G S++K L+   V  ++EAYRLL +G + Q +  TKLN  SSRSH+I T++ ++        + +V   S CDLAGSERT K Q  G   +E  NIN+SLL LG+CI+VLK N       + VP+R+SKLT  FQ++  G GK  MIV ++Q    +DET+ VLKFSA+A+KV +     P  +N        P K  Q +S+      + L +K                       + A +   +E+ L  +D D           EE + +    + ++LLD+IE LK +LI  KKEK+  E K+RE++  +++Q   Q E D  + + + RE
Sbjct:   57 DYLQVCLRIRPFTQSEKELESEGCVHILDSQTVVLKEP-QCILGRLSEKSSGQMAQKFSFSKVFGPATTQKEFFQGCIMQPVKDLLKGQSRLIFTYGLTNSGKTYTFQGTEENIGILPRTLNVLFDSLQERLYTKMNLKPHRSREYLRLSSEQEKEEIASKSALLRQIKEVTVHNDSDDTLYGSLTNSLNISEF--EESIKDYEQANLNMANSIKFSVWVSFFEIYNEYIYDLFVPVS------SKFQKRKMLRLSQDVKGYSFIKDLQWIQVSDSKEAYRLLKLGIKHQSVAFTKLNNASSRSHSIFTVKILQIEDSEMSRVIRVSELSLCDLAGSERTMKTQNEGERLRETGNINTSLLTLGKCINVLK-NSEKSKFQQHVPFRESKLTHYFQSFFNGKGKICMIVNISQCYLAYDETLNVLKFSAIAQKVCV-----PDTLNSSQEKLFGPVKSSQDVSLDSNSNSKILNVKRATISWENSLEDLMEDEDLVEELENAEETQNVETKLLDEDLDK--------TLEENKAFISHEEKRKLLDLIEDLKKKLINEKKEKLTLEFKIREEVTQEFTQYWAQREADFKETLLQERE 629          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q29RT6|KI20A_BOVIN (Kinesin-like protein KIF20A OS=Bos taurus OX=9913 GN=KIF20A PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.535e-55
Identity = 135/345 (39.13%), Postives = 193/345 (55.94%), Query Frame = 3
Query:  747 TFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIRE 1781
            + WIS+ EIYNEL+YDLL+P S        + KR  L +   +NG  YVK L    V  AEEA++LL VGR++Q   ST LNQNSSRSH+I +IR +      + + K+   S CDLAGSER  K Q SG   KEA NIN+SL  LGRCI  L+ NQ N +   +VP+RDSKLTR+FQ +  G G++ MIV VN     +DET+ V KFSA+A ++V      PV +        L  +      + +T +K D       GDD ++             E     Y  +ELL ++E +K  L+  ++EK+  E +LR+++ N+  + + Q E+  ++H+   +E
Sbjct:  299 SIWISFFEIYNELLYDLLEPPS-------QQRKRQTLRLCEDQNGNPYVKDLNWIHVQDAEEAWKLLKVGRKNQSFASTHLNQNSSRSHSIFSIRILHLQGEGDIIPKISELSLCDLAGSERC-KDQKSGERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLVPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCASTYDETLHVAKFSAIASQLV---HAPPVQLGFPSIHSFLKEHSLRASPSLETGAKTDPG----LGDDIEN-------------EVDISTYGKEELLQVVEAMKALLLKERQEKLRLEVQLRDEICNEMVEQMQQREQWCSEHLDTQKE 615          

HSP 2 Score: 89.3521 bits (220), Expect = 1.231e-16
Identity = 51/147 (34.69%), Postives = 85/147 (57.82%), Query Frame = 3
Query:  153 DTMKIFLRFRPL---NINQAESPFVIC--DPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKF--SKLSNNPLLMPVDFAEV 572
            + +K++LR RPL    + + E    +C  +  T++   P+ S + K+   G G+   +F+FS++F PE  Q   FN T K +++D +KG + L++TYG T+SGKT+T+ G   + GI+PR+L  +F     +L   P L P+   EV
Sbjct:   62 EKVKVYLRVRPLLPSELERQEDQGCVCIENMETLALQAPKDSFAQKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTYTIQGTIKDGGILPRSLALIFNSLQGQLHPTPNLKPLFSNEV 208          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q02241|KIF23_HUMAN (Kinesin-like protein KIF23 OS=Homo sapiens OX=9606 GN=KIF23 PE=1 SV=3)

HSP 1 Score: 211.846 bits (538), Expect = 4.275e-55
Identity = 151/462 (32.68%), Postives = 231/462 (50.00%), Query Frame = 3
Query:  102 AETPL-TLFNNNSENAVDDTMKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK-----------FSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDV-LHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDI-RIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRT---YPGSEYLSK-----VCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPV 1421
            A+TP        S+  + D + ++ R RPL     E    + +  T+    PE    Y+   +G+ K  Q +SF +VF   + Q+ +F+  +  L+ D I G + LLFTYG T SGKTHTM G+    G++PR L  +F            F     N + +  +   + + +K ++    K  S   ++  + +  + +  F   E VDE+ +                ++SY EIYN  IYDLL+ V    I    K K P   + R  +N   YV G     V S EEA+ +   G++ + I +T LN+ SSRSH++  I+ V+      G   L +     +   S  DLAGSERT++ +  G   +EA NIN SL+ L  C+DVL+ NQ+   N ++VPYRDSKLT LF+ Y  G GK  MIVCVN     ++E +QV++F+ + ++V   E  +PV
Sbjct:    6 AKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPE---GYRLNRNGDYKETQ-YSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMPNPKTSSSKRQVDPEFADMITVQEFCKAEEVDEDSVYG-------------VFVSYIEIYNNYIYDLLEEVPFDPI----KPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTN-KMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEV---EVARPV 442          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|O95235|KI20A_HUMAN (Kinesin-like protein KIF20A OS=Homo sapiens OX=9606 GN=KIF20A PE=1 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 7.553e-55
Identity = 141/365 (38.63%), Postives = 196/365 (53.70%), Query Frame = 3
Query:  726 INNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVL-------------FEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIRE 1781
            +  N   + WIS+ EIYNEL+YDLL+P S        + KR  L +   +NG  YVK L    V  AEEA++LL VGR++Q   ST LNQNSSRSH+I +IR +      + + K+   S CDLAGSER  K Q SG   KEA NIN+SL  LGRCI  L+ NQ N +   +VP+RDSKLTR+FQ +  G G++ MIV VN     +DET+ V KFSA+A ++V              F KE  + V+PS                 +  +K DT      G D D            E E     Y  +ELL ++E +KT L+  ++EK+  E  LR+++ N+  + + Q E+  ++H+   +E
Sbjct:  293 VPANIRFSIWISFFEIYNELLYDLLEPPS-------QQRKRQTLRLCEDQNGNPYVKDLNWIHVQDAEEAWKLLKVGRKNQSFASTHLNQNSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERC-KDQKSGERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLVPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCASTYDETLHVAKFSAIASQLVHAPPMQLGFPSLHSFIKEHSLQVSPSL----------------EKGAKADT------GLDDD-----------IENEADISMYGKEELLQVVEAMKTLLLKERQEKLQLEMHLRDEICNEMVEQMQQREQWCSEHLDTQKE 616          

HSP 2 Score: 88.1965 bits (217), Expect = 2.775e-16
Identity = 54/153 (35.29%), Postives = 88/153 (57.52%), Query Frame = 3
Query:  135 SENAVDDTMKIFLRFRPLNINQAE-----SPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKF--SKLSNNPLLMPVDFAEV 572
            SE++++  +K++LR RPL  ++ E         I +  T+    P+ S + K+   G G+   +F+FS++F PE  Q   FN T K +++D +KG + L++TYG T+SGKTHT+ G   + GI+PR+L  +F     +L   P L P+   EV
Sbjct:   58 SEDSMEK-VKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEV 209          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A1S8WZH9 (Kinesin motor domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_04303 PE=3 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 3.587e-92
Identity = 196/469 (41.79%), Postives = 281/469 (59.91%), Query Frame = 3
Query:  159 MKIFLRFRPLNINQ--AESPFVIC-DPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNG--EFVDENVLS---------------NNELSDINNNYETTFWISYTEIYNELIYDLLDPV-SISSISGNNK-------------------------------LKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGS-EYLSKVCNFSFCDLAGSERTDKAQTSG--LMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVL 1400
            MK++LR +PL      + +P V C +   + A PP+     + L   + K    F+FS VF  ES Q  VF+  +   +++F++G + LLF YGTTSSGKT+T+ G   ++GI+PR    LF+  K + NP LMP DF++V  +   + +K+L++K+ ++KLS   S DVL++       FV   VL                ++E    NN+    FWIS+ E+YNEL+YDLLDPV  +S+IS   +                               L++  LD+R  +NG  ++KGL+ YPV SAEEA RL+LVGR+ Q + +T+LN  SSRSH+ILTI+AVR         +++ + +FCDLAGSERT+KA T G  +  +EA NIN+SLL LGRCI+ L+YNQ +P N ++VPYRDSKLTRLFQ++  G GKA MIV V+  P LFDET+  L+FSALA ++++
Sbjct:   37 MKVYLRLKPLKRCHTYSPTPAVRCVNRRMVEAVPPDN----QRLGVRDKKASHTFTFSHVFDSESTQSSVFSRVAVDQVRNFLEGLNGLLFAYGTTSSGKTYTLQGPLGDMGIVPRTFCALFRSVKHTMNPSLMPKDFSDVTALSAHEVEKVLRDKATVIKLSSSLSEDVLNLEKESLDSFVSTCVLDEPQPDLEMTQFPGMDSSERIRFNNDLRFAFWISFAEVYNELVYDLLDPVYCVSTISAAQQPNSLRSCLTAVPQKNVFSTIPPTGATEFSANLRKKALDLRTDKNGNVFIKGLRIYPVSSAEEALRLVLVGRQCQKVAATRLNLASSRSHSILTIKAVRVVDKENPKFARISSLTFCDLAGSERTEKAATGGQAVRVREAGNINTSLLTLGRCIECLRYNQAHPENPKLVPYRDSKLTRLFQSFFTGRGKACMIVNVSPHPELFDETLHALRFSALATRIIV 501          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A074Z023 (Kinesin motor domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_11145 PE=3 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 3.764e-92
Identity = 196/469 (41.79%), Postives = 281/469 (59.91%), Query Frame = 3
Query:  159 MKIFLRFRPLNINQ--AESPFVIC-DPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNG--EFVDENVLS---------------NNELSDINNNYETTFWISYTEIYNELIYDLLDPV-SISSISGNNK-------------------------------LKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGS-EYLSKVCNFSFCDLAGSERTDKAQTSG--LMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVL 1400
            MK++LR +PL      + +P V C +   + A PP+     + L   + K    F+FS VF  ES Q  VF+  +   +++F++G + LLF YGTTSSGKT+T+ G   ++GI+PR    LF+  K + NP LMP DF++V  +   + +K+L++K+ ++KLS   S DVL++       FV   VL                ++E    NN+    FWIS+ E+YNEL+YDLLDPV  +S+IS   +                               L++  LD+R  +NG  ++KGL+ YPV SAEEA RL+LVGR+ Q + +T+LN  SSRSH+ILTI+AVR         +++ + +FCDLAGSERT+KA T G  +  +EA NIN+SLL LGRCI+ L+YNQ +P N ++VPYRDSKLTRLFQ++  G GKA MIV V+  P LFDET+  L+FSALA ++++
Sbjct:   37 MKVYLRLKPLKRCHTYSPTPAVRCVNRRMVEAVPPDN----QRLGVRDKKASHTFTFSHVFDSESTQSSVFSRVAVDQVRNFLEGLNGLLFAYGTTSSGKTYTLQGPLGDMGIVPRTFCALFRSVKHTMNPSLMPKDFSDVTALSAHEVEKVLRDKATVIKLSSSLSEDVLNLEKESLDSFVSTCVLDEPQPDLEVTPFPGMDSSERIRFNNDLRFAFWISFAEVYNELVYDLLDPVYCVSTISAAQQPNSLRSCLTAVPQKNIFSTIPPTGATEFSANLRKKALDLRTDKNGNVFIKGLRIYPVSSAEEALRLVLVGRQCQKVAATRLNLASSRSHSILTIKAVRVVDKENPKFARISSLTFCDLAGSERTEKAATGGQAVRVREAGNINTSLLTLGRCIECLRYNQAHPENPKLVPYRDSKLTRLFQSFFTGRGKACMIVNVSPHPELFDETLHALRFSALATRIIV 501          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A3R7JSB1 (Kinesin-like protein KIF20A (Fragment) OS=Clonorchis sinensis OX=79923 GN=KIF20A PE=3 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 4.084e-92
Identity = 198/473 (41.86%), Postives = 282/473 (59.62%), Query Frame = 3
Query:  147 VDDTMKIFLRFRPLNINQAESP--FVIC-DPFTISATPPE-QSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMF--SNGEFVDENVLSN---------------NELSDINNNYETTFWISYTEIYNELIYDLLDPV-SISSISGNNK------------------------------LKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGS-EYLSKVCNFSFCDLAGSERTDKAQTSG--LMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVL 1400
             ++ MK++LR +PL      SP   V C +   + A PP+ Q    ++      K    F+FS VF  ES Q  VF+  +   ++ F++G + LLF YGTTSSGKT+T+ G   ++GI+PR    LF+  K + NP LMP DF++V  +   + +KLL++K+ ++KLS     DVL++   S   FV  +VL                 +E    NN+   TFWIS+ E+YNEL+YDLLDPV  +S+IS   +                              L++  LD+R  +NG  ++KGL+ YPV SAEEA RL+LVGR+ Q + +T+LN  SSRSH+ILTI+AVR         +++ + +FCDLAGSER++KA T G  +  +EA NIN+SLL LGRCI+ L+YNQ +P N ++VPYRDSKLTRLFQ++  G GKA MIV V+  P LFDET+  L+FSALA ++++
Sbjct:   47 CNELMKVYLRLKPLKRCHTNSPTPAVRCVNRRMVEAVPPDNQRFGVRD-----KKTSHTFTFSHVFDSESAQSSVFSKVALDQVRSFLEGLNGLLFAYGTTSSGKTYTLQGPLEDMGIVPRTFCALFRSVKHTMNPSLMPKDFSDVTALSAHEVEKLLRDKATVIKLSSGLPEDVLNLEKESLDSFVGTSVLDEPQPDLEVTPFPGMDFSERIRFNNDLRFTFWISFAEVYNELVYDLLDPVYCVSAISAVQQPNSLRSCLTTVAQKNIFSTIPPTGATEFANLRKKALDLRTDKNGNVFIKGLRIYPVSSAEEALRLVLVGRQCQKVAATRLNLASSRSHSILTIKAVRVVDKENPKFARISSLTFCDLAGSERSEKAATGGQAVRVREAGNINTSLLTLGRCIECLRYNQAHPENPKLVPYRDSKLTRLFQSFFTGRGKACMIVNVSPHPELFDETLHALRFSALATRIIV 514          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A4Z2DCZ3 (Kinesin-like protein OS=Schistosoma japonicum OX=6182 GN=EWB00_002225 PE=3 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 7.464e-92
Identity = 222/613 (36.22%), Postives = 332/613 (54.16%), Query Frame = 3
Query:  150 DDTMKIFLRFRPLNINQAESPFVIC---DPFTISATPPE---QSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEF---VDENVLSNNELSD------INNNYETTFWISYTEIYNELIYDLLDPVSISS-------------------------------ISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTY-PGSEYLSKVCNFSFCDLAGSERTDKAQTSG--LMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKE-------KPVAVNPSKGGQRLSIYR----RLGMKTPKTASKRDTIESILAGDDF---------------------DSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQME 1745
            + +MK++LR RP   +  +S   +    D  T+ A PPE      +++N      K   KF+F+ +F     Q  +F   +   ++ FI G + L+F YGTTSSGKTHT+ G + + GIIPR+L+++F   +  ++P LMP DF+EV  + +   +K+L EK+ LLK SE        +F N  F     E + S++   D      ++++   +FWIS+ EIYNE  YDLLDP   SS                               +S  N+ +R  L++R  +NG  ++KGL+ YPV S EEA RLL VGR+ Q + ST+LNQ SSRSH+IL ++AVR     +   ++V    FCDLAGSER+ KA T G  L  +EA NINSSLL LGRCI+ L+YNQ++P+N ++VPYRDSKLTRLFQ +  G+G+A MIV  + +P LFDET+  L+F+ALAK+V++            P  V P +G Q +   +     +  KT KTA   +T  S  + DDF                     D+  +  +  + +  E   + +  +EL+ +++ L  +L   K E V  EA+LR ++ ++ +Q I+  E
Sbjct:   55 NHSMKVYLRIRPYGCDDEKSAKTVLSYPDKCTVIACPPEIDGPKYAFRNF----QKSTNKFTFNGIFRESDTQAEIFEIVAADKVRAFISGLNGLIFAYGTTSSGKTHTLQGTRGDAGIIPRSLYSIFSLVRHKSDPSLMPKDFSEVVSLDEDKVKKVLSEKAYLLKYSEG-------IFENNSFPNEAKEKIFSDDTSIDQDFGYNLSSDIRFSFWISFVEIYNETFYDLLDPTQCSSMLNLPPTNIRNNHNTTNSRNIFSVNTNTSHTLSFVNQPRRTSLELRTDKNGNLFIKGLRWYPVSSPEEALRLLAVGRQCQKVASTRLNQASSRSHSILCVKAVRVANKNNPNFARVSTLMFCDLAGSERSVKAATGGQTLRIREAGNINSSLLTLGRCIECLRYNQIHPDNPKLVPYRDSKLTRLFQGFFNGHGRACMIVNASPNPELFDETLHALRFAALAKQVIVEAIPVTETAVLHPNKVGPKQGFQDIKRIKPSNQSVVAKTVKTAFVLETQSSCWSEDDFDRETLPVEGVPSEVGCSIGFDDASPSRAVTPNHDGTELVLDHFSKEELITMVKDLSEKLFESKGELVEQEARLRAEMCDNMNQQIIDFE 656          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A4S2L5R7 (Kinesin motor domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010263 PE=3 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 1.526e-91
Identity = 197/470 (41.91%), Postives = 280/470 (59.57%), Query Frame = 3
Query:  159 MKIFLRFRPLNINQAESPF--VIC-DPFTISATPPE-QSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNG--EFVDENVLSN---------------NELSDINNNYETTFWISYTEIYNELIYDLLDPV-SISSISGNNK-------------------------------LKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGS-EYLSKVCNFSFCDLAGSERTDKAQTSG--LMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVL 1400
            MK++LR +PL      SP   V C +   + A PP+ Q    ++      K    F+FS VF  ES Q  VF+  +   ++ F++G + LLF YGTTSSGKT+T+ G   ++GI+PR    LF+  K + NP LMP DF++V  +   + +KLL++K+ ++KLS     DVL++       FV  +VL                 +E    NN+   TFWIS+ E+YNEL+YDLLDPV  +S+IS   +                               L++  LD+R  +NG  ++KGL+ YPV SAEEA RL+LVGR+ Q + +T+LN  SSRSH+ILTI+AVR         +++ + +FCDLAGSER++KA T G  +  +EA NIN+SLL LGRCI+ L+YNQ++P N ++VPYRDSKLTRLFQ++  G GKA MIV V+  P LFDET+  L+FSALA ++++
Sbjct:   52 MKVYLRLKPLKRCHTNSPTPSVRCVNRRMVEAVPPDNQRFGVRD-----KKTSHTFTFSHVFDSESTQSSVFSSVALDQVRSFLEGLNGLLFAYGTTSSGKTYTLQGPLEDMGIVPRTFCALFRSVKHTMNPSLMPKDFSDVTALSAHEVEKLLRDKATVIKLSIGLPEDVLNLEKESLDSFVGTSVLDKPQPDLEVTPFPGMDFSERIRFNNDLRFTFWISFAEVYNELVYDLLDPVYCVSAISAAQQPNSLRSCLTAVAQKNIFSTIPPTGATEFSANLRKKALDLRTDKNGNVFIKGLRIYPVSSAEEALRLVLVGRQCQKVAATRLNLASSRSHSILTIKAVRVVDKENPKFARISSLTFCDLAGSERSEKAATGGQAVRVREAGNINTSLLTLGRCIECLRYNQIHPENPKLVPYRDSKLTRLFQSFFTGRGKACMIVNVSPHPELFDETLHALRFSALATRIIV 516          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif20a (kinesin family member 20A [Source:NCBI gene;Acc:103042345])

HSP 1 Score: 281.567 bits (719), Expect = 6.299e-80
Identity = 204/624 (32.69%), Postives = 319/624 (51.12%), Query Frame = 3
Query:   66 PANNLNIINFNVAETPLTLFNNNSENAVDDTMKIFLRFRPLNINQ---AESPFVIC--DPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLF--KFSKLSNNPLLMPV--------DFAEVC-QIKKTDXXXXXXXXXXXXXXXXXXXXDV--LHMFSNGEFVDENVLSNNELS-----DINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEY--LSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNL-RIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESILA---GDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIREENQLLMEKRARNERNKAFIQLKK 1850
            PA +         +T   L    S +   + +K+FLR RPL   +    E    +C  +  T+  T P+ S + K    G  +   KF+F+++F  ++ Q+ V++ T + +++D ++G +RLL+TYG T+SGKT+T+ G     G++PRAL ++F     +L     L PV        D +EVC +  K D+        +    S    S +  L   +  E  D   L  + LS     D+    + + W+S+ EIYNE +YDLL+     ++      KR  L +   + G  YVK L    V SAEEA+++L VGRR+Q   ST LN NSSRSH+I TIR +   P  E    +++   S CDLAGSER  K Q +G   KEA+NIN+SLL LGRCI  L++NQ N +   ++VP+RDSKLTR+ Q++  G+G++ M+V +N     +DET+Q LKFSA+A ++V                             P T ++   I S+L        D     +   +  ++E     +D +ELL  I  LK E++  ++EKV  EA++RE++  +  + I +M+ D ++ ++R R  N    E+R  N+ +     LKK
Sbjct:   50 PATDPQTPTKEALQTKTLLDRTVSRDEATEKLKVFLRIRPLTETEKERGEEQGCVCVQNEDTLLLTAPKDSHNMKTAERGIVQSVHKFNFTQIFGSQTSQQDVYDQTMREMVRDVLRGENRLLYTYGVTNSGKTYTIQGTAGEAGLLPRALVSVFYKTSGRLYTATDLKPVLSQEVRRLDVSEVCAEESKRDALLKEDTTRLRGGTSCSWDSGIGGLSAVTRLEDSDTVCLEADPLSLSGGDDLEPGLQYSIWVSFYEIYNEFLYDLLE-----ALPTQQTRKRATLRLSDDKYGNPYVKDLTWVQVRSAEEAWKVLKVGRRNQSFASTHLNHNSSRSHSIFTIRVLHIDPQMEMGQGTRISELSVCDLAGSERC-KNQQNGERMKEANNINTSLLTLGRCISALRHNQANKSRAPQVVPFRDSKLTRVLQSFFCGHGRSCMVVNINPCASTYDETLQALKFSAIATQLV---------------------------HGPATKTRVAYILSLLREQNAHTADITLEEDDEEEESDDEGDLTMFDPEELLKAINILKREVLRQRQEKVNLEARVREEVCTEMMEIINRMQDDFSETLERERHLN----EERCENKISNLKTSLKK 636          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif20a (kinesin family member 20A [Source:NCBI gene;Acc:103042345])

HSP 1 Score: 281.182 bits (718), Expect = 9.478e-80
Identity = 204/624 (32.69%), Postives = 319/624 (51.12%), Query Frame = 3
Query:   66 PANNLNIINFNVAETPLTLFNNNSENAVDDTMKIFLRFRPLNINQ---AESPFVIC--DPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLF--KFSKLSNNPLLMPV--------DFAEVC-QIKKTDXXXXXXXXXXXXXXXXXXXXDV--LHMFSNGEFVDENVLSNNELS-----DINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEY--LSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNL-RIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESILA---GDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIREENQLLMEKRARNERNKAFIQLKK 1850
            PA +         +T   L    S +   + +K+FLR RPL   +    E    +C  +  T+  T P+ S + K    G  +   KF+F+++F  ++ Q+ V++ T + +++D ++G +RLL+TYG T+SGKT+T+ G     G++PRAL ++F     +L     L PV        D +EVC +  K D+        +    S    S +  L   +  E  D   L  + LS     D+    + + W+S+ EIYNE +YDLL+     ++      KR  L +   + G  YVK L    V SAEEA+++L VGRR+Q   ST LN NSSRSH+I TIR +   P  E    +++   S CDLAGSER  K Q +G   KEA+NIN+SLL LGRCI  L++NQ N +   ++VP+RDSKLTR+ Q++  G+G++ M+V +N     +DET+Q LKFSA+A ++V                             P T ++   I S+L        D     +   +  ++E     +D +ELL  I  LK E++  ++EKV  EA++RE++  +  + I +M+ D ++ ++R R  N    E+R  N+ +     LKK
Sbjct:   50 PATDPQTPTKEALQTKTLLDRTVSRDEATEKLKVFLRIRPLTETEKERGEEQGCVCVQNEDTLLLTAPKDSHNMKTAERGIVQSVHKFNFTQIFGSQTSQQDVYDQTMREMVRDVLRGENRLLYTYGVTNSGKTYTIQGTAGEAGLLPRALVSVFYKTSGRLYTATDLKPVLSQEVRRLDVSEVCAEESKRDALLKEDTTRLRGGTSCSWDSGIGGLSAVTRLEDSDTVCLEADPLSLSGGDDLEPGLQYSIWVSFYEIYNEFLYDLLE-----ALPTQQTRKRATLRLSDDKYGNPYVKDLTWVQVRSAEEAWKVLKVGRRNQSFASTHLNHNSSRSHSIFTIRVLHIDPQMEMGQGTRISELSVCDLAGSERC-KNQQNGERMKEANNINTSLLTLGRCISALRHNQANKSRAPQVVPFRDSKLTRVLQSFFCGHGRSCMVVNINPCASTYDETLQALKFSAIATQLV---------------------------HGPATKTRVAYILSLLREQNAHTADITLEEDDEEEESDDEGDLTMFDPEELLKAINILKREVLRQRQEKVNLEARVREEVCTEMMEIINRMQDDFSETLERERHLN----EERCENKISNLKTSLKK 636          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: zgc:56231 (zgc:56231 [Source:ZFIN;Acc:ZDB-GENE-040426-1914])

HSP 1 Score: 266.929 bits (681), Expect = 2.310e-75
Identity = 192/559 (34.35%), Postives = 315/559 (56.35%), Query Frame = 3
Query:  159 MKIFLRFRP-----LNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKF--SKLSNNPLLMPVDFAEVCQI----------KKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNN-ELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIRE 1781
            ++++LR RP     LN N+ +   V+ +  T +   P+ S + K+   G G+   KFSF+K+F  ES Q   F+ T +  +QDF++G + L+F+YG T++GKTHT+ G+  + GI+PRAL  +F+    ++  +  L P   ++V Q+           K     LLKE S   +     SS +  +  +G   D+ V S    + D+   Y  + W++Y EIYNE +YDLL P    S++   K +RP L +     G SYV+ L+   + +AEEA ++L VG +++   +TK+NQ+SSRSH+I TI+ +R   G+  ++ +   S CDLAGSER +K +T G   KEA NIN+SLL LG+CI  L+ NQ +      +P+R+SKLTRLFQ    G GKASMIV +NQ    +DET+ V+KFSA+AK+V        + V P +  + L+  R +G       S  +++    A DD+ S++ +    +  +     +    +ELL ++E L+ +L+A +K+ +  E ++R ++ +   Q IM++E  +++ +  ++E
Sbjct:   52 LRVYLRVRPFSKEELNNNEDQGCVVLENTETAALHAPKGSATMKSSEKGIGQQLHKFSFTKIFGSESTQAEFFDGTIRLQVQDFLQGRNALVFSYGVTNAGKTHTIQGSPKDPGILPRALEVVFRHINGRMYEHMDLRPYLSSDVQQLDPDQIRAERCAKAALFSLLKESSRNCRSRSSSSSSINSLSFSGVSYDQTVDSVEVAVDDVQCVY--SLWVAYYEIYNEQVYDLLQP----SLTNKTK-RRPALRVCEDSAGNSYVRDLRWVNIQAAEEANKVLRVGNKNRSAAATKMNQSSSRSHSIFTIKLMRIDGGN--VNGISELSLCDLAGSERCNKTKTFGERLKEAGNINNSLLILGKCIAALR-NQNDRVKSSYIPFRESKLTRLFQGVFCGRGKASMIVNINQCASTYDETLHVMKFSAVAKEV--------LQVIPPRSLESLAP-RLIGRDGKPLLS--NSVIDCQAVDDYLSEDELLDGDEDADMSILPQ----EELLSLVESLRAKLLAERKKNLQQEIQIRREMGDAMLQQIMEIEEIHSRQMADLKE 585          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif20bb (kinesin family member 20Bb [Source:ZFIN;Acc:ZDB-GENE-030131-9684])

HSP 1 Score: 250.751 bits (639), Expect = 6.064e-68
Identity = 190/585 (32.48%), Postives = 311/585 (53.16%), Query Frame = 3
Query:  159 MKIFLRFRPL-----NINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRAL---FNLFKFSKLSNNPL--LMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVR----TYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTI---ESIL--------------AGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIER---LKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIREENQLLMEKRA 1811
            ++++LR RP      +  +++    I  P T+    P  S++ +       +  Q+F FSKV+ PE+ Q  +F+ T+K L++D + G + L+FTYG T++GKT T  G ++++GI+PR+L   FN  +    + N +     +DF  + + ++     + K      K ++ + S      S       ++  ++   + +++ + + W+S+ EIYNE I+DLLD  S SS       +R +L +     G ++VK L    V SA+EAYR+L +GR++Q   STKLN  SSRSH+I +IR +R      P  + +S+    S CDLAGSER  K Q  G   KEA NIN+SLL LG+CI+ L+ NQ      + +P+R+SKLT   Q +  G GKA MIV +NQ   +FDET+ VLKFSA+A+KVV+   +   +  P K  + +SI   +     K  ++R T+   ES L                +D + +E      ++  E    E  D QEL ++ ++   LK +L     EK+  E+++RE++  ++ +    ME+D  + +QR +E    + E+RA
Sbjct:   46 LQVYLRIRPFTSTESDFGESQDCISIESPDTVVLKAPRSSLTARQSEKLGPQIAQRFQFSKVYSPETTQRQIFDGTTKALVKDVLAGQNSLIFTYGVTNAGKTFTFLGPETDVGILPRSLKVIFNSIEGRIYTQNNIKPHRCIDFTRLTKDQQDAEATIKKNLLRRYKENDLQKSSSSMSNSACSSSCSDLNEDSLCLEEDSHVKFSVWVSFCEIYNENIHDLLDFASSSS------QRRSVLRLCQDVKGNTFVKDLTWIQVNSADEAYRVLKIGRKNQSFSSTKLNSVSSRSHSIFSIRILRIEDMCVPRVQTISE---LSLCDLAGSERCAKTQNRGERLKEAGNINTSLLTLGKCINALRLNQTQSKFQQHIPFRESKLTHYLQGFFSGRGKACMIVNINQCASMFDETLNVLKFSAVAQKVVVVNPKPVFSAVPRKSARDVSIM--INNVDKKEWTRRSTLIGWESSLEDVQEDEDDEDMEEGEEDEEEEEQEASDDESVMENTVLEAEDDQELNELQQKICELKEKLSKADSEKLVMESRIREEVTAEFMELFSNMEKDYNERLQREKE----IAEERA 615          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif20bb (kinesin family member 20Bb [Source:ZFIN;Acc:ZDB-GENE-030131-9684])

HSP 1 Score: 251.136 bits (640), Expect = 6.432e-68
Identity = 191/604 (31.62%), Postives = 309/604 (51.16%), Query Frame = 3
Query:  159 MKIFLRFRPL-----NINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRAL---FNLFKFSKLSNNPL--LMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEF----------VDENVLSNNELSDIN---------NNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVR----TYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTI---ESIL--------------AGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIER---LKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIREENQLLMEKRA 1811
            ++++LR RP      +  +++    I  P T+    P  S++ +       +  Q+F FSKV+ PE+ Q  +F+ T+K L++D + G + L+FTYG T++GKT T  G ++++GI+PR+L   FN  +    + N +     +DF  + + ++                      ++L  +   +               +L  +  SD+N         ++ + + W+S+ EIYNE I+DLLD  S SS       +R +L +     G ++VK L    V SA+EAYR+L +GR++Q   STKLN  SSRSH+I +IR +R      P  + +S+    S CDLAGSER  K Q  G   KEA NIN+SLL LG+CI+ L+ NQ      + +P+R+SKLT   Q +  G GKA MIV +NQ   +FDET+ VLKFSA+A+KVV+   +   +  P K  + +SI   +     K  ++R T+   ES L                +D + +E      ++  E    E  D QEL ++ ++   LK +L     EK+  E+++RE++  ++ +    ME+D  + +QR +E    + E+RA
Sbjct:   45 LQVYLRIRPFTSTESDFGESQDCISIESPDTVVLKAPRSSLTARQSEKLGPQIAQRFQFSKVYSPETTQRQIFDGTTKALVKDVLAGQNSLIFTYGVTNAGKTFTFLGPETDVGILPRSLKVIFNSIEGRIYTQNNIKPHRCIDFTRLTKDQQ--------------DAEATIKKNLLRRYKENDLQKSSSSMSNSACSTLLEGSSCSDLNEDSLCLEEDSHVKFSVWVSFCEIYNENIHDLLDFASSSS------QRRSVLRLCQDVKGNTFVKDLTWIQVNSADEAYRVLKIGRKNQSFSSTKLNSVSSRSHSIFSIRILRIEDMCVPRVQTISE---LSLCDLAGSERCAKTQNRGERLKEAGNINTSLLTLGKCINALRLNQTQSKFQQHIPFRESKLTHYLQGFFSGRGKACMIVNINQCASMFDETLNVLKFSAVAQKVVVVNPKPVFSAVPRKSARDVSIM--INNVDKKEWTRRSTLIGWESSLEDVQEDEDDEDMEEGEEDEEEEEQEASDDESVMENTVLEAEDDQELNELQQKICELKEKLSKADSEKLVMESRIREEVTAEFMELFSNMEKDYNERLQREKE----IAEERA 619          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif23 (kinesin family member 23 [Source:ZFIN;Acc:ZDB-GENE-991019-4])

HSP 1 Score: 207.223 bits (526), Expect = 4.124e-55
Identity = 146/457 (31.95%), Postives = 237/457 (51.86%), Query Frame = 3
Query:  153 DTMKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLF-KFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDE-NVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILD-IRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLS--------KVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKV-VLFEKEKPV-AVNPSKGGQ----RLSIYRRL 1472
            D + ++ R RPL  +  E    +     +   PPE + +++N   G  K  Q +SF +VF   + Q+ +F+  +KTL+ D ++G + LLFTYG T SGKT  M G     G++PR+L  LF   SK      +  +D     +++ ++   LL+ +   +       S       + EF +   V  + +   ++ +   + ++SY EIYN  I+DLL+ V +  I    + K P    +R   N   YV G     V S EEA+ +   G++ + + +T LN+ SSRSH++  ++ V+    S+  +         V   +  DLAGSERT++ +  G   +EA NIN SL+ L  CI+VL+ NQ+   N ++VPYRDSKLT LF+ Y  G GK  MIVCVN      +ET+ V++F+ + ++V V    +KP+  + P +  +    R+ + RRL
Sbjct:   24 DPVGVYCRVRPLGEDDKECCVEVISDTMVQLHPPEGARAFRN---GEYKETQ-YSFKRVFGVNTTQKELFDIVAKTLVDDLVQGKNGLLFTYGVTGSGKTFNMTGAPGQPGLLPRSLDMLFNTISKFQAKRYVFKLDDKNSLEVQ-SEVDALLERQKRDILPPATPKSTTSRSKVDTEFAEIITVEEHCKAEGVDEDSAYSVFVSYIEIYNNYIFDLLEDVVVDPI----RPKPPQSKMLREDSNHNMYVVGCTEVEVKSTEEAFEMFWRGQKRRRVANTTLNRESSRSHSVFIVKLVQAPLDSDGETILQDREQITVSQLALVDLAGSERTNRTKAEGNRLREAGNINQSLMTLRTCIEVLRENQMLGTN-KMVPYRDSKLTLLFKNYFDGEGKVRMIVCVNPKADDHEETLHVMRFAEMTQEVEVARPADKPIFGLTPGRRNRYHELRMELTRRL 470          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: KIF20A (kinesin family member 20A [Source:HGNC Symbol;Acc:HGNC:9787])

HSP 1 Score: 188.348 bits (477), Expect = 2.262e-50
Identity = 100/218 (45.87%), Postives = 142/218 (65.14%), Query Frame = 3
Query:  747 TFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSE-YLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQ-LNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKV 1394
            + W+++ EIYNELIYDLLD    + ++     +R IL +   ++ G ++K +K   V++  E   LL  GR++Q   STKLN NSSRSH+I TIR +R   G++  ++ +  FS CDLAGSER+ +        +EA NIN+SLLALG+CI  L++NQ  N  N R+VP+R+SKLTRLFQ YL G GK  M+V +N     + E + VL+FSA+AK+V
Sbjct:  296 SVWVAFYEIYNELIYDLLDFTPATRLA-----QRHILHMAEDQHKGPFIKDIKWVQVHNVIEVLTLLNAGRKNQSFASTKLNLNSSRSHSIFTIRLIRLEKGAKPEVTAINEFSICDLAGSERSSRTHNVADRLQEACNINTSLLALGKCITALRFNQQANRLNSRVVPFRESKLTRLFQVYLLGRGKTCMVVNINPSTSWYTENLNVLRFSAIAKQV 508          

HSP 2 Score: 75.485 bits (184), Expect = 3.535e-14
Identity = 33/71 (46.48%), Postives = 53/71 (74.65%), Query Frame = 3
Query:  303 FQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLF 515
             Q+F+F++V+ PE  Q+ VF++T + L+Q+F+ GN+ L+FTYG T+SGKT+T+ G   + G++PR L  LF
Sbjct:  112 IQRFTFTQVYGPEVSQKEVFDNTVRPLVQEFLLGNNCLVFTYGVTNSGKTYTVQGTVKDGGLLPRTLDLLF 182          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif15 (kinesin family member 15 [Source:ZFIN;Acc:ZDB-GENE-050622-16])

HSP 1 Score: 136.732 bits (343), Expect = 8.130e-33
Identity = 93/260 (35.77%), Postives = 136/260 (52.31%), Query Frame = 3
Query:  759 SYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCN-----FSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGG------------QRLSIYRRLGMKTP 1487
            S+ EIYNE ++DLLDP S S            L IR     G +V+G+    + SA EAY++L +G R++ + ST +N+ SSRSH + T+    T    E  + + N      +  DLAGSER    Q+ G+  KEA +IN SL +LG  I+ L   ++     R VPYRDSKLT L +  LGGN K ++IV V+   R F ET+  L+F+   K +    K K V    ++G             ++LS+++ L +  P
Sbjct:  145 SFLEIYNEQVFDLLDPASTS------------LFIRENIQKGVFVEGVMEMSLSSAAEAYQVLSLGWRNRRVASTSMNRESSRSHAVFTL----TIQSKEKRNGMVNIRSSQLNLVDLAGSERQRDTQSDGMRLKEAGSINRSLSSLGNVINALA--EIAHGKGRFVPYRDSKLTFLLRDSLGGNAKTAVIVNVHPGGRYFGETLSTLQFARRTKLI----KNKAVVNEDTRGDLSQLQAEIKRLREQLSLHQLLTIAAP 382          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: KIF27 (kinesin family member 27 [Source:HGNC Symbol;Acc:HGNC:18632])

HSP 1 Score: 132.88 bits (333), Expect = 1.521e-31
Identity = 89/246 (36.18%), Postives = 130/246 (52.85%), Query Frame = 3
Query:  729 NNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYP-GS---------EYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVA-VNP 1433
            ++N + +  +SY E+Y E + DLLD   I ++S +       + IR    G + + G K   V + +E   LL  G  ++  G+T++N++SSRSHTI T+   +  P GS         E  S    F F DLAGSER  K   +G   KE+  INS LLALG  I  L   +   ++   +PYRD+K+TR+ +  LGGN K  MI C++     FDET+  LK++  AK +    + KPV   NP
Sbjct:  124 SHNTDFSVGVSYIEVYKEELRDLLD---IETLSKD-------MHIREDDKGNTVIIGTKESVVETEDEVLSLLEAGNAARHTGTTQMNEHSSRSHTIFTLTVTQRRPYGSSNSGDNLNNESESLSSKFHFVDLAGSERVSKTGNTGERFKESIQINSGLLALGNVISALGDPKRKSSH---IPYRDAKITRILKDSLGGNAKTLMIACISPSSGNFDETINSLKYANRAKNI----RNKPVVNYNP 352          

HSP 2 Score: 61.2326 bits (147), Expect = 1.254e-9
Identity = 44/138 (31.88%), Postives = 67/138 (48.55%), Query Frame = 3
Query:  147 VDDTM-KIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGN------KSNLGIIPRALFNLFKFSKLSNN 539
            +DDT+ ++ +R RPL  N+       C    +   P  Q +     L G  + F   +F  VF  +  QE V+    + L++ F+ G +  +F YG T SGKT T+ G       +   GIIPRA+ +LF   K S+N
Sbjct:    1 MDDTLVRVAVRIRPLLRNEILYSQQTC----VRVVPGNQQI-----LLGKDRAF---TFDHVFGSKVAQEEVYKTCIQPLVKSFVDGYNVTVFAYGQTGSGKTFTIGGANIASSIEDERGIIPRAIADLFFAMKESHN 126          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010887.1 (pep scaffold:Pmarinus_7.0:GL482947:9977:16429:1 gene:ENSPMAG00000009864.1 transcript:ENSPMAT00000010887.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 1.974e-28
Identity = 78/216 (36.11%), Postives = 109/216 (50.46%), Query Frame = 3
Query:  756 ISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLS---KVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKV 1394
            +SY EIYNE+I DLL+P +              LD+R    GG  + G+      +A+E  +LL+ G R +    T  N+ SSRSH +L +  VR       +S   +       DLAGSER  + Q  G   KE ++IN SLLALG CI+ L          + V YRDSKLTRL +  LGGN +  MI  ++     F+E+   L ++  AK +
Sbjct:   77 MSYLEIYNEMIRDLLNPST------------GFLDLREDHKGGIQIAGITEVSTSNAKEIMQLLVKGNRQRTQEPTAANKASSRSHAVLQV-TVRQSSRVRDISQEVRTGRLFLIDLAGSERAAQTQNRGKRMKEGAHINRSLLALGNCINALSE---RGGRAQYVNYRDSKLTRLLKDSLGGNSRTVMIAHISPASISFEESRNTLTYADRAKNI 276          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 127.487 bits (319), Expect = 2.305e-30
Identity = 85/230 (36.96%), Postives = 123/230 (53.48%), Query Frame = 3
Query:  711 NELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSK--VCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKV 1394
            N+++D+ +  +    +SY EIYNE I DLL P + S        KR  L IR        V  L  +   + E+   L++ G  ++    T+ N+ SSRSH +L I  ++T    +  S+      S  DLAGSER    +  G+   E +NIN SLLALG CI+ L  N  + +    +PYRDSKLTRL +  LGGN K  MIVC++     +DET+  LK++  AK++
Sbjct:  221 NKITDLKDEKDFEISLSYLEIYNERIRDLLKPETPS--------KR--LVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLN--DGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEI 438          

HSP 2 Score: 55.8398 bits (133), Expect = 2.906e-8
Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 3
Query:  285 HGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLF 515
            HG   G  KF F K+F   S Q  V+ +T+  LL   + G +  +F YG T  GKT+T++G  S  GII  A+  LF
Sbjct:  147 HG---GEIKFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPSQPGIIFLAMEELF 220          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 119.398 bits (298), Expect = 5.954e-28
Identity = 99/271 (36.53%), Postives = 124/271 (45.76%), Query Frame = 3
Query:  756 ISYTEIYNELIYDLLDPV---SISSISGNNKLKRPI---------LDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLN---------------------------PNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQR 1451
            ISY EIYNE IYDLL+     S S IS  ++L             L IR     G  V GL      S+EE  R + VG +S+ IG T  N  SSRSH I+ IR   T       S+    S CDLAGSER    Q     +KE S IN SLLALG  I  L  +++N                           P+N   +PYRDSKLTRL Q  L G+   + I  V+       ETM  L+F++ AK V L   +K +  N +  G +
Sbjct:  248 ISYLEIYNERIYDLLESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNV-KNGTSRSSTLSLCDLAGSERATGQQE---RRKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNH--IPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNVALHVSKKSIISNGNNDGDK 512          

HSP 2 Score: 55.0694 bits (131), Expect = 4.476e-8
Identity = 27/69 (39.13%), Postives = 39/69 (56.52%), Query Frame = 3
Query:  309 KFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLF 515
            +F F  VF        V+  TSK ++   + G +  +F YG T SGKT TM+GN+  LG+IP ++  LF
Sbjct:  162 EFKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQELGLIPLSVSYLF 230          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: CIN8 (Kinesin motor protein; involved in mitotic spindle assembly and chromosome segregation [Source:SGD;Acc:S000000787])

HSP 1 Score: 106.301 bits (264), Expect = 9.972e-24
Identity = 64/179 (35.75%), Postives = 99/179 (55.31%), Query Frame = 3
Query:  882 GSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKP 1418
            G Y++ L+ + + +A E   LL  G + + + STK+N  SSRSHTI TI   + +   + L ++   +  DLAGSE  +++       KEA +IN SLL LGR I+ L       +    +P+R+SKLTRL Q  LGGN K ++I  ++      +ET   L++++ AK +    K KP
Sbjct:  315 GIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH--QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL------VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI----KNKP 481          

HSP 2 Score: 72.4034 bits (176), Expect = 3.102e-13
Identity = 36/97 (37.11%), Postives = 56/97 (57.73%), Query Frame = 3
Query:  306 QKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNK--------SNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEV 572
            ++++  KVF P + Q+L+F++ +  L QDFIKG +  +  YG TS+GKT+TM G++           GIIPR L  LF   +L  N  ++   F E+
Sbjct:   87 KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIEL 183          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 101.293 bits (251), Expect = 3.947e-22
Identity = 79/237 (33.33%), Postives = 119/237 (50.21%), Query Frame = 3
Query:  714 ELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGS----YVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTI------RAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKV 1394
            ELS +N  Y  +  IS+ E+YNE + DLL        + N+    P   IRI  N  +     VKG++   + SA E   LL+ G   + + +TK N  SSRSHT+ TI      +  + +  ++   K+   +  DLAGSE  +++       +EA  IN SLL LGR I+ L       ++   +PYR+SKLTRL Q  LGG  K  +I  ++      +ET   L+++  AK +
Sbjct:  186 ELSSLNKEY--SVKISFLELYNENLKDLLSDSEDDDPAVND----PKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINAL------VDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSI 410          

HSP 2 Score: 69.707 bits (169), Expect = 2.041e-12
Identity = 52/172 (30.23%), Postives = 81/172 (47.09%), Query Frame = 3
Query:  108 TPLTLFNNNSENAVDDTMKIFLRFRPLNINQAESPFVICDPFTISATPPE-QSVSYKNLLHGNGKGFQK-FSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGN---------------KSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEV 572
            TP T   NN     D  + +++R R  N  + E    +     IS   P+ + +   N  H +    +K + F +VF  ESDQE VFN T+K  +++ + G +  +F YG T +GKT+TM+G+                 + GIIPR L +LFK     N    + + F E+
Sbjct:   38 TPPTC--NNGAATSDSNIHVYVRCRSRNKREIEEKSSV----VISTLGPQGKEIILSNGSHQSYSSSKKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLEL 203          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 76.6406 bits (187), Expect = 1.019e-14
Identity = 71/229 (31.00%), Postives = 105/229 (45.85%), Query Frame = 3
Query:  732 NNYETTFW-----ISYTEIYNELIYDLLDPVSISSISGNNKLKRPI---LDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLV-GRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNF---SFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNL-RIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSA 1379
            N  +T  W       + EIYNE I DLL          NNK    I    +IR  +   +      +     +EE   ++L    + +   ST  N++SSRSH+I  I       GS   +   ++   +  DLAGSER + +Q  G   +E  NIN SL  LG  I  L      P++  R +P+R+SKLT L Q  L G+ K  M V ++      +ET+  L+F++
Sbjct:  504 NKLKTKGWDYKVNCEFIEIYNENIVDLLRS------DNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIH----LSGSNAKTGAHSYGTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHALG----QPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFAS 718          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO32131 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVZ5])

HSP 1 Score: 219.55 bits (558), Expect = 4.769e-65
Identity = 110/220 (50.00%), Postives = 153/220 (69.55%), Query Frame = 3
Query:  747 TFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTY-PGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLF 1403
            + W+S+ EIYNELIYDLL+P       G  K KRP L +   ++G  YVKGL+   V +A+EAY++L VG+++Q I STKLN  SSRSH I +I+ +R     + ++++V   SF DLAGSER  K Q++G   KEA NIN+SL+ LG+C+D L+YNQ + NN +++P+R+SKLTRLFQ +  G GKA+M+V +NQ    FDET   LKFSA+AK+V  +
Sbjct:   28 SIWVSFAEIYNELIYDLLEPCP----EGKGK-KRPTLKLGDDKHGNPYVKGLREVCVANADEAYKILKVGKKNQTIASTKLNHQSSRSHCIFSIKILRVVNVDNPHVARVSRLSFVDLAGSERYSKTQSTGDRLKEAGNINTSLMTLGKCLDYLRYNQQHHNNPQMIPFRESKLTRLFQGFFCGKGKAAMVVNINQCASTFDETYHALKFSAIAKQVSTY 242          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO32926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STS0])

HSP 1 Score: 225.328 bits (573), Expect = 2.787e-61
Identity = 147/444 (33.11%), Postives = 235/444 (52.93%), Query Frame = 3
Query:  135 SENAVDDTMKIFLRFRPLNINQAESPFVICDPFT--ISATPPEQSVSYKNLLHGNGKGFQ-KFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLF-KFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNG----EFVDE-NVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGS--YVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTY--PGSEYLSKVCN------FSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNN---LRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVL 1400
            S N + D ++++ R +PL  N+ ES   I D  +  +  T P+ S ++K+     G   + + +F  V+   + Q+ +F+  +  L+ D + G + L+F YG T SGKTHTM G  S+ G++PR L  +F   ++   +  +   D     +++  D  KL +E      L +  ++       NG    EF D   +     + +I+ +     ++SY EIYN  +YDLLD   +  I       +P +   +  +G    Y+ G+    V + EEAY + L G++ + +  T LNQ SSRSH++  I+ V+    P  E + + C+       S CDLAGSERT +    G   +EA NINSSL+AL  CI++L+ NQ N  N    +IVPYRDSKLT LF+ +  G GK  M+VC+NQ    +DE++ V+KF+ L ++VV+
Sbjct:   21 SANKLKDPVEVYCRIKPLGENEEESCVKIIDNDSKLLQLTAPKFSQAFKS-----GHRIETQHTFKHVYDENTTQKHLFDQVALPLVDDVLHGKNGLIFAYGITGSGKTHTMTGTPSDSGLLPRCLDVIFNSIAEYQTDTFIFKPDKNNGWEVQTEDEAKLDREMKHKEALLQAAATPSRR---NGNISPEFSDAIRIPEERRIDNIDEDNGYAVFVSYIEIYNNFVYDLLDESPVDPI-----CPKPPVSKNLREDGSHNMYISGVTEIEVKTTEEAYGVFLKGQKGRRVAQTVLNQESSRSHSVFAIKVVQAPLDPDGEQILQDCDQVAVSTLSLCDLAGSERTKRTNAGGDRLREAGNINSSLMALRTCIEILRENQSNYENGVSPKIVPYRDSKLTHLFKNFFDGEGKVRMVVCLNQSAEEYDESIHVMKFAELTQEVVV 451          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO27285 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9N9])

HSP 1 Score: 176.792 bits (447), Expect = 2.995e-48
Identity = 129/412 (31.31%), Postives = 210/412 (50.97%), Query Frame = 3
Query:  165 IFLRFRPLNINQAESPFVICDPFT--ISATPPEQSVSYKNLLHGNGKGFQ-KFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLF-KFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEF----VDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGS--YVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYP----GSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETM 1358
            ++ R +PL  N+ ES   I D  +  +  T P+ S ++K+     G   + + +F  V+   + Q+ +F+  +  L+ D + G + L+F YG T SGKTHTM G  S+ G++PR L  +F   ++      +   D     +++  D  KL +E      L +  ++    + SN  F    +    +  N++ D +N Y    ++SY EIYN  +YDLLD   +  I       +P +   +  +G    Y+ G+    V + EEAY + L G++ + +  T LNQ SSRSH++  I+ V+  P    G + L +    S        +T   + S +  + + NINSSL+AL  CI++L+ NQ N  N  IVPYRDSKLT LF+ +  G GK  M+VC+NQ    +DE++
Sbjct:    1 VYCRIKPLGENEEESCVKIIDNDSKLLQLTAPKFSQAFKS-----GHRIETQHTFKHVYDENTTQKHLFDQVALPLVDDVLHGKNGLIFAYGITGSGKTHTMTGTPSDSGLLPRCLDVIFNSIAEYQTGTFIFKPDKNNGWEVQTEDEAKLDREMKHKEALLQAAATPSRRLSSNVLFSMSRIQCKYMQMNQI-DEDNGY--AVFVSYIEIYNNFVYDLLDESPVDPIC-----PKPPVSKNLREDGSHNMYISGVTEIEVKTTEEAYGVFLKGQKGRRVAQTVLNQESSRSHSVFAIKVVQA-PLDPDGEQILQENITISLI-----LQTQGQKQSAITLRTSRNINSSLMALRTCIEILRENQSNYEN-GIVPYRDSKLTHLFKNFFDGEGKVRMVVCLNQSAEEYDESI 392          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO49629 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFN0])

HSP 1 Score: 138.272 bits (347), Expect = 1.453e-33
Identity = 85/227 (37.44%), Postives = 117/227 (51.54%), Query Frame = 3
Query:  741 ETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPV 1421
            E +  +S+ EI+NE I+DLL+P S              + IR +  GG  + GL    V S ++  + L +G  S++ G+T +N  SSRSH I TI   +   G +   +   F   DLAGSER  K    G   KE  NIN  LL LG  I  L   Q NP+    VPYRDSKLTRL Q  LGGN    M+ CV+     ++ET+  L+++  A+ +    K KP+
Sbjct:  135 EYSLKVSFLEIHNEEIHDLLNPSSTDER----------ITIRESCEGGIKIAGLMEKKVDSVQDMVQCLELGSASRVTGATAMNSRSSRSHAIYTIIMEQRGKGIDSDVRKAKFHLVDLAGSERVKKTNAQGERFKEGVNINKGLLCLGNVISALSDEQRNPSTH--VPYRDSKLTRLLQDSLGGNSNTLMLACVSPADSNYEETLNTLRYADRARHI----KNKPI 345          

HSP 2 Score: 62.3882 bits (150), Expect = 7.908e-10
Identity = 43/146 (29.45%), Postives = 67/146 (45.89%), Query Frame = 3
Query:  159 MKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTM--------NGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEV 572
            +K+ +R RPL   +       C    IS TP E  V     + G  K F   ++  VF   S Q+ ++ D    LL  F KG +  +  YG T SGKTH+M        + ++ + G+IPR + +LF+  +       + V F E+
Sbjct:   12 VKVAVRIRPLLHKEISEACQEC----ISVTPGEPQV-----IMGTNKAF---TYDYVFGKSSSQKELYTDVVTPLLDGFFKGYNATVLAYGQTGSGKTHSMGTSFTVCTSDDEDSQGVIPRLIQDLFRHIEQDKCEYSLKVSFLEI 145          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO47075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN53])

HSP 1 Score: 136.346 bits (342), Expect = 4.291e-33
Identity = 109/396 (27.53%), Postives = 180/396 (45.45%), Query Frame = 3
Query:  153 DTMKIFLRFRPLNINQAESPFVIC-----DPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIR---AVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMI 1316
            D +++ +R RPLN  +  S   +C        +I+ TPP    S         +  +KF+F +VF  +  Q  V+ D ++ +++  ++G +  +F YG T +GKT TM G +S    +P                 ++P  FA                                H+F +             ++ ++ +      +SY EIYNE + DLL            K +   L+++   + G YVK L SY + +A++  R + +G +++ +G+T +N+ SSRSH I +I    + +   G +++ ++      DLAGSER  K   +G+  KEA+ IN SL  LG  I  L    ++  +  I PYR+SKLTRL Q  LGGN K  M+
Sbjct:    9 DNVRVVVRCRPLNEKEKGSGCKMCVNVDEGTGSIAVTPPGGRSS---------EPPKKFTFDRVFNVDCKQTDVYTDAARGIVESVLEGYNGTIFAYGQTGTGKTFTMEGVRS----VPELRG-------------IVPNSFA--------------------------------HIFGH-------------IAKVDGHVRFLVRVSYLEIYNENVRDLL-----------GKDQNAKLEVKERPDIGVYVKDLSSYVMNNADDLDRTMTLGNKNRSVGATNMNERSSRSHAIFSITVECSEKGLDGQQHV-RMGKLHLVDLAGSERQAKTGATGVRLKEATQINLSLSTLGNVISAL----VDGKSTHI-PYRNSKLTRLLQDSLGGNSKTIMV 316          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: zgc:56231 (ribosomal protein S20 [Source:NCBI gene;Acc:101166754])

HSP 1 Score: 266.929 bits (681), Expect = 3.505e-75
Identity = 188/556 (33.81%), Postives = 295/556 (53.06%), Query Frame = 3
Query:  159 MKIFLRFRP-----LNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKF--SKLSNNPLLMP-----VDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELSDINNNYETTF--WISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPV-AVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIRE 1781
            M+++LR RP     L+  + +   VI +   ++   P+ S + K+   G G    KFSFS++F PE+ Q  +F DT ++ L DF+ G + L+F+YG T++GKT T+ G     GI+PR +   F      L +   L P     V   +  Q+KK  + K      +  +     SS      S+         S+   +   +    TF  W+S+ EIYNE +YDLL P S S        KRP L +     G +YVK ++   V+S  EA++L+  G +++   +TK+NQ+SSRSH I T++ ++   G   + +V  FS CDLAGSER +K +T G   KEA NIN+SLL LG+CI  L+ NQ +      +P+R+SKLT+LFQT+  G GKASMIV +NQ    +DET+ V+KFSA+AK+VV    ++P  ++ P   G+   +  R      K A    T+ES L           E     E EE         ELL+II+ L+T+L+A +++ +  E ++R+++ +   + +M+ E    + ++ ++E
Sbjct:  110 MRVYLRVRPFFKEELSDEEDQDCVVIENRQLVTLYAPKGSATMKSSEKGVGMSIFKFSFSQIFGPETTQAELFEDTVRSQLVDFLDGKNALIFSYGVTNAGKTFTIQGTTKEPGILPRVMEATFHHIQGHLYDGMDLKPHLRSGVQCLDADQVKKERTAKAAIFTLVKEECDRLRSSSGSESSSDHSLASPPPFSSQTATPSRSANGETFALWVSFFEIYNECVYDLLQP-SFSK-------KRPSLRVCDDGAGNAYVKDIRWINVHSLSEAFKLIQFGNKNRTAAATKMNQSSSRSHGIFTMKLLKIDGGE--VKRVSEFSLCDLAGSERCNKTRTFGERLKEAGNINNSLLILGKCISALRNNQTDKAKASYIPFRESKLTKLFQTFFCGKGKASMIVNINQCASTYDETLHVMKFSAIAKEVVQVVPDRPADSLAPCLVGRDGKLLVR------KAAVDDLTLESFLT----------EEERLDETEEADVSLLPQNELLNIIDNLRTKLLAERRKNLVQEMEIRKEMGDAMLEQLMESEELRVRQLEELKE 639          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif20a (kinesin family member 20A [Source:NCBI gene;Acc:101164668])

HSP 1 Score: 262.692 bits (670), Expect = 2.255e-73
Identity = 163/442 (36.88%), Postives = 245/442 (55.43%), Query Frame = 3
Query:  165 IFLRFRPLN-----INQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK------FSKLSNNPLL----MPVDFAEVC--QIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNG-------EFVDENVLSNNELS-----DINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGS--EYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVV 1397
            +FLR RPL        + +    + D  T+    P +S + K    G  +   KFSFSK+F PE+ Q+  ++ T K ++ + +KG +RLL+TYG T+SGKT+T+ G+    G++PRAL +LF+      +S +   P++      +D +EV   +I+K    K  +  +     +       +   S+        E  D   L  + LS     D+    + + W+SY EIYNE +YDLLD    +S+S  ++ KR  L +   + G  YVK L    V SAEEA+++L  G R+Q   ST LNQNSSRSH+I +IR +  +P +      ++   + CDLAGSER  K Q  G   KEA+NIN+SL+ LGRCI  L++NQ      ++VP+RDSKLTR+ Q +  G G + M+V +N     +DET+QVLKFSA+A ++V
Sbjct:   77 VFLRIRPLTDLEKEQGEEQGSVTVQDDATVLLKAPRESQNSKTAEKGVTQSIHKFSFSKIFGPETTQQQFYDATLKKMINEVLKGENRLLYTYGVTNSGKTYTIQGSGQEAGLLPRALVSLFRKLQGRLYSAMDLKPVMSQDVRQLDSSEVKMEEIRKNSLLKEDENLTSRRAGTTTVWDSGVGGLSSTTQITTQLEDTDSVCLEPDSLSLSGGDDLEEGVQFSIWVSYFEIYNEFLYDLLD----TSLSLQSR-KRITLRLSDDKQGNPYVKDLTWIQVRSAEEAWKVLKAGCRNQSFASTHLNQNSSRSHSIFSIRVLHVHPDAVPGQALQISELTVCDLAGSERC-KEQRLGERMKEATNINTSLMTLGRCISALRHNQNKSRPPQVVPFRDSKLTRVLQGFFCGRGTSCMVVNINPCASTYDETLQVLKFSAIATQLV 512          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: ENSORLT00000025264.2 (kinesin-like protein KIF20B [Source:NCBI gene;Acc:101164965])

HSP 1 Score: 245.743 bits (626), Expect = 6.129e-67
Identity = 156/452 (34.51%), Postives = 248/452 (54.87%), Query Frame = 3
Query:  153 DTMKIFLRFRPLNINQAES-----PFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKF--SKLSNNPLLMPV---DFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELS---DINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTY-PGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEK--PVAVNPSKGGQRLSI 1460
            + ++++LR RP    ++ S        I  P T++   P  S S +       +  Q+F+F++VF P++ Q  VFN + + L++D ++G + L+FTYG T++GKT T  G + + G++PR+L  +F     +L +   L P    DF+ +   ++       +    L K ++K  +     F  G  +  +   +   S   D+++N   + W+S+ EIYNE I+DLL+ V   +       +R +L +     G S++K L+   V S+EEAYR++ +G+R+Q   ST+LN  SSRSH+I +IR +R    G   +  V   + CDLAGSER  +   +G   KEA NIN+SLL LG+CI+ ++ NQ N      +P+R+SKLT   Q +  G G+ SM+V +NQ    FDET+ VLKFSALA+KVV+   +   P   +P K    LSI
Sbjct:   43 ENLQVYLRVRPFTAAESHSRDSQDCVTIEGPDTVALRAPRVSTSNQKSEKPLPQTAQRFTFTQVFGPDAGQRQVFNGSVRGLVRDVLQGGNCLVFTYGVTNAGKTFTFLGPEHDSGLLPRSLSVIFNSIEDRLYSRHDLKPQRCKDFSRLTAEQQAAESSSKRSLLRLFKETDKTLTSGRSTFLEGSSLSSDSSVSEPDSFCLDVSSNVSFSVWVSFCEIYNESIHDLLEQVPALN------QRRTVLRLSQDVKGNSFIKDLRWVQVNSSEEAYRIMKIGKRNQSFSSTRLNYLSSRSHSIFSIRILRVDDSGVPRVLGVSELALCDLAGSERCSRTHNTGERLKEAGNINTSLLTLGKCINAMRLNQ-NSKFQHHIPFRESKLTHFLQNFFCGAGRVSMVVNINQSSSFFDETLNVLKFSALAQKVVVLSSQPDVPGDQDPQKMAMELSI 487          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: KIF23 (kinesin family member 23 [Source:NCBI gene;Acc:101168442])

HSP 1 Score: 200.675 bits (509), Expect = 1.201e-52
Identity = 149/472 (31.57%), Postives = 226/472 (47.88%), Query Frame = 3
Query:  102 AETPLTLFNNNSENAVDDTMKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK-----------FSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHM--FSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLL-----DPVSISSISGNNKLKRPILD------IRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRT---YPGSEYLSK-----VCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPV 1421
              TP         N   D + ++ R RPL     E    +    TI    P+   + +N   G  K  Q +SF KVF   + Q  +F D +K L+ D I   + LLFTYG T SGKT TM G+    G++PR+L  LF            F     N + +      + + +K DSQ+ + +     + ++ E +D++        E VDE+                + ++SY EIYN  IYDLL     DP+    + G   ++           +R  +N   YV G     V S EEA+ +   G++ + I +T+LN+ SSRSH++ T++ V+      G   L       V      DLAGSERT + +  G   +EA NIN SL+ L  C++VL+ NQ+   N ++VPYRDSK+T LF+ Y  G GK  MIVCVN +   ++E+  V++F+ + ++V   E  +PV
Sbjct:    7 GRTPRRPGQKKPSNTERDPVGVYCRIRPLISEDEECCIEMISSTTIQLHAPDGLKANRN---GEYKETQ-YSFKKVFGVNTTQMELFQDVAKPLVNDLIHCKNGLLFTYGVTGSGKTFTMTGSPGEGGLLPRSLDMLFNSIGPFQAKRYVFKPDDKNGMEIQSQVDALLERQKRDSQQSVPKTPSSRQKADPEFADMISPDEACKSESVDEDCC-------------FSVFVSYIEIYNNYIYDLLEDAPFDPIRPKWLDGGTPIRNKEFTPPQSKVLREDQNHNMYVAGCTEVEVKSTEEAFEIFWKGQKKRRIANTQLNRESSRSHSVFTVKLVQAPLDADGDHILQDKNQVNVSQLCLVDLAGSERTSRTRAEGSRLREAGNINQSLMTLRTCMEVLRENQMCGTN-KMVPYRDSKVTHLFKNYFDGEGKVRMIVCVNPNADDYEESALVMRFAEMTQEV---EVARPV 457          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: KIF23 (kinesin family member 23 [Source:NCBI gene;Acc:101168442])

HSP 1 Score: 199.519 bits (506), Expect = 2.802e-52
Identity = 149/460 (32.39%), Postives = 224/460 (48.70%), Query Frame = 3
Query:  108 TPLTLFNNNSENAVDDTMKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFK-----------FSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHM--FSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDI-RIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRT---YPGSEYLSK-----VCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPV 1421
            TP         N   D + ++ R RPL     E    +    TI    P+   + +N   G  K  Q +SF KVF   + Q  +F D +K L+ D I   + LLFTYG T SGKT TM G+    G++PR+L  LF            F     N + +      + + +K DSQ+ + +     + ++ E +D++        E VDE+                + ++SY EIYN  IYDLL+      I    + K P   + R  +N   YV G     V S EEA+ +   G++ + I +T+LN+ SSRSH++ T++ V+      G   L       V      DLAGSERT + +  G   +EA NIN SL+ L  C++VL+ NQ+   N ++VPYRDSK+T LF+ Y  G GK  MIVCVN +   ++E+  V++F+ + ++V   E  +PV
Sbjct:    9 TPRRPGQKKPSNTERDPVGVYCRIRPLISEDEECCIEMISSTTIQLHAPDGLKANRN---GEYKETQ-YSFKKVFGVNTTQMELFQDVAKPLVNDLIHCKNGLLFTYGVTGSGKTFTMTGSPGEGGLLPRSLDMLFNSIGPFQAKRYVFKPDDKNGMEIQSQVDALLERQKRDSQQSVPKTPSSRQKADPEFADMISPDEACKSESVDEDCC-------------FSVFVSYIEIYNNYIYDLLEDAPFDPI----RPKPPQSKVLREDQNHNMYVAGCTEVEVKSTEEAFEIFWKGQKKRRIANTQLNRESSRSHSVFTVKLVQAPLDADGDHILQDKNQVNVSQLCLVDLAGSERTSRTRAEGSRLREAGNINQSLMTLRTCMEVLRENQMCGTN-KMVPYRDSKVTHLFKNYFDGEGKVRMIVCVNPNADDYEESALVMRFAEMTQEV---EVARPV 443          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000030852.1 (SMESG000030852.1)

HSP 1 Score: 1911.35 bits (4950), Expect = 0.000e+0
Identity = 1017/1039 (97.88%), Postives = 1019/1039 (98.08%), Query Frame = 3
Query:   45 ENDVYSKPANNLNIINFNVAETPLTLFNNNSENAVDDTMKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESILAGDDFDSXXXXXXXXXXXXXXXXXXXXDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIREENQLLMEKRARNERNKAFIQLKKRRMQPXXXXXXXXXXELKFSTLENEIQKLKADLKDSQXXXXXXXXXXXXLIQEKEQLQVQCRTLEFRAQISTKSVQPFVKADYSFDESKANVSIMDISCSSLVAMVNPYATLLPAPSDRFSLFSRNVSQDNNSTEISTSGPSSMPQQYDTVEYLXXXXXXXXXXXXNRSSNHNGNAPCSEGEGSFLQHEKECAIDELQNELSRMTLESGKKSAEICQLQEQLELMHTKIASREKSIEKYVAKEAEAGKLLNILLSQLQVPTSNDIGKIRRKLKLLSRAIQKIHEEFVEIIPERKALSDWTNSPDTSAGCDNFHSLSNQMVAHARKLDRELQATSNKYRKLLSICNRCIIDKAAAFLEMDFQILSVDTSLSVVAQTFQSVWKSAIDKVESLAAPADGTRTDQSAVESQLPTNSSDENDDPSPCHSSLHLSQNGSDQAH 3161
            ENDVYSKPANNLNIINFNVAETPLTLFNNNSENAVDDTMKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDSQKLLKEKSILLKLSEKESSDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESILAGDDFDSDETIEIATDAEEEEEYEEEYDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIREENQLLMEKRARNERNKAFIQLKKRRMQPDIDLSDSSSDELKFSTLENEIQKLKADLKDSQEETAEARETIEILIQEKEQLQVQCRTLEFRAQISTKSVQPFVKADYSFDESKANVSIMDISCSSLVAMVNP                 NVSQDNNSTEISTSGPS+ PQQYDTVEYLSSPEAPIPSPIINRSSNHNGNAPCSE EGSFLQHEKECAIDELQNELSRMTLE+GKKSAEICQLQEQLELMHTKIASREKSIEKYVAKEAEAGKLLNILLSQLQVPTSNDIGKIRRKLKLLSRAIQKIHEEFVEIIPERKALSDWTNSPD SAGCDNFHSLSNQMVAHARKLDRELQATSNKYRKLLSICNRCIIDKAAAFLEMDFQILSVDTSLSVVAQTFQSVWKSAIDKVESLAAPADGTRTDQSAVESQLPTNSSDENDDPSPCHSSLHLSQNGSDQAH
Sbjct:    8 ENDVYSKPANNLNIINFNVAETPLTLFNNNSENAVDDTMKIFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDSQKLLKEKSILLKLSEKESSDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESILAGDDFDSDETIEIATDAEEEEEYEEEYDAQELLDIIERLKTELIAVKKEKVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIREENQLLMEKRARNERNKAFIQLKKRRMQPDIDLSDSSSDELKFSTLENEIQKLKADLKDSQEETAEARETIEILIQEKEQLQVQCRTLEFRAQISTKSVQPFVKADYSFDESKANVSIMDISCSSLVAMVNP-----------------NVSQDNNSTEISTSGPSNRPQQYDTVEYLSSPEAPIPSPIINRSSNHNGNAPCSESEGSFLQHEKECAIDELQNELSRMTLEAGKKSAEICQLQEQLELMHTKIASREKSIEKYVAKEAEAGKLLNILLSQLQVPTSNDIGKIRRKLKLLSRAIQKIHEEFVEIIPERKALSDWTNSPDASAGCDNFHSLSNQMVAHARKLDRELQATSNKYRKLLSICNRCIIDKAAAFLEMDFQILSVDTSLSVVAQTFQSVWKSAIDKVESLAAPADGTRTDQSAVESQLPTNSSDENDDPSPCHSSLHLSQNGSDQAH 1029          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000078501.1 (SMESG000078501.1)

HSP 1 Score: 174.481 bits (441), Expect = 6.662e-45
Identity = 137/424 (32.31%), Postives = 206/424 (48.58%), Query Frame = 3
Query:  147 VDDTMK---IFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNN--ELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAV---RTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKV 1394
            +D+T++   +F R +PLN    +S     + FTISA PPE  ++ KN          K++F+KVF   + Q  VFND +  L++D +   + LLF YG T SGKT++M G   N G+I R + +LF+        L+ P +      + +TD+   +            +   V +M         N +S++  E++ ++N    T ++S  EIY   I DL          G  +  R +  ++  +    Y+  +K   V S  EA      G R++ I  T LN NSSRSH I  IR V   R     E LS V   S  DLAGSER  +   SG   KEA +IN+SL+ L   ++ L+       +  I+ YR +KLT L +T    N K  MIVCV Q P  ++ET+ VL F+  +K++
Sbjct:    2 MDNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPE--INRKNTKE------IKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYM---------NAISDDPFEVNKVDN---CTVFVSMVEIYGNNIKDLF--------IGKREASREVT-VKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLS-VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKH-KTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEI 394          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000078501.1 (SMESG000078501.1)

HSP 1 Score: 174.096 bits (440), Expect = 8.197e-45
Identity = 137/424 (32.31%), Postives = 206/424 (48.58%), Query Frame = 3
Query:  147 VDDTMK---IFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNN--ELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAV---RTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKV 1394
            +D+T++   +F R +PLN    +S     + FTISA PPE  ++ KN          K++F+KVF   + Q  VFND +  L++D +   + LLF YG T SGKT++M G   N G+I R + +LF+        L+ P +      + +TD+   +            +   V +M         N +S++  E++ ++N    T ++S  EIY   I DL          G  +  R +  ++  +    Y+  +K   V S  EA      G R++ I  T LN NSSRSH I  IR V   R     E LS V   S  DLAGSER  +   SG   KEA +IN+SL+ L   ++ L+       +  I+ YR +KLT L +T    N K  MIVCV Q P  ++ET+ VL F+  +K++
Sbjct:    1 MDNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPE--INRKNTKE------IKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYM---------NAISDDPFEVNKVDN---CTVFVSMVEIYGNNIKDLF--------IGKREASREVT-VKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLS-VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKH-KTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEI 393          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000018967.1 (SMESG000018967.1)

HSP 1 Score: 166.007 bits (419), Expect = 3.127e-42
Identity = 134/427 (31.38%), Postives = 200/427 (46.84%), Query Frame = 3
Query:  165 IFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFSKLSNNPLLMP-------VDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNN--ELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAV---RTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVLFEK 1409
            +F R +PLN    +S     + FT+SA PPE  ++ KN          K++F+KVF   + Q  VFND +  L++D +   + LLF YG T SGKT++M G   N G+I R + +LF+        ++ P       V +  VC                    +  +   V +M         N +S++  E++ ++N    T ++S  EIY   I DL          G  +  R +  ++  +    Y+  +K   V S  EA      G R++ I  T LN NSSRSH I  IR V   R     E LS V   S  DLAGSER  +   SG   KEA +IN+SL+ L   ++ L+       +  I+ YR +KLT L +T    N K  MIVCV Q P  ++ET+ VL F+  +K++ +  +
Sbjct:   10 VFCRLKPLNDENIKSCIQYENEFTVSAVPPE--INRKNTKE------IKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNKNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFVIKPDERNGFTVLYDIVCN--------------KNNYSTSGDHDCVAYM---------NAISDDPFEVNKVDN---CTVFVSMVEIYGNNIKDLF--------IGKREASREVT-VKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRNKSNGECLS-VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKH-KTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITR 391          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000003085.1 (SMESG000003085.1)

HSP 1 Score: 135.576 bits (340), Expect = 3.880e-32
Identity = 107/383 (27.94%), Postives = 169/383 (44.13%), Query Frame = 3
Query:  306 QKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDXXXXXXXXXXXXXXXXXXXXDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKVCN---FSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKVVL------FEKEKPVAV 1427
            ++F F K+F  +S QE V+ + S  ++     G +  +  YG T SGKT+TM G  S +G+  +A+  L                  E+C  +K+                                       N ELS           ++  EIYNE + DLL P            K   +++R        V G+ S PV ++ +  +++ +G  ++ +  TK+N +SSRSH I+T+       G + LS +      +  DLAGSER  K   SG    EA+ IN SL +LG+    L+ NQL+      +PYR+SKLT + +  LGG+ KA + V ++ D     E++  L+F + A++V L       +K  PV V
Sbjct:  426 KQFQFDKIFAEDSKQEAVYAEVS-PIITSCADGYNVTILAYGQTGSGKTYTMQGTSSEVGVNKKAIEELL-----------------EICSKRKS--------------------------------------VNYELS-----------VTMVEIYNENVQDLLSP------------KVETVELRATGTHSVSVMGVTSLPVKTSNDIIKIMNLGNSNRKVAETKMNSSSSRSHLIVTVNLT----GIDNLSGLVTKGQLNMVDLAGSERVSKTDASGARLTEAAFINKSLTSLGQVFQALRTNQLH------IPYRNSKLTHILEPSLGGDAKACLFVNISPDEANIQESLSSLQFGSNARQVALGQAKANVQKAAPVKV 719          
The following BLAST results are available for this feature:
BLAST of Kinesin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF20B9.956e-6732.72kinesin family member 20B [Source:HGNC Symbol;Acc:... [more]
KIF20B2.230e-6632.72kinesin family member 20B [Source:HGNC Symbol;Acc:... [more]
KIF232.702e-5632.68kinesin family member 23 [Source:HGNC Symbol;Acc:H... [more]
KIF237.169e-5632.68kinesin family member 23 [Source:HGNC Symbol;Acc:H... [more]
KIF238.902e-5632.68kinesin family member 23 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zen-41.920e-4932.46Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
zen-42.252e-4932.46Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
zen-42.252e-4932.46Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
zen-42.764e-4932.46Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
zen-44.687e-4932.46Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pav1.190e-5531.49gene:FBgn0011692 transcript:FBtr0073227[more]
sub2.051e-5233.10gene:FBgn0003545 transcript:FBtr0340277[more]
sub2.051e-5233.10gene:FBgn0003545 transcript:FBtr0086881[more]
Klp31E4.437e-4028.67gene:FBgn0032243 transcript:FBtr0302039[more]
Klp31E4.437e-4028.67gene:FBgn0032243 transcript:FBtr0080018[more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif20a1.328e-7636.63kinesin family member 20A [Source:ZFIN;Acc:ZDB-GEN... [more]
kif20a1.328e-7636.63kinesin family member 20A [Source:ZFIN;Acc:ZDB-GEN... [more]
zgc:562314.206e-7231.11zgc:56231 [Source:ZFIN;Acc:ZDB-GENE-040426-1914][more]
BX649437.11.685e-6834.42kinesin family member 20Ba [Source:NCBI gene;Acc:4... [more]
BX649437.21.685e-6834.42kinesin family member 20Ba [Source:NCBI gene;Acc:4... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
marveld21.641e-7735.07MARVEL domain containing 2 [Source:Xenbase;Acc:XB-... [more]
marveld21.862e-7735.57MARVEL domain containing 2 [Source:Xenbase;Acc:XB-... [more]
marveld22.323e-7735.33MARVEL domain containing 2 [Source:Xenbase;Acc:XB-... [more]
marveld24.077e-7735.51MARVEL domain containing 2 [Source:Xenbase;Acc:XB-... [more]
marveld24.292e-7735.51MARVEL domain containing 2 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif20b6.119e-7136.15kinesin family member 20B [Source:MGI Symbol;Acc:M... [more]
Kif20b7.740e-7136.15kinesin family member 20B [Source:MGI Symbol;Acc:M... [more]
Kif231.372e-5531.18kinesin family member 23 [Source:MGI Symbol;Acc:MG... [more]
Kif239.884e-5532.09kinesin family member 23 [Source:MGI Symbol;Acc:MG... [more]
Kif20a1.077e-5336.77kinesin family member 20A [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80WE4|KI20B_MOUSE4.280e-7036.15Kinesin-like protein KIF20B OS=Mus musculus OX=100... [more]
sp|Q96Q89|KI20B_HUMAN1.071e-6532.72Kinesin-like protein KIF20B OS=Homo sapiens OX=960... [more]
sp|Q29RT6|KI20A_BOVIN1.535e-5539.13Kinesin-like protein KIF20A OS=Bos taurus OX=9913 ... [more]
sp|Q02241|KIF23_HUMAN4.275e-5532.68Kinesin-like protein KIF23 OS=Homo sapiens OX=9606... [more]
sp|O95235|KI20A_HUMAN7.553e-5538.63Kinesin-like protein KIF20A OS=Homo sapiens OX=960... [more]
back to top
BLAST of Kinesin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8WZH93.587e-9241.79Kinesin motor domain protein (Fragment) OS=Opistho... [more]
A0A074Z0233.764e-9241.79Kinesin motor domain-containing protein OS=Opistho... [more]
A0A3R7JSB14.084e-9241.86Kinesin-like protein KIF20A (Fragment) OS=Clonorch... [more]
A0A4Z2DCZ37.464e-9236.22Kinesin-like protein OS=Schistosoma japonicum OX=6... [more]
A0A4S2L5R71.526e-9141.91Kinesin motor domain-containing protein OS=Opistho... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif20a6.299e-8032.69kinesin family member 20A [Source:NCBI gene;Acc:10... [more]
kif20a9.478e-8032.69kinesin family member 20A [Source:NCBI gene;Acc:10... [more]
zgc:562312.310e-7534.35zgc:56231 [Source:ZFIN;Acc:ZDB-GENE-040426-1914][more]
kif20bb6.064e-6832.48kinesin family member 20Bb [Source:ZFIN;Acc:ZDB-GE... [more]
kif20bb6.432e-6831.62kinesin family member 20Bb [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif234.124e-5531.95kinesin family member 23 [Source:ZFIN;Acc:ZDB-GENE... [more]
KIF20A2.262e-5045.87kinesin family member 20A [Source:HGNC Symbol;Acc:... [more]
kif158.130e-3335.77kinesin family member 15 [Source:ZFIN;Acc:ZDB-GENE... [more]
KIF271.521e-3136.18kinesin family member 27 [Source:HGNC Symbol;Acc:H... [more]
ENSPMAT00000010887.11.974e-2836.11pep scaffold:Pmarinus_7.0:GL482947:9977:16429:1 ge... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIP32.305e-3036.96Kinesin-related antiparallel sliding motor protein... [more]
KIP25.954e-2836.53Kinesin-related motor protein involved in mitotic ... [more]
CIN89.972e-2435.75Kinesin motor protein; involved in mitotic spindle... [more]
KIP13.947e-2233.33Kinesin-related motor protein; required for mitoti... [more]
KAR31.019e-1431.00Minus-end-directed microtubule motor; functions in... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO321314.769e-6550.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329262.787e-6133.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272852.995e-4831.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496291.453e-3337.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470754.291e-3327.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:562313.505e-7533.81ribosomal protein S20 [Source:NCBI gene;Acc:101166... [more]
kif20a2.255e-7336.88kinesin family member 20A [Source:NCBI gene;Acc:10... [more]
ENSORLT00000025264.26.129e-6734.51kinesin-like protein KIF20B [Source:NCBI gene;Acc:... [more]
KIF231.201e-5231.57kinesin family member 23 [Source:NCBI gene;Acc:101... [more]
KIF232.802e-5232.39kinesin family member 23 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Kinesin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030852.10.000e+097.88SMESG000030852.1[more]
SMESG000078501.16.662e-4532.31SMESG000078501.1[more]
SMESG000078501.18.197e-4532.31SMESG000078501.1[more]
SMESG000018967.13.127e-4231.38SMESG000018967.1[more]
SMESG000003085.13.880e-3227.94SMESG000003085.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025245 ID=SMED30025245|Name=Kinesin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3219bp
TGATATTTTAAAGTTTTATAATCATGTTTACATCATTTATATCTGAAAAT
GATGTTTATAGTAAGCCTGCTAATAATTTGAATATTATCAATTTTAATGT
AGCTGAAACACCATTAACGCTATTTAATAATAATTCAGAAAATGCAGTTG
ATGATACAATGAAGATATTTTTGAGATTTAGGCCATTAAATATAAACCAA
GCTGAATCTCCTTTTGTTATATGCGATCCTTTCACTATATCTGCAACTCC
ACCTGAACAAAGTGTTAGTTACAAAAATCTTCTGCATGGCAATGGGAAAG
GTTTTCAAAAATTTTCTTTCTCCAAAGTTTTTATTCCCGAATCCGATCAA
GAATTAGTATTTAATGATACATCCAAGACACTTTTACAAGATTTTATCAA
AGGAAATGATCGATTACTTTTTACTTATGGAACAACAAGCAGTGGCAAAA
CTCACACAATGAATGGTAACAAATCAAATTTAGGAATCATACCCAGAGCT
CTATTTAATCTATTTAAATTTTCAAAGTTATCAAATAATCCTCTATTAAT
GCCAGTTGACTTTGCTGAAGTTTGTCAAATTAAAAAAACCGATTCACAGA
AATTATTAAAAGAAAAAAGCATTTTATTGAAATTATCAGAAAAAGAATCA
TCCGATGTCTTGCATATGTTCAGCAATGGGGAATTTGTAGATGAAAATGT
TCTATCTAATAATGAATTATCGGACATTAATAATAACTACGAAACGACAT
TTTGGATATCTTATACTGAAATTTACAATGAATTGATTTACGATTTGCTT
GACCCGGTTTCGATTTCGTCTATTTCTGGAAATAACAAGCTGAAGCGGCC
GATTCTCGATATTAGAATTGCAAGGAACGGCGGATCCTATGTGAAAGGAT
TGAAATCCTATCCTGTTTATTCAGCCGAAGAAGCTTATCGACTATTATTG
GTTGGCAGACGTAGCCAGATCATTGGATCTACGAAACTAAACCAAAACAG
CTCTCGGTCGCATACGATTCTTACAATTCGAGCTGTCCGGACATATCCGG
GATCAGAATACCTATCAAAGGTGTGCAATTTCAGTTTTTGTGACCTGGCT
GGTAGTGAGCGCACCGACAAAGCCCAGACCTCGGGATTAATGCAAAAGGA
AGCATCGAATATCAATTCTAGCCTGCTAGCATTGGGCCGTTGCATTGACG
TGCTGAAATACAATCAGCTCAATCCAAACAATTTGCGAATCGTGCCGTAT
CGGGACAGTAAATTAACCCGATTGTTCCAAACGTATTTGGGCGGTAACGG
CAAGGCATCAATGATTGTCTGTGTCAATCAGGATCCTCGCCTGTTCGATG
AGACTATGCAAGTCCTGAAATTTAGTGCTCTAGCTAAGAAGGTCGTATTG
TTCGAGAAGGAGAAACCGGTTGCAGTCAATCCCAGTAAAGGTGGCCAACG
ATTGAGCATTTATAGGCGACTGGGAATGAAAACCCCGAAAACAGCTAGTA
AACGTGACACGATTGAATCAATATTGGCTGGAGATGATTTCGACTCGGAC
GAAACGATTGAGATAGCAACTGACGCAGAGGAAGAAGAGGAATACGAGGA
AGAGTACGATGCTCAGGAGCTGCTGGACATTATTGAGCGATTGAAAACAG
AATTGATTGCAGTAAAAAAAGAGAAAGTTTTTAATGAAGCTAAGTTGCGC
GAAAAACTAAACAACGATTGGAGCCAAACGATAATGCAAATGGAAAGAGA
CAATGCACAACATATTCAGCGGATACGGGAGGAAAATCAACTGCTGATGG
AGAAAAGAGCTCGAAATGAAAGGAACAAAGCTTTCATCCAACTGAAAAAG
CGTCGAATGCAACCCGATATCGATTTGTCCGATTCATCAAGCGATGAATT
GAAATTCAGCACATTAGAAAATGAAATCCAAAAATTAAAAGCCGATTTGA
AAGATTCCCAAGAAGAAACTGCAGAGGCGAGAGAAACAATAGAAATATTG
ATCCAAGAGAAGGAACAATTGCAGGTGCAGTGCAGAACATTGGAATTCCG
GGCGCAAATATCCACCAAATCCGTGCAGCCTTTTGTGAAAGCCGATTATT
CGTTTGATGAGTCCAAAGCAAACGTATCGATAATGGACATCAGCTGTTCC
AGTTTGGTAGCGATGGTCAATCCGTATGCAACTTTGTTACCCGCTCCGTC
GGATCGATTTTCACTGTTTTCCAGAAACGTCTCGCAAGATAACAACAGCA
CCGAAATCAGCACCAGCGGTCCTAGCAGCATGCCACAACAATACGATACC
GTGGAGTACCTCTCGTCACCAGAGGCACCAATCCCGTCACCGATAATCAA
TAGGAGCAGCAATCATAATGGCAATGCTCCTTGCAGCGAGGGTGAGGGCT
CGTTCCTGCAGCACGAAAAGGAATGTGCGATCGATGAGCTCCAGAACGAG
CTATCAAGGATGACGCTGGAGTCGGGCAAGAAATCCGCGGAAATCTGCCA
GCTTCAGGAACAGCTAGAACTGATGCATACAAAAATCGCTTCCCGAGAAA
AGAGTATCGAGAAATACGTGGCAAAAGAAGCGGAAGCGGGGAAACTGCTG
AACATATTGCTGAGCCAATTGCAAGTGCCGACTAGCAATGATATCGGCAA
AATCAGGCGAAAACTGAAATTGTTGTCAAGGGCGATTCAGAAAATCCATG
AGGAATTTGTAGAAATCATTCCCGAGAGAAAAGCTTTATCGGATTGGACA
AATTCTCCTGATACAAGCGCTGGATGCGACAATTTCCATTCGCTGTCCAA
TCAGATGGTGGCACACGCGAGAAAACTCGACCGGGAGCTGCAAGCTACCA
GCAATAAGTACCGCAAGCTCCTGTCGATATGCAATCGATGCATTATCGAT
AAGGCTGCCGCGTTTCTGGAGATGGACTTCCAGATTTTGAGTGTAGACAC
TTCTCTGTCTGTGGTTGCGCAAACCTTTCAGTCGGTTTGGAAAAGCGCTA
TCGATAAAGTTGAATCTCTCGCCGCTCCTGCAGATGGAACCCGTACGGAC
CAATCAGCGGTCGAATCCCAGTTGCCTACTAACAGTTCCGATGAAAATGA
TGATCCGTCACCATGCCACAGTTCCTTGCATTTATCTCAGAACGGATCAG
ATCAAGCCCACTGAGGCCAGTAATACAAGATGAGAAAATATTTCAGATTA
TCATGAGAATGTATTTTTG
back to top

protein sequence of SMED30025245-orf-1

>SMED30025245-orf-1 ID=SMED30025245-orf-1|Name=SMED30025245-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1047bp
MFTSFISENDVYSKPANNLNIINFNVAETPLTLFNNNSENAVDDTMKIFL
RFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFS
KVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNK
SNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDSQKLLKEKSI
LLKLSEKESSDVLHMFSNGEFVDENVLSNNELSDINNNYETTFWISYTEI
YNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYS
AEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAVRTYPGSEYLSKV
CNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLN
PNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKF
SALAKKVVLFEKEKPVAVNPSKGGQRLSIYRRLGMKTPKTASKRDTIESI
LAGDDFDSDETIEIATDAEEEEEYEEEYDAQELLDIIERLKTELIAVKKE
KVFNEAKLREKLNNDWSQTIMQMERDNAQHIQRIREENQLLMEKRARNER
NKAFIQLKKRRMQPDIDLSDSSSDELKFSTLENEIQKLKADLKDSQEETA
EARETIEILIQEKEQLQVQCRTLEFRAQISTKSVQPFVKADYSFDESKAN
VSIMDISCSSLVAMVNPYATLLPAPSDRFSLFSRNVSQDNNSTEISTSGP
SSMPQQYDTVEYLSSPEAPIPSPIINRSSNHNGNAPCSEGEGSFLQHEKE
CAIDELQNELSRMTLESGKKSAEICQLQEQLELMHTKIASREKSIEKYVA
KEAEAGKLLNILLSQLQVPTSNDIGKIRRKLKLLSRAIQKIHEEFVEIIP
ERKALSDWTNSPDTSAGCDNFHSLSNQMVAHARKLDRELQATSNKYRKLL
SICNRCIIDKAAAFLEMDFQILSVDTSLSVVAQTFQSVWKSAIDKVESLA
APADGTRTDQSAVESQLPTNSSDENDDPSPCHSSLHLSQNGSDQAH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR027326KIF20A
IPR027640Kinesin-like_fam
IPR001752Kinesin_motor_dom
IPR027417P-loop_NTPase
Vocabulary: cellular component
TermDefinition
GO:0005794Golgi apparatus
GO:0005874microtubule
Vocabulary: biological process
TermDefinition
GO:0000281mitotic cytokinesis
GO:0007018microtubule-based movement
GO:0007088regulation of mitotic nuclear division
Vocabulary: molecular function
TermDefinition
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0008017microtubule binding
GO:0000166nucleotide binding
GO:0003774motor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 799..826
NoneNo IPR availableCOILSCoilCoilcoord: 533..553
NoneNo IPR availableCOILSCoilCoilcoord: 631..679
NoneNo IPR availableCOILSCoilCoilcoord: 573..604
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1007..1049
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1004..1049
IPR001752Kinesin motor domainPRINTSPR00380KINESINHEAVYcoord: 410..431
score: 59.05
coord: 323..340
score: 49.17
coord: 355..373
score: 42.32
coord: 130..151
score: 53.11
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 46..466
e-value: 6.0E-88
score: 308.2
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 54..460
e-value: 1.9E-86
score: 290.0
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 48..460
score: 86.427
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 225..462
e-value: 1.7E-63
score: 216.7
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 28..224
e-value: 7.9E-26
score: 92.6
IPR027326Kinesin-like protein KIF20APANTHERPTHR24115:SF352KINESIN-LIKE PROTEIN KIF20Acoord: 209..670
coord: 41..184
IPR027640Kinesin-like proteinPANTHERPTHR24115FAMILY NOT NAMEDcoord: 209..670
coord: 41..184
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 50..553