Roundabout, axon guidance receptor, homolog 1 (Drosophila)

Overview
NameRoundabout, axon guidance receptor, homolog 1 (Drosophila)
Smed IDSMED30025239
Length (bp)4177
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Roundabout, axon guidance receptor, homolog 1 (Drosophila) (SMED30025239) t-SNE clustered cells

Violin plots show distribution of expression levels for Roundabout, axon guidance receptor, homolog 1 (Drosophila) (SMED30025239) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Roundabout, axon guidance receptor, homolog 1 (Drosophila) (SMED30025239) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Roundabout, axon guidance receptor, homolog 1 (Drosophila) (SMED30025239) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025239

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30025239SMESG000066973.1 SmedASXL_010506SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30025239SMESG000066973.1 dd_Smed_v4_7921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025239SMESG000066973.1 dd_Smed_v4_7921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025239SMESG000066973.1 dd_Smed_v4_7921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30025239SMESG000066973.1 dd_Smed_v4_7921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025239SMESG000066973.1 dd_Smed_v4_7921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025239SMESG000066973.1 Contig8170newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025239SMESG000066973.1 Contig8170uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30025239SMESG000066973.1 dd_Smed_v6_7921_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30025239SMESG000066973.1 SMED30025239smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Human
Match: ROBO2 (roundabout guidance receptor 2 [Source:HGNC Symbol;Acc:HGNC:10250])

HSP 1 Score: 192.586 bits (488), Expect = 8.141e-49
Identity = 181/612 (29.58%), Postives = 259/612 (42.32%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGI-SALFPEDTSY--SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLP-PQNQTLIEGSTATFRCEVVSHMDVTITWYRG----PHNEPLQAGGRIKIPTKGALQI--LKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQVT-----YWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    ++   +     +   ++ +G L   R++        E    C A N LG AVS  AS  +A L  +F+ NP  +    +G    L C PP G P PT+ W K+  +I        +   +        L I N  K D+G Y C   N      S  + L +F    + +           + E +C +  +   TV W +    + +  R  ++    Y LR      +D G Y+C   ++ G+  EA   L V+AP  F+  P D+ V +G  V+F C   G P P V+W+  G  + LFP       SR  VS  G L I+N Q SDAG Y C   +   +  + A L V     +  P I L  P NQTL    TA  +C+        I+W +     P  +P     R  I  +G LQI  L+I    D+  YTC A+  S   +T W+A+L V    + I     L+D   L  PP     T+ T +SVTL+W      T     Y IE         W         T  TV  L PN+ Y F+VR+ N +GLS  S  ++ V+T
Sbjct:   31 PRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYK-DGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPT-DVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGK--------LMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKD---DADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK-MEASATLTVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPANQTLAVDGTALLKCKATGDPLPVISWLKEGFTFPGRDP-----RATIQEQGTLQIKNLRIS---DTGTYTCVATSSSG--ETSWSAVLDVTESGATISKNYDLSD---LPGPPSKPQVTDVTKNSVTLSWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRT 615          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Human
Match: ROBO2 (roundabout guidance receptor 2 [Source:HGNC Symbol;Acc:HGNC:10250])

HSP 1 Score: 192.586 bits (488), Expect = 8.226e-49
Identity = 181/612 (29.58%), Postives = 259/612 (42.32%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGI-SALFPEDTSY--SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLP-PQNQTLIEGSTATFRCEVVSHMDVTITWYRG----PHNEPLQAGGRIKIPTKGALQI--LKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQVT-----YWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    ++   +     +   ++ +G L   R++        E    C A N LG AVS  AS  +A L  +F+ NP  +    +G    L C PP G P PT+ W K+  +I        +   +        L I N  K D+G Y C   N      S  + L +F    + +           + E +C +  +   TV W +    + +  R  ++    Y LR      +D G Y+C   ++ G+  EA   L V+AP  F+  P D+ V +G  V+F C   G P P V+W+  G  + LFP       SR  VS  G L I+N Q SDAG Y C   +   +  + A L V     +  P I L  P NQTL    TA  +C+        I+W +     P  +P     R  I  +G LQI  L+I    D+  YTC A+  S   +T W+A+L V    + I     L+D   L  PP     T+ T +SVTL+W      T     Y IE         W         T  TV  L PN+ Y F+VR+ N +GLS  S  ++ V+T
Sbjct:   47 PRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYK-DGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPT-DVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGK--------LMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKD---DADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK-MEASATLTVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPANQTLAVDGTALLKCKATGDPLPVISWLKEGFTFPGRDP-----RATIQEQGTLQIKNLRIS---DTGTYTCVATSSSG--ETSWSAVLDVTESGATISKNYDLSD---LPGPPSKPQVTDVTKNSVTLSWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRT 631          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Human
Match: ROBO2 (roundabout guidance receptor 2 [Source:HGNC Symbol;Acc:HGNC:10250])

HSP 1 Score: 192.971 bits (489), Expect = 8.349e-49
Identity = 181/612 (29.58%), Postives = 259/612 (42.32%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGI-SALFPEDTSY--SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLP-PQNQTLIEGSTATFRCEVVSHMDVTITWYRG----PHNEPLQAGGRIKIPTKGALQI--LKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQVT-----YWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    ++   +     +   ++ +G L   R++        E    C A N LG AVS  AS  +A L  +F+ NP  +    +G    L C PP G P PT+ W K+  +I        +   +        L I N  K D+G Y C   N      S  + L +F    + +           + E +C +  +   TV W +    + +  R  ++    Y LR      +D G Y+C   ++ G+  EA   L V+AP  F+  P D+ V +G  V+F C   G P P V+W+  G  + LFP       SR  VS  G L I+N Q SDAG Y C   +   +  + A L V     +  P I L  P NQTL    TA  +C+        I+W +     P  +P     R  I  +G LQI  L+I    D+  YTC A+  S   +T W+A+L V    + I     L+D   L  PP     T+ T +SVTL+W      T     Y IE         W         T  TV  L PN+ Y F+VR+ N +GLS  S  ++ V+T
Sbjct:   31 PRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYK-DGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPT-DVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGK--------LMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKD---DADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK-MEASATLTVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPANQTLAVDGTALLKCKATGDPLPVISWLKEGFTFPGRDP-----RATIQEQGTLQIKNLRIS---DTGTYTCVATSSSG--ETSWSAVLDVTESGATISKNYDLSD---LPGPPSKPQVTDVTKNSVTLSWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRT 615          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Human
Match: ROBO1 (roundabout guidance receptor 1 [Source:HGNC Symbol;Acc:HGNC:10249])

HSP 1 Score: 190.66 bits (483), Expect = 4.537e-48
Identity = 178/605 (29.42%), Postives = 260/605 (42.98%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRL-IITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL---FPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPP--TEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    + +  +     +   ++ +G L  L I+   +++ +  VY C A N LG AVS  AS  +A L  +F+ NP+    A  G    + C PP G P PT+ W K+G  +    + R  I       +   L I    K D+GKY C   N      S  + L +     + K    L   + +SAE +C    + V TV W +  G   ++     + + L+   +   D G Y C   +  G+ +EA   L VQ P  F+  P D+ V  G  V+F C  +G P P ++W   G   L   +    S SRF VS+ G L I+N Q SD G Y C   +   +  + A L V     +  P VI   P NQT+    T    C        TI W +       Q   RIK    G LQI +     D+  YTC AS  S   +  W+A + V   + G+ V  P   +  L +P     P  T+ + ++VTL+W     S     +Y IE     S   W    ++       ++ L PN+ Y FLVR+ N  G+S  S  ++ VKT
Sbjct:   68 PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVET-DKDDPRSHRMLLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAV-GEPAVMECQPPRGHPEPTISWKKDGSPLDD-KDERITI-------RGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGK-AEASATLTVQEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTFVLSCVATGSPVPTILWRKDGVLVSTQ-DSRIKQLENGVLQI-RYAKLGDTGRYTCIASTPSG--EATWSAYIEVQ--EFGVPVQPPRPTDPNL-IPSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYIIEAFSHASGSSWQTVAENVKTETSAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKT 654          

HSP 2 Score: 118.242 bits (295), Expect = 7.359e-26
Identity = 107/409 (26.16%), Postives = 167/409 (40.83%), Query Frame = 3
Query:  393 NASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKE-----AYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASN---SRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKI-FSNSKYYKMQKELKYRISNSAEIQCPL---NEVGTVHWSRLGG-LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYW-----ELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYR-GPHN-----EPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCE 1547
            N  NSLGY       TG      +F   P I +         G    L+C   EGRP PT++W+K G ++ +  +   S  ++     L    I+  R  ++ D G Y C A N      S  ++L++      + +   ++   +   A ++C     +   T+ W + G  L+ +  R +  G  L     + SD+GKYVC  T+  G+    +  L V    SF++ P +  V   D   F C   G P+P V W     ELP            SR+ +  D +L I      D G YTC   + +    +SA L V++      P   + P++Q +  G T TF+CE   +    I W R G  N     +P Q+  R  +   G L I  +    D   Y C+
Sbjct:   49 NDDNSLGY-------TGSRLRQEDFP--PRIVEHPSDLIVSKGEPATLNCKA-EGRPTPTIEWYKGGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRK-SRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGELP-----------KSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQEP-----PHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQ-RSDVGYYICQ 429          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Human
Match: ROBO2 (roundabout guidance receptor 2 [Source:HGNC Symbol;Acc:HGNC:10250])

HSP 1 Score: 187.578 bits (475), Expect = 1.714e-47
Identity = 181/616 (29.38%), Postives = 259/616 (42.05%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQA----PASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGI-SALFPEDTSY--SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLP-PQNQTLIEGSTATFRCEVVSHMDVTITWYRG----PHNEPLQAGGRIKIPTKGALQI--LKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQVT-----YWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    ++   +     +   ++ +G L   R++        E    C A N LG AVS  AS  +A L  +F+ NP  +    +G    L C PP G P PT+ W K+  +I        +   +        L I N  K D+G Y C   N      S  + L +F    + +           + E +C +  +   TV W +    + +  R  ++    Y LR      +D G Y+C   ++ G+  EA   L V+A    P  F+  P D+ V +G  V+F C   G P P V+W+  G  + LFP       SR  VS  G L I+N Q SDAG Y C   +   +  + A L V     +  P I L  P NQTL    TA  +C+        I+W +     P  +P     R  I  +G LQI  L+I    D+  YTC A+  S   +T W+A+L V    + I     L+D   L  PP     T+ T +SVTL+W      T     Y IE         W         T  TV  L PN+ Y F+VR+ N +GLS  S  ++ V+T
Sbjct:   47 PRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYK-DGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPT-DVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGK--------LMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKD---DADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK-MEASATLTVRARPVAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPANQTLAVDGTALLKCKATGDPLPVISWLKEGFTFPGRDP-----RATIQEQGTLQIKNLRIS---DTGTYTCVATSSSG--ETSWSAVLDVTESGATISKNYDLSD---LPGPPSKPQVTDVTKNSVTLSWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRT 635          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Celegans
Match: sax-3 (pep chromosome:WBcel235:X:3451945:3465925:-1 gene:WBGene00004729.1 transcript:ZK377.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:sax-3)

HSP 1 Score: 175.252 bits (443), Expect = 6.988e-44
Identity = 175/631 (27.73%), Postives = 266/631 (42.16%), Query Frame = 3
Query:  102 LIQIVIFLNYITDTLTINAPVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKV---YCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNP-NKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGG-LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPG-ISALFPEDTSY-SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPP------QNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQ-AGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW-----SSTGQVT-YWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            L+   +  ++  D   + APVI E P       G+   L+C A    A  I+WY    +  I N   +N+   ++  G L  L +   +   +      YC ASN  G   S   S  LA L  +F+  P    +A  G    L CSPP G P P V W K+ +++      RY + +  +L       I +P ++ DSG Y C A N      S  + L +F   K+ +  K++   +  +    C +  +    + W R    + +  +  + +   LR   +Q SD G+YVC   + +G   EA  +L VQAP SF   P D++V  G   +F C + G P P  +W   G    LFP   S   R +VS  G+L I   +  D G Y C   +S  +  S A L V  + +        PP      QNQTL+ GS+A   C+        I+W R     P+     RI   + G+L I  +    D+ +YTC A  K+   ++ W+A L V    S  Q +  + D +     P        T   V L W     S  G +T Y I+Y      + W         T+  ++ L P+  Y F++R+ N KG+   SV +  V T
Sbjct:   13 LVLQAVIRSFCEDASNL-APVIIEHPIDVVVSRGSPATLNCGAKPSTA-KITWYK-DGQPVITNKEQVNSHRIVLDTGSLFLLKVNSGKNGKDSDAGAYYCVASNEHGEVKSNEGSLKLAMLREDFRVRPRT-VQALGGEMAVLECSPPRGFPEPVVSWRKDDKELRIQDMPRYTLHSDGNL-------IIDPVDRSDSGTYQCVANNMVGERVSNPARLSVFEKPKFEQEPKDMTVDVGAAVLFDCRVTGDPQPQITWKRKNEPMPVTRAYIAKDNRGLRIERVQPSDEGEYVCYARNPAGT-LEASAHLRVQAPPSFQTKPADQSVPAGGTATFECTLVGQPSPAYFWSKEGQQDLLFPSYVSADGRTKVSPTGTLTIEEVRQVDEGAYVCAGMNSAGSSLSKAALKVTTKAVTGNTPAKPPPTIEHGHQNQTLMVGSSAILPCQASGKPTPGISWLR--DGLPIDITDSRISQHSTGSLHIADLK-KPDTGVYTCIA--KNEDGESTWSASLTVEDHTSNAQFVR-MPDPSNFPSSPTQPIIVNVTDTEVELHWNAPSTSGAGPITGYIIQYYSPDLGQTWFNIPDYVASTEYRIKGLKPSHSYMFVIRAENEKGIGTPSVSSALVTT 625          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Celegans
Match: sax-3 (pep chromosome:WBcel235:X:3451945:3465925:-1 gene:WBGene00004729.1 transcript:ZK377.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:sax-3)

HSP 1 Score: 174.481 bits (441), Expect = 1.104e-43
Identity = 175/631 (27.73%), Postives = 266/631 (42.16%), Query Frame = 3
Query:  102 LIQIVIFLNYITDTLTINAPVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKV---YCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNP-NKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGG-LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPG-ISALFPEDTSY-SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPP------QNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQ-AGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW-----SSTGQVT-YWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            L+   +  ++  D   + APVI E P       G+   L+C A    A  I+WY    +  I N   +N+   ++  G L  L +   +   +      YC ASN  G   S   S  LA L  +F+  P    +A  G    L CSPP G P P V W K+ +++      RY + +  +L       I +P ++ DSG Y C A N      S  + L +F   K+ +  K++   +  +    C +  +    + W R    + +  +  + +   LR   +Q SD G+YVC   + +G   EA  +L VQAP SF   P D++V  G   +F C + G P P  +W   G    LFP   S   R +VS  G+L I   +  D G Y C   +S  +  S A L V  + +        PP      QNQTL+ GS+A   C+        I+W R     P+     RI   + G+L I  +    D+ +YTC A  K+   ++ W+A L V    S  Q +  + D +     P        T   V L W     S  G +T Y I+Y      + W         T+  ++ L P+  Y F++R+ N KG+   SV +  V T
Sbjct:   13 LVLQAVIRSFCEDASNL-APVIIEHPIDVVVSRGSPATLNCGAKPSTA-KITWYK-DGQPVITNKEQVNSHRIVLDTGSLFLLKVNSGKNGKDSDAGAYYCVASNEHGEVKSNEGSLKLAMLREDFRVRPRT-VQALGGEMAVLECSPPRGFPEPVVSWRKDDKELRIQDMPRYTLHSDGNL-------IIDPVDRSDSGTYQCVANNMVGERVSNPARLSVFEKPKFEQEPKDMTVDVGAAVLFDCRVTGDPQPQITWKRKNEPMPVTRAYIAKDNRGLRIERVQPSDEGEYVCYARNPAGT-LEASAHLRVQAPPSFQTKPADQSVPAGGTATFECTLVGQPSPAYFWSKEGQQDLLFPSYVSADGRTKVSPTGTLTIEEVRQVDEGAYVCAGMNSAGSSLSKAALKVTTKAVTGNTPAKPPPTIEHGHQNQTLMVGSSAILPCQASGKPTPGISWLR--DGLPIDITDSRISQHSTGSLHIADLK-KPDTGVYTCIA--KNEDGESTWSASLTVEDHTSNAQFVR-MPDPSNFPSSPTQPIIVNVTDTEVELHWNAPSTSGAGPITGYIIQYYSPDLGQTWFNIPDYVASTEYRIKGLKPSHSYMFVIRAENEKGIGTPSVSSALVTT 625          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 100.138 bits (248), Expect = 1.146e-20
Identity = 97/388 (25.00%), Postives = 173/388 (44.59%), Query Frame = 3
Query:  540 GRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIET---SRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKT--VLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGS-LHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALL----RVIYPDSGIQVMTPLNDETQLSLP 1667
            G P+P++KW KNG+++T   N R +        Q  +L+I   + + +GK+ C AEN  + V+     L +F+              +  +  + C    N    + W++ G L  ++   +R S +G  L   +L+ +D G Y C+  + +G  SEA +++ V  P    +   D +  +     ++  C+  G P+PQ+ W L G +       S     V+ D + + I+N   SD G YTC   +   + +   N+ V +      PVIS     Q +IEG  A   C V  +    ++W R  +       G ++  T G +  +    +LDS IY C A+ ++   +  +T  +    ++I    G  V+TP +  ++ SLP
Sbjct: 3793 GHPFPSIKWLKNGKEVTDDENIRIV-------EQGQVLQILRTDSDHAGKWSCVAEND-AGVKELEMVLDVFTPPVVSVKSDNPIKALGETITLFCNASGNPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGT-SEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQCLAQGKPVPQMRWTLNGTALTH----STPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQA-----PVISNGGTKQ-VIEGELAVIECLVEGYPAPQVSWLRNGNRVETGVQG-VRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPG--VLTP-SSGSKFSLP 4157          

HSP 2 Score: 94.3597 bits (233), Expect = 5.743e-19
Identity = 116/492 (23.58%), Postives = 190/492 (38.62%), Query Frame = 3
Query:  186 YFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIE-----KEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAEN-AFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGT----VHWSR----LGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFI-QTPDDKTVLEGDDVSFTCIVS-GFPLPQVYWELPGISALFPEDTSYSRFRVSKDGS-LHISNTQTSDAGKYTCNCHSSLDARHSSANL-FVKKRELEYYPV----------------ISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGR-IKIPTKGALQILKIDPNLDSNIYTCEAS 1553
            YF     + LSC A G+P P++ WY          G  + N  +  + G  S+ +       H+   Y C A +  G A     +T L        + P +E          G+ V   C    G+P+P ++WFKNG+ +    +  Y+  N+  L+      I     ED+G Y C  EN A   V+ A  NL +       +    ++  I     +QC    VG     + W +    L  LN        +G  L   + Q+ D G++ C   +  GQ S++   +V    +  +   P ++ ++EG D++ +C+V  G P P + W    I    P +   +  ++   GS L +      D GKYTC   S         N+  +KK E  Y P                 +++      +++G      C V       ITWY      P+    R   +     L + K D +  S +YTC+A+
Sbjct:  621 YFNMREGVNLSCEAMGDPKPEVHWY--------FKGRHLLNDYK-YQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARD---TTDLM-----LATPPKVEIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDLIKPDD--YIKINEGQLH------IMGAKDEDAGAYSCVGENMAGKDVQVA--NLSVGRVPTIIESPHTVRVNIERQVTLQCL--AVGIPPPEIEWQKGNVLLATLNNPRYTQLADGNLL-ITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLGHVPPEEQLIEGQDLTLSCVVVLGTPKPSIVW----IKDDKPVEEGPT-IKIEGGGSLLRLRGGNPKDEGKYTCIAVSPAGNSTLHINVQLIKKPEFVYKPEGGIVFKPTISGMDEKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYL--DGRPITPNSRDFTVTADNTLIVRKADKSY-SGVYTCQAT 1074          

HSP 3 Score: 90.1225 bits (222), Expect = 1.229e-17
Identity = 114/449 (25.39%), Postives = 189/449 (42.09%), Query Frame = 3
Query:  501 SGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISN-SAEIQCPLNEVGT-VHWSRLG-GLNIETSRA-SF-----EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASF---IQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDG-SLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIE------GSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGA-----LQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQVTYWIEYVRFGSR 1775
            SGN   L C P +G P PT+ W K+G  I    N RY+       +    L+I      D G+Y C A N+  +     + L++         ++E    I   S+E+ C  N  G  V W + G  +N +T R  SF      G  + F + + SDSG+Y C + + +G+ +  L +  V  P S    + + + +T++    V   C+VSG P P+VYW L     L P+  +Y    ++ +G +L I  +Q   AG YTC   ++           V K   ++   ++ PP  +   E      G T    C   S + ++  ++   H+E +Q G    I +K A     L +  I  + D   Y C A  ++ + K  +  ++          + TP   + Q   P +L          +TL  S+TG     I +++ G R
Sbjct: 2492 SGNPSTLHC-PAKGSPSPTITWLKDGNAI--EPNDRYVF-----FDAGRQLQISKTEGSDQGRYTCIATNSVGS-DDLENTLEVIIPPVIDGERREAVAVIEGFSSELFCDSNSTGVDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGE-ARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYW-LFDDKPLEPDSAAY---ELTNNGETLKIVRSQVEHAGTYTCEAQNN-----------VGKARKDFLVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHA-HDESVQNG---VITSKYAANEKTLNVTNIQLD-DEGFYYCTAVNEAGITKKFFKLIV----------IETPYFLDQQKLYPIIL-------GKRLTLDCSATGTPPPTILFMKDGKR 2893          

HSP 4 Score: 88.9669 bits (219), Expect = 2.513e-17
Identity = 92/376 (24.47%), Postives = 158/376 (42.02%), Query Frame = 3
Query:  504 GNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNL-KIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVH--WSRLGGLNIET---SRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGD-DVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYP 1610
            G  + L CS   G P PT+ + K+G+++  +     +          S L I NP KE  G+Y C AEN     RS    + ++    K  K    ++ +  +   ++CP+ +   VH  WSR  G + +    +++S +   L        D+  Y C   + +G  +EA+  + V  P          T +  D  +   C   G P P++ W L G   L     +Y +     D SL I N + +  G+YTC   +   A  +  + +V   E+   P + +  +   ++EG   T RCEV  + +  + W +    EP  +   ++  TK +   L+     D   YTC A+ K+   +T  T  + V+ P
Sbjct: 2868 GKRLTLDCSA-TGTPPPTILFMKDGKRLNESDEVDII---------GSTLVIDNPQKEVEGRYTCIAENKAG--RSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGG-AEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQ----GDLSLRIDNIKPNQEGRYTCVAENK--AGRAEQDTYV---EISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLK--DGEPYTS-DLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQT--TTDVEVLVP 3216          

HSP 5 Score: 85.5001 bits (210), Expect = 2.742e-16
Identity = 119/478 (24.90%), Postives = 181/478 (37.87%), Query Frame = 3
Query:  204 TLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYA--------VSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSI----LKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNE--VGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSL-DARHS-SANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTA 1589
            TLE+ CR +G P P+ISW+ L  K  IL   G+       K G LS L I   +   E +  C A N  G A          PP     + + R              G    + C    G P P V W K+G   TS            DL Q+S     L +R     D G Y C A N     ++ T+++++    +    ++ L+ +  N+  + C +    V  V W R  G  IE          L   N   +D GKY C  ++++G      +  V   P +F        ++EG+     C + G P P + W L G      ++   S     +  +L I   Q  D G YTC   +S  D+      N++ K    E         Q    + G     +C V+ +   T+TW RG    P  +  R  I     L+I  +    D+  Y+C A  ++  + T + A
Sbjct: 3052 TLEIPCRTEGIPPPEISWF-LDGK-PILEMPGVT-----YKQGDLS-LRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMR-----------VVEGRQTTIRCE-VFGNPEPVVNWLKDGEPYTS------------DLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQT-TTDVEVLVPPRIEDEERVLQGKEGNTYMVHCQVTGRPVPYVTWKR-NGKEIEQFNP-----VLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKP-TFETHETTFNIVEGESAKIECKIDGHPKPTISW-LKGGRPFNMDNIILS----PRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETI------DQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDS--RHTIVNNYDLKINSVTTE-DAGQYSCIAVNEAGNLTTHYAA 3475          

HSP 6 Score: 78.9518 bits (193), Expect = 2.948e-14
Identity = 121/513 (23.59%), Postives = 205/513 (39.96%), Query Frame = 3
Query:  141 TLTINAP--VITEMPKSYFPRYG-TLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAI------EKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIF----SNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHW--SRLGGLNIETS-RASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVL--EGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDG-SLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPV-ISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGA-LQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYP 1610
            TLT++    +I+E+P       G T+E+ CRA G P    +W          NGI +    +      L  L I E +        C  +N  G        T     + + Q  P I         A  G+ VEL C   E  P  +V WF+ G  I + +   Y++ +         L I++ + ED+  Y C+A N       A +NL++      + K   +  +   + S+   + CP+  N +  + W  +    ++ +TS + S +   L     +++DSG Y C   + +G+ S++   + V  P +  ++   K V   EG++V+  C VSGFP+PQ+ W + G   +      Y    +S DG +LH  +      G Y C          S  N+     EL    V I     N  +  G   +  C++ +  D   T+    +         ++IP+ G  L I    P  ++  Y C  +  ++  K   T  L V+ P
Sbjct: 1263 TLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNK--------NGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAG--------TSQMTTHVDVQEPPIILPSTQTNNTAVVGDRVELKCYV-EASPPASVTWFRRGIAIGTDTKG-YVVESD------GTLVIQSASVEDATIYTCKASNPAG---KAEANLQVTVIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSF-QVEVIVPLNLDESKYKKKVFAKEGEEVTLGCPVSGFPVPQINWVVDG--TVVEPGKKYKGATLSNDGLTLHFDSVSVKQEGNYHC-------VAQSKGNILDIDVELSVLAVPIVGEDDNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSESDRPDNVQIPSDGHRLYITDAKPE-NNGKYMCRVT--NSAGKAERTLTLDVLEP 1735          

HSP 7 Score: 75.485 bits (184), Expect = 3.108e-13
Identity = 99/421 (23.52%), Postives = 167/421 (39.67%), Query Frame = 3
Query:  339 SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPN-------KEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYK--MQKELKYRISNSAEIQCPLNE-VGT-VHWSRLGG---LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQN-QTLIEGSTATFRCEVVSHMDVT--ITWYRGPHNEPLQA-GGRI-KIPTKGALQILKIDPNLDSNIYTC 1544
            +RL I      HE    C A+N+ G  VS      +  L +    N  +  E   G ++ L+C   EG P PT KW                  NQ DL + ++    N         K  +G Y C A N        T N+ + +  ++     + EL   ++ S  ++C +++ +G  + W+  G       +  +    G +L   + +  D G Y C +T+++G  ++   NL VQ P + +    + TV+E + +   C V+G P P V W   G     P     S   +S+     I + + +  G Y C   + +     S ++ +  R     P+I    +N  T I+G    F+C +    +    I W R      L+A   RI ++     L IL +  N D   Y+C
Sbjct: 1878 TRLTILNANRDHEDIYTCVANNTAG-QVSKDFDVVVQVLPK--IKNAVVTLEINEGEEIILTCDA-EGNPTPTAKWD----------------FNQGDLPKEAVFVNNNHTVVVNNVTKYHTGVYKCYATNKVGQA-VKTINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVGISWTVNGKPFLAETDGVQTLAGGRFLHIVSAKTDDHGSYACTVTNEAGVATKTF-NLFVQVPPTIVNEGGEYTVIENNSLVLPCEVTGKPNPVVTWTKDG----RPVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITR-----PMIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTEN-DEGQYSC 2266          

HSP 8 Score: 73.559 bits (179), Expect = 1.288e-12
Identity = 124/509 (24.36%), Postives = 200/509 (39.29%), Query Frame = 3
Query:  195 RYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEK-------EAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAEN-AFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASF--EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINL--VVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDT--SYSRFRVSKDG-SLHISNTQTSDAGKYTC-----------------NCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLD-SNIYTCEASLKSNLMKTRWTALLRVIYP 1610
             + T+ LSC A G+P PDI+W+      K    I I N   I+  G L  ++L IT  +     K  C A NS G             +N N  + P IEK       E+     V +SC P   RP   + W K G+ + S    +++ T+      Y + K+R   + DS KY C A N A +  R    ++ +  +     + + +     N + + CP   +   T+ W + G       R  F   G  L+ +  + SD G+Y C  T+  G  S+ L N   V+  P    +  +   V+EG      C  +   +  V W+  G++    +DT    S  ++   G  +   + + SD+G+YTC                 N   S+    SSAN+   +  + YYPV                   C V       + W     ++PL+        T     +  +   ++ +  YTCEA  ++N+ K R   L+RV  P
Sbjct: 2302 EHSTVTLSCPATGKPEPDITWF------KDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQD--------VNVNVITIPKIEKDGIPSDYESQQNERVVISC-PVYARPPAKITWLKAGKPLQS---DKFVKTSANGQKLY-LFKLR---ETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVG--SDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFCDSNSTGV-DVEWQKDGLT--INQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANI---QTIVPYYPV----------------EINCVVSGSPHPKVYWLF--DDKPLEPDSAAYELTNNGETLKIVRSQVEHAGTYTCEA--QNNVGKARKDFLVRVTAP 2760          

HSP 9 Score: 72.7886 bits (177), Expect = 1.994e-12
Identity = 144/622 (23.15%), Postives = 241/622 (38.75%), Query Frame = 3
Query:  165 ITEMPKSYFPRYGTLELSCRADGEPAPDISW------YDLQSKQKILNGIGIN-NPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYK---MQKELKYRISNSAEIQCPLNEVG--TVHWSRLG-GLNIETSRASFEGYYLRFN--NLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVS-----GFPLPQVYWELPGISALFPEDTSYSRFRVSKDG-SLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLP---PQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKG-ALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVL----DPPTEKTADSVTLTWSSTGQVTYWIEYVRFGSREGWVIYKKDWPD--------TKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYV 1919
            I + PK+     G + L C   G P P ++W          S+  I+N   +  N V    AG  S                C A N  G   +  A+  +      F        E    + + + C     RP P++ WF+  + +      RY I+  PD +  +I K +     D GKY C+A N   T       LKI    K  K   +   L   ++ +  ++CP++ +    V W++ G  +N+  SR         F   N+Q++D G+Y C  T++ G+ S      V+  P   I         EGD ++ TC +         +  V W     S     D +     +S DG  L IS     +AG YTC   +    R   A+L   K E+   PVI +     Q Q  +   T   RC V  H   +I W +  + + +     I+I  +G  LQIL+ D +                   +W+    V   D+G++ +  + D   +  PPV+    D P +   +++TL  +++G     +++ + GS    +I+  D PD         ++ + +L       +  ++ N  G S ASV  + +
Sbjct: 3396 IDQTPKAV--AGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYS----------------CIAVNEAGNLTTHYAAEVIG--KPTFVRKGGNLYEVIENDTITMDCGV-TSRPLPSISWFRGDKPVYLYD--RYSIS--PDGSHITINKAK---LSDGGKYICRASNEAGT-SDIDLILKILVPPKIDKSNIIGNPLAI-VARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWTKD--SRALDGDLT-DNVDISDDGRKLTISQASLENAGLYTCIALN----RAGEASLEF-KVEILSPPVIDISRNDVQPQVAVNQPT-IMRCAVTGHPFPSIKWLK--NGKEVTDDENIRIVEQGQVLQILRTDSD----------------HAGKWSC---VAENDAGVKELEMVLD---VFTPPVVSVKSDNPIKALGETITLFCNASGNPYPQLKWAKGGS----LIF--DSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVL 3948          

HSP 10 Score: 70.0922 bits (170), Expect = 1.605e-11
Identity = 88/381 (23.10%), Postives = 154/381 (40.42%), Query Frame = 3
Query:  495 AYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYC--QAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASF--EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQT--PDDKTVLEGDDVSFTCIVSGFPLPQVYWELPG----ISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLI-EGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVI 1604
            A  G +V L C P  G P P + W  +G  +      +    +   L     L   + + +  G Y+C  Q++     +    S L +    +   ++  L   IS S ++Q   ++  T  WS  G  +          +G+ L   + +  ++GKY+CR+T+ +G+ +E  + L V  P  F++     ++ ++  + +   C V+G P P V W++ G     S LF E  S  R       S  IS T  + AG              +S + F++       P        +T+  E  T T  C  VS  D  ITW +     PL     I       L IL  + + + +IYTC A+  +  +   +  +++V+
Sbjct: 1561 AKEGEEVTLGC-PVSGFPVPQINWVVDGTVVEPGKKYKGATLSNDGLT----LHFDSVSVKQEGNYHCVAQSKGNILDIDVELSVLAVPIVGEDDNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSESDRPDNVQIPSDGHRLYITDAKPENNGKYMCRVTNSAGK-AERTLTLDVLEPPVFVEPVFEANQKLIGNNPIILQCQVTGNPKPTVIWKIDGNDVDKSWLFDESLSLLRIEKLTGKSAQISCTAENKAGT-------------ASRDFFIQNIAA---PTFKNEGDQETIFRESETITLDCP-VSLGDFQITWMK--QGLPLTENDAIFTLDNTRLTILNANRDHE-DIYTCVANNTAGQVSKDFDVVVQVL 1915          

HSP 11 Score: 69.707 bits (169), Expect = 1.836e-11
Identity = 108/436 (24.77%), Postives = 173/436 (39.68%), Query Frame = 3
Query:  150 INAPVITEMPKSYFPRYGTL-ELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISN-SAEIQCPLNEVGTV--HWSRLG-GLNIETSRASFEGY-YLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFI-QTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPP--QNQTLIEGSTATFRCEVVSHMDVTITWY 1430
            +N P+I+    S+      L  + C   G+P P I+W  L   +    G+       + + G L+   + E    H     C+A N+ G        T       N ++    EK A   +D+ L C P +  P P   W   G +I S      LI +   + +   L ++N   E++G + CQ  N  +   S +  L +    K       +   +   + EI C    V  V   W++ G  L ++  + S +    LR      +D G Y C +T+++G  S+   ++ VQ P   +  T  + T + GD V   C V   P   V W   GI+      T    + V  DG+L I +    DA  YTC   +S  A  + ANL V    +   P I  P     +++ E    +  C V S+    I+WY
Sbjct: 1089 MNTPMISPGQSSFNMVVDDLFTIPCDVYGDPKPVITW--LLDDKPFTEGV-------VNEDGSLTIPNVNE---AHRGTFTCHAQNAAGNDTRTVTLTVHTTPTINAENQ---EKIALQNDDIVLEC-PAKALPPPVRLWTYEGEKIDSQ-----LIPHT--IREDGALVLQNVKLENTGVFVCQVSN-LAGEDSLSYTLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNKNGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGT-SQMTTHVDVQEPPIILPSTQTNNTAVVGDRVELKCYVEASPPASVTWFRRGIAI----GTDTKGYVVESDGTLVIQSASVEDATIYTCK--ASNPAGKAEANLQVT---VIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWY 1490          

HSP 12 Score: 68.1662 bits (165), Expect = 5.343e-11
Identity = 80/373 (21.45%), Postives = 145/373 (38.87%), Query Frame = 3
Query:  492 EAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYR-----ISNSAEIQCPLNEVGTVH------------WSRLGGLNIE---TSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGS-LHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVV-SHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTC 1544
            + + G D+ LSC+      Y T+ W K G  I        L  +  D + ++I ++   + +D+G+Y C                ++ SN+  Y ++  ++ R     I     +  PL E   +H            W+R G        T R    G  L+ +++  +D+G Y C   +  G  +  +  L +  P S   TP D      + V+ +C   G P P+V+W   G   L     +  +++V +D   L+I +    D G Y C   S       + +L      L   P + +      +  G   +F C+ +       I W++    + ++    IKI  +G L I+    + D+  Y+C
Sbjct:  439 QEFVGRDLNLSCTVESASAY-TIYWVKTGEDIIGGP----LFYHNTDTSVWTIPEL---SLKDAGEYEC----------------RVISNNGNYSVKTRVETRESPPEIFGVRNVSVPLGEAAFLHCSTRSAGEVEIRWTRYGATVFNGPNTERNPTNGT-LKIHHVTRADAGVYECMARNAGGMSTRKM-RLDIMEPPSVKVTPQDVYFNMREGVNLSCEAMGDPKPEVHWYFKGRHLL-----NDYKYQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARDTTDLM-----LATPPKVEIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKN-GKDLIKPDDYIKI-NEGQLHIMGAK-DEDAGAYSC 772          

HSP 13 Score: 68.1662 bits (165), Expect = 5.479e-11
Identity = 83/362 (22.93%), Postives = 134/362 (37.02%), Query Frame = 3
Query:  204 TLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAY-------SGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGT------------VHWSRLGG---LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQ 1223
            T+ L C A G P P + W    S       +  ++P     +   +RL I   +        C A N+ G        T  A ++ +    P I ++         +   + L C   +G+P P ++W  NG  +T ++    + ++       + ++I N +  D G Y C AEN      + + NL        Y +       ISN    Q    E+              V W R G      ++  R   +G  L     +  DSG Y+C  T+++G   +A    V+ +P     TP   T   G   S  C V G+P P + W L G      E+       +  DG+LHI   +
Sbjct: 3875 TITLFCNASGNPYPQLKWAKGGS-------LIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAG--------TSEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQCLA-QGKPVPQMRWTLNGTALTHSTPGITVASDS------TFIQINNVSLSDKGVYTCYAENV-----AGSDNL-------MYNVDVVQAPVISNGGTKQVIEGELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPGVLTPSSGSKFSLPCAVRGYPDPIISWTLNGNDIKDGENG----HTIGADGTLHIEKAE 4198          

HSP 14 Score: 63.5438 bits (153), Expect = 1.384e-9
Identity = 94/409 (22.98%), Postives = 153/409 (37.41%), Query Frame = 3
Query:  126 NYITDTLTINAPVITEMPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYA---------VSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAEN--AFSTVRSATSNL---KIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASF--EGYYL-RFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFV 1301
            N + +   + APVI+              + C  +G PAP +SW  L++  ++  G+     V+ +  G +  L I E  +       C+A+N  G A         VSP   T          S P +   + SG+   L C+   G P P + W  NG  I    N   +  +         L I    +E    Y C A+N     T+      +   KI ++   Y    E          I+C +    +       G+ +  S      E Y L +  + ++SD G+Y C   +K+G  ++   NL V      ++ P  + V +GD V+  C  SG P P + W           +T       +K  S+  S+   S AG YTC   + + +     +L V
Sbjct: 4034 NLMYNVDVVQAPVISNGGTKQVIEGELAVIECLVEGYPAPQVSW--LRNGNRVETGV---QGVRYVTDGRM--LTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIIT----------STPGVLTPS-SGSKFSLPCAV-RGYPDPIISWTLNGNDIKDGENGHTIGAD-------GTLHIEKA-EERHLIYECTAKNDAGADTLEFPVQTIVAPKISTSGNRYINGSE-----GTETVIKCEIESESSEFSWSKNGVPLLPSNNLIFSEDYKLIKILSTRLSDQGEYSCTAANKAGNATQK-TNLNVGVAPKIMERPRTQVVHKGDQVTLWCEASGVPQPAITWYK---DNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIV 4406          

HSP 15 Score: 58.9214 bits (141), Expect = 3.929e-8
Identity = 89/385 (23.12%), Postives = 152/385 (39.48%), Query Frame = 3
Query:  132 ITDTLTINAPVITEMPKSYFPRYGTLELSCRADGEPAPDISW-YDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKE-----AYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVG----TVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYS-RFRVSKDGS-LHISNTQTSDAGKYTC 1250
            I+D L+ +A + T +P  Y+P    +E++C   G P P + W +D +  +       + N  + +K        I   + +H     C A N++G A          +L R   + P  EKE     A  G+ + L+C+     P  +V W  +   + +   +     N+  LN      + N   +D G YYC A N     +     + I   + Y+  Q++L Y I     +    +  G    T+ + + G    E+      G  L  +N Q    G+Y C   +K+G+ SE  + + V  P    +   +  V  GD ++  C +       + W     S  F +D     R + S D S L+I      DA  Y+C
Sbjct: 2668 ISDELS-SANIQTIVP--YYP----VEINCVVSGSPHPKVYWLFDDKPLEPDSAAYELTNNGETLK--------IVRSQVEHAGTYTCEAQNNVGKARK-------DFLVR-VTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYAANEKTLN------VTNIQLDDEGFYYCTAVNEAGITKKFFKLIVI--ETPYFLDQQKL-YPIILGKRLTLDCSATGTPPPTILFMKDGKRLNESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGR-SEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITW-----SRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSC 3014          

HSP 16 Score: 55.8398 bits (133), Expect = 3.296e-7
Identity = 77/286 (26.92%), Postives = 114/286 (39.86%), Query Frame = 3
Query:  495 AYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAF-STVRSATSNL--------KIFSNSK-------YYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPL-PQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFV 1301
            A  G  VEL CS   G P+PT+ W K+G+ I    +S++ I        YS LK+   +  DSG+Y C A+N+  S+  SA  N+        K  SN K       Y + Q   +        +  P N  G +H+   G L I           L  ++L+  D   Y C++ ++       L +     P   ++T D   V  GD V   C V+  PL   V W       +  +D  Y    V  + SL + N +  D G Y C   +S+        L V
Sbjct: 4581 AAIGAIVELRCSA-AGPPHPTITWAKDGKLI---EDSKFEIA-------YSHLKVTLNSTSDSGEYTCMAQNSVGSSTVSAFINVDNNILPTPKPSSNQKNVAVITCYERNQAYSRGLTWEYNGVPMPKNLAG-IHFMNNGSLVI-----------LDTSSLKEGDLELYTCKVRNRRRHSIPHLTSAFEGVPE--VKTIDKVEVNNGDSVVLDCEVTSDPLTTHVVW-TKNDQKMLDDDAIY----VLPNNSLVLLNVEKYDEGVYKCVASNSIGKAFDDTQLNV 4836          

HSP 17 Score: 55.0694 bits (131), Expect = 5.551e-7
Identity = 92/468 (19.66%), Postives = 165/468 (35.26%), Query Frame = 3
Query:  213 LSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGN-------DVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVG----TVHWSRLGG--LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFP--LPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISL--PPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGA-----LQILKIDPNLDSNIYTCEA 1550
            L+C A+G P P   W   Q           + P + +       +++      H     C A+N +G AV          +N + ++ P  E               + L C   +      + W  NG+   + ++    +           L I +   +D G Y C   N       AT    +F       + +  +Y +  +  +  P    G     V W++ G    ++++ +   EG   +  + +++  G Y+C   +  G    +    ++  P       +  T ++G  + F C +        Q+ W L     +  E       R+S D  L I N   +D G+Y+C   +      +  N F  K  +   P I +    +N+T +E ST T  C      +  ITW++    E +       I   G      L+I +I    D+  YTCEA
Sbjct: 1935 LTCDAEGNPTPTAKWDFNQG----------DLPKEAVFVNNNHTVVVNNVTKYHTGVYKCYATNKVGQAVK--------TINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGV-GISWTVNGKPFLAETDGVQTLAGG------RFLHIVSAKTDDHGSYACTVTNEAGV---ATKTFNLFVQVPPTIVNEGGEYTVIENNSLVLPCEVTGKPNPVVTWTKDGRPVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRPMIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIW-LRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKND-----AGENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFK--DGEAIHIENIADIIPNGELNGNQLKITRIKEG-DAGKYTCEA 2365          

HSP 18 Score: 52.7582 bits (125), Expect = 2.458e-6
Identity = 102/479 (21.29%), Postives = 180/479 (37.58%), Query Frame = 3
Query:  204 TLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEK------EAYSGNDVELSCSPPEGRPYP-TVKWFKNGRQIT-SASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQ-----AENAF---STVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEV--GTVHWSRLG-GLNIET-----SRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEAL-INLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDG-SLHISNTQTSDAGKYTC--NCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKG-ALQILKIDPNLDSNIYTCEAS 1553
            +L L C   G+P P ++W       K    +G    VQ++  G   +  I   E  H+    C A N +G        T     + +  + P I+K       A  G  +   C   + + +   + W +N + I   A ++R  IT    L+    L I N  + D G+Y C+      EN+F   +TV    + + +  +     ++        ++  + CP        + W + G  ++IE            G  L+   ++  D+GKY C   + +G   + + +N++          P D    + + V  +C V   P  ++ W   G         S    + S +G  L++   + +D+ KYTC     +  D R    ++ V     E   V  +     T+  G+ +T  C        TITW +      ++   R      G  LQI K + + D   YTC A+
Sbjct: 2115 SLVLPCEVTGKPNPVVTW------TKDGRPVGDLKSVQVLSEG--QQFKIVHAEIAHKGSYICMAKNDVG--------TAEISFDVDIITRPMIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDAR--ITR---LSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKTAVEH-------STVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPL-----QSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRI-----TVNSGNPSTLHCPAKGSPSPTITWLK--DGNAIEPNDRYVFFDAGRQLQISKTEGS-DQGRYTCIAT 2552          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 100.138 bits (248), Expect = 1.206e-20
Identity = 97/388 (25.00%), Postives = 173/388 (44.59%), Query Frame = 3
Query:  540 GRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIET---SRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKT--VLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGS-LHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALL----RVIYPDSGIQVMTPLNDETQLSLP 1667
            G P+P++KW KNG+++T   N R +        Q  +L+I   + + +GK+ C AEN  + V+     L +F+              +  +  + C    N    + W++ G L  ++   +R S +G  L   +L+ +D G Y C+  + +G  SEA +++ V  P    +   D +  +     ++  C+  G P+PQ+ W L G +       S     V+ D + + I+N   SD G YTC   +   + +   N+ V +      PVIS     Q +IEG  A   C V  +    ++W R  +       G ++  T G +  +    +LDS IY C A+ ++   +  +T  +    ++I    G  V+TP +  ++ SLP
Sbjct: 3793 GHPFPSIKWLKNGKEVTDDENIRIV-------EQGQVLQILRTDSDHAGKWSCVAEND-AGVKELEMVLDVFTPPVVSVKSDNPIKALGETITLFCNASGNPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGT-SEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQCLAQGKPVPQMRWTLNGTALTH----STPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQA-----PVISNGGTKQ-VIEGELAVIECLVEGYPAPQVSWLRNGNRVETGVQG-VRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPG--VLTP-SSGSKFSLP 4157          

HSP 2 Score: 94.3597 bits (233), Expect = 6.145e-19
Identity = 116/492 (23.58%), Postives = 190/492 (38.62%), Query Frame = 3
Query:  186 YFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIE-----KEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAEN-AFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGT----VHWSR----LGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFI-QTPDDKTVLEGDDVSFTCIVS-GFPLPQVYWELPGISALFPEDTSYSRFRVSKDGS-LHISNTQTSDAGKYTCNCHSSLDARHSSANL-FVKKRELEYYPV----------------ISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGR-IKIPTKGALQILKIDPNLDSNIYTCEAS 1553
            YF     + LSC A G+P P++ WY          G  + N  +  + G  S+ +       H+   Y C A +  G A     +T L        + P +E          G+ V   C    G+P+P ++WFKNG+ +    +  Y+  N+  L+      I     ED+G Y C  EN A   V+ A  NL +       +    ++  I     +QC    VG     + W +    L  LN        +G  L   + Q+ D G++ C   +  GQ S++   +V    +  +   P ++ ++EG D++ +C+V  G P P + W    I    P +   +  ++   GS L +      D GKYTC   S         N+  +KK E  Y P                 +++      +++G      C V       ITWY      P+    R   +     L + K D +  S +YTC+A+
Sbjct:  621 YFNMREGVNLSCEAMGDPKPEVHWY--------FKGRHLLNDYK-YQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARD---TTDLM-----LATPPKVEIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDLIKPDD--YIKINEGQLH------IMGAKDEDAGAYSCVGENMAGKDVQVA--NLSVGRVPTIIESPHTVRVNIERQVTLQCL--AVGIPPPEIEWQKGNVLLATLNNPRYTQLADGNLL-ITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLGHVPPEEQLIEGQDLTLSCVVVLGTPKPSIVW----IKDDKPVEEGPT-IKIEGGGSLLRLRGGNPKDEGKYTCIAVSPAGNSTLHINVQLIKKPEFVYKPEGGIVFKPTISGMDEKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYL--DGRPITPNSRDFTVTADNTLIVRKADKSY-SGVYTCQAT 1074          

HSP 3 Score: 90.1225 bits (222), Expect = 1.349e-17
Identity = 114/449 (25.39%), Postives = 189/449 (42.09%), Query Frame = 3
Query:  501 SGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISN-SAEIQCPLNEVGT-VHWSRLG-GLNIETSRA-SF-----EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASF---IQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDG-SLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIE------GSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGA-----LQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQVTYWIEYVRFGSR 1775
            SGN   L C P +G P PT+ W K+G  I    N RY+       +    L+I      D G+Y C A N+  +     + L++         ++E    I   S+E+ C  N  G  V W + G  +N +T R  SF      G  + F + + SDSG+Y C + + +G+ +  L +  V  P S    + + + +T++    V   C+VSG P P+VYW L     L P+  +Y    ++ +G +L I  +Q   AG YTC   ++           V K   ++   ++ PP  +   E      G T    C   S + ++  ++   H+E +Q G    I +K A     L +  I  + D   Y C A  ++ + K  +  ++          + TP   + Q   P +L          +TL  S+TG     I +++ G R
Sbjct: 2492 SGNPSTLHC-PAKGSPSPTITWLKDGNAI--EPNDRYVF-----FDAGRQLQISKTEGSDQGRYTCIATNSVGS-DDLENTLEVIIPPVIDGERREAVAVIEGFSSELFCDSNSTGVDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGE-ARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYW-LFDDKPLEPDSAAY---ELTNNGETLKIVRSQVEHAGTYTCEAQNN-----------VGKARKDFLVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHA-HDESVQNG---VITSKYAANEKTLNVTNIQLD-DEGFYYCTAVNEAGITKKFFKLIV----------IETPYFLDQQKLYPIIL-------GKRLTLDCSATGTPPPTILFMKDGKR 2893          

HSP 4 Score: 88.9669 bits (219), Expect = 2.805e-17
Identity = 92/376 (24.47%), Postives = 158/376 (42.02%), Query Frame = 3
Query:  504 GNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNL-KIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVH--WSRLGGLNIET---SRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGD-DVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYP 1610
            G  + L CS   G P PT+ + K+G+++  +     +          S L I NP KE  G+Y C AEN     RS    + ++    K  K    ++ +  +   ++CP+ +   VH  WSR  G + +    +++S +   L        D+  Y C   + +G  +EA+  + V  P          T +  D  +   C   G P P++ W L G   L     +Y +     D SL I N + +  G+YTC   +   A  +  + +V   E+   P + +  +   ++EG   T RCEV  + +  + W +    EP  +   ++  TK +   L+     D   YTC A+ K+   +T  T  + V+ P
Sbjct: 2868 GKRLTLDCSA-TGTPPPTILFMKDGKRLNESDEVDII---------GSTLVIDNPQKEVEGRYTCIAENKAG--RSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGG-AEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQ----GDLSLRIDNIKPNQEGRYTCVAENK--AGRAEQDTYV---EISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLK--DGEPYTS-DLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQT--TTDVEVLVP 3216          

HSP 5 Score: 85.5001 bits (210), Expect = 3.060e-16
Identity = 119/478 (24.90%), Postives = 181/478 (37.87%), Query Frame = 3
Query:  204 TLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYA--------VSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSI----LKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNE--VGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSL-DARHS-SANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTA 1589
            TLE+ CR +G P P+ISW+ L  K  IL   G+       K G LS L I   +   E +  C A N  G A          PP     + + R              G    + C    G P P V W K+G   TS            DL Q+S     L +R     D G Y C A N     ++ T+++++    +    ++ L+ +  N+  + C +    V  V W R  G  IE          L   N   +D GKY C  ++++G      +  V   P +F        ++EG+     C + G P P + W L G      ++   S     +  +L I   Q  D G YTC   +S  D+      N++ K    E         Q    + G     +C V+ +   T+TW RG    P  +  R  I     L+I  +    D+  Y+C A  ++  + T + A
Sbjct: 3052 TLEIPCRTEGIPPPEISWF-LDGK-PILEMPGVT-----YKQGDLS-LRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMR-----------VVEGRQTTIRCE-VFGNPEPVVNWLKDGEPYTS------------DLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQT-TTDVEVLVPPRIEDEERVLQGKEGNTYMVHCQVTGRPVPYVTWKR-NGKEIEQFNP-----VLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKP-TFETHETTFNIVEGESAKIECKIDGHPKPTISW-LKGGRPFNMDNIILS----PRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETI------DQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDS--RHTIVNNYDLKINSVTTE-DAGQYSCIAVNEAGNLTTHYAA 3475          

HSP 6 Score: 78.5666 bits (192), Expect = 3.548e-14
Identity = 121/513 (23.59%), Postives = 205/513 (39.96%), Query Frame = 3
Query:  141 TLTINAP--VITEMPKSYFPRYG-TLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAI------EKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIF----SNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHW--SRLGGLNIETS-RASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVL--EGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDG-SLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPV-ISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGA-LQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYP 1610
            TLT++    +I+E+P       G T+E+ CRA G P    +W          NGI +    +      L  L I E +        C  +N  G        T     + + Q  P I         A  G+ VEL C   E  P  +V WF+ G  I + +   Y++ +         L I++ + ED+  Y C+A N       A +NL++      + K   +  +   + S+   + CP+  N +  + W  +    ++ +TS + S +   L     +++DSG Y C   + +G+ S++   + V  P +  ++   K V   EG++V+  C VSGFP+PQ+ W + G   +      Y    +S DG +LH  +      G Y C          S  N+     EL    V I     N  +  G   +  C++ +  D   T+    +         ++IP+ G  L I    P  ++  Y C  +  ++  K   T  L V+ P
Sbjct: 1263 TLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNK--------NGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAG--------TSQMTTHVDVQEPPIILPSTQTNNTAVVGDRVELKCYV-EASPPASVTWFRRGIAIGTDTKG-YVVESD------GTLVIQSASVEDATIYTCKASNPAG---KAEANLQVTVIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSF-QVEVIVPLNLDESKYKKKVFAKEGEEVTLGCPVSGFPVPQINWVVDG--TVVEPGKKYKGATLSNDGLTLHFDSVSVKQEGNYHC-------VAQSKGNILDIDVELSVLAVPIVGEDDNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSESDRPDNVQIPSDGHRLYITDAKPE-NNGKYMCRVT--NSAGKAERTLTLDVLEP 1735          

HSP 7 Score: 75.485 bits (184), Expect = 3.497e-13
Identity = 99/421 (23.52%), Postives = 167/421 (39.67%), Query Frame = 3
Query:  339 SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPN-------KEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYK--MQKELKYRISNSAEIQCPLNE-VGT-VHWSRLGG---LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQN-QTLIEGSTATFRCEVVSHMDVT--ITWYRGPHNEPLQA-GGRI-KIPTKGALQILKIDPNLDSNIYTC 1544
            +RL I      HE    C A+N+ G  VS      +  L +    N  +  E   G ++ L+C   EG P PT KW                  NQ DL + ++    N         K  +G Y C A N        T N+ + +  ++     + EL   ++ S  ++C +++ +G  + W+  G       +  +    G +L   + +  D G Y C +T+++G  ++   NL VQ P + +    + TV+E + +   C V+G P P V W   G     P     S   +S+     I + + +  G Y C   + +     S ++ +  R     P+I    +N  T I+G    F+C +    +    I W R      L+A   RI ++     L IL +  N D   Y+C
Sbjct: 1878 TRLTILNANRDHEDIYTCVANNTAG-QVSKDFDVVVQVLPK--IKNAVVTLEINEGEEIILTCDA-EGNPTPTAKWD----------------FNQGDLPKEAVFVNNNHTVVVNNVTKYHTGVYKCYATNKVGQA-VKTINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVGISWTVNGKPFLAETDGVQTLAGGRFLHIVSAKTDDHGSYACTVTNEAGVATKTF-NLFVQVPPTIVNEGGEYTVIENNSLVLPCEVTGKPNPVVTWTKDG----RPVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITR-----PMIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTEN-DEGQYSC 2266          

HSP 8 Score: 73.559 bits (179), Expect = 1.310e-12
Identity = 124/509 (24.36%), Postives = 200/509 (39.29%), Query Frame = 3
Query:  195 RYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEK-------EAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAEN-AFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASF--EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINL--VVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDT--SYSRFRVSKDG-SLHISNTQTSDAGKYTC-----------------NCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLD-SNIYTCEASLKSNLMKTRWTALLRVIYP 1610
             + T+ LSC A G+P PDI+W+      K    I I N   I+  G L  ++L IT  +     K  C A NS G             +N N  + P IEK       E+     V +SC P   RP   + W K G+ + S    +++ T+      Y + K+R   + DS KY C A N A +  R    ++ +  +     + + +     N + + CP   +   T+ W + G       R  F   G  L+ +  + SD G+Y C  T+  G  S+ L N   V+  P    +  +   V+EG      C  +   +  V W+  G++    +DT    S  ++   G  +   + + SD+G+YTC                 N   S+    SSAN+   +  + YYPV                   C V       + W     ++PL+        T     +  +   ++ +  YTCEA  ++N+ K R   L+RV  P
Sbjct: 2302 EHSTVTLSCPATGKPEPDITWF------KDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQD--------VNVNVITIPKIEKDGIPSDYESQQNERVVISC-PVYARPPAKITWLKAGKPLQS---DKFVKTSANGQKLY-LFKLR---ETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVG--SDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFCDSNSTGV-DVEWQKDGLT--INQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANI---QTIVPYYPV----------------EINCVVSGSPHPKVYWLF--DDKPLEPDSAAYELTNNGETLKIVRSQVEHAGTYTCEA--QNNVGKARKDFLVRVTAP 2760          

HSP 9 Score: 72.7886 bits (177), Expect = 2.263e-12
Identity = 144/622 (23.15%), Postives = 241/622 (38.75%), Query Frame = 3
Query:  165 ITEMPKSYFPRYGTLELSCRADGEPAPDISW------YDLQSKQKILNGIGIN-NPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYK---MQKELKYRISNSAEIQCPLNEVG--TVHWSRLG-GLNIETSRASFEGYYLRFN--NLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVS-----GFPLPQVYWELPGISALFPEDTSYSRFRVSKDG-SLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLP---PQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKG-ALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVL----DPPTEKTADSVTLTWSSTGQVTYWIEYVRFGSREGWVIYKKDWPD--------TKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYV 1919
            I + PK+     G + L C   G P P ++W          S+  I+N   +  N V    AG  S                C A N  G   +  A+  +      F        E    + + + C     RP P++ WF+  + +      RY I+  PD +  +I K +     D GKY C+A N   T       LKI    K  K   +   L   ++ +  ++CP++ +    V W++ G  +N+  SR         F   N+Q++D G+Y C  T++ G+ S      V+  P   I         EGD ++ TC +         +  V W     S     D +     +S DG  L IS     +AG YTC   +    R   A+L   K E+   PVI +     Q Q  +   T   RC V  H   +I W +  + + +     I+I  +G  LQIL+ D +                   +W+    V   D+G++ +  + D   +  PPV+    D P +   +++TL  +++G     +++ + GS    +I+  D PD         ++ + +L       +  ++ N  G S ASV  + +
Sbjct: 3396 IDQTPKAV--AGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYS----------------CIAVNEAGNLTTHYAAEVIG--KPTFVRKGGNLYEVIENDTITMDCGV-TSRPLPSISWFRGDKPVYLYD--RYSIS--PDGSHITINKAK---LSDGGKYICRASNEAGT-SDIDLILKILVPPKIDKSNIIGNPLAI-VARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWTKD--SRALDGDLT-DNVDISDDGRKLTISQASLENAGLYTCIALN----RAGEASLEF-KVEILSPPVIDISRNDVQPQVAVNQPT-IMRCAVTGHPFPSIKWLK--NGKEVTDDENIRIVEQGQVLQILRTDSD----------------HAGKWSC---VAENDAGVKELEMVLD---VFTPPVVSVKSDNPIKALGETITLFCNASGNPYPQLKWAKGGS----LIF--DSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVL 3948          

HSP 10 Score: 69.707 bits (169), Expect = 1.776e-11
Identity = 88/381 (23.10%), Postives = 154/381 (40.42%), Query Frame = 3
Query:  495 AYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYC--QAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASF--EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQT--PDDKTVLEGDDVSFTCIVSGFPLPQVYWELPG----ISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLI-EGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVI 1604
            A  G +V L C P  G P P + W  +G  +      +    +   L     L   + + +  G Y+C  Q++     +    S L +    +   ++  L   IS S ++Q   ++  T  WS  G  +          +G+ L   + +  ++GKY+CR+T+ +G+ +E  + L V  P  F++     ++ ++  + +   C V+G P P V W++ G     S LF E  S  R       S  IS T  + AG              +S + F++       P        +T+  E  T T  C  VS  D  ITW +     PL     I       L IL  + + + +IYTC A+  +  +   +  +++V+
Sbjct: 1561 AKEGEEVTLGC-PVSGFPVPQINWVVDGTVVEPGKKYKGATLSNDGLT----LHFDSVSVKQEGNYHCVAQSKGNILDIDVELSVLAVPIVGEDDNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSESDRPDNVQIPSDGHRLYITDAKPENNGKYMCRVTNSAGK-AERTLTLDVLEPPVFVEPVFEANQKLIGNNPIILQCQVTGNPKPTVIWKIDGNDVDKSWLFDESLSLLRIEKLTGKSAQISCTAENKAGT-------------ASRDFFIQNIAA---PTFKNEGDQETIFRESETITLDCP-VSLGDFQITWMK--QGLPLTENDAIFTLDNTRLTILNANRDHE-DIYTCVANNTAGQVSKDFDVVVQVL 1915          

HSP 11 Score: 69.707 bits (169), Expect = 1.948e-11
Identity = 108/436 (24.77%), Postives = 173/436 (39.68%), Query Frame = 3
Query:  150 INAPVITEMPKSYFPRYGTL-ELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISN-SAEIQCPLNEVGTV--HWSRLG-GLNIETSRASFEGY-YLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFI-QTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPP--QNQTLIEGSTATFRCEVVSHMDVTITWY 1430
            +N P+I+    S+      L  + C   G+P P I+W  L   +    G+       + + G L+   + E    H     C+A N+ G        T       N ++    EK A   +D+ L C P +  P P   W   G +I S      LI +   + +   L ++N   E++G + CQ  N  +   S +  L +    K       +   +   + EI C    V  V   W++ G  L ++  + S +    LR      +D G Y C +T+++G  S+   ++ VQ P   +  T  + T + GD V   C V   P   V W   GI+      T    + V  DG+L I +    DA  YTC   +S  A  + ANL V    +   P I  P     +++ E    +  C V S+    I+WY
Sbjct: 1089 MNTPMISPGQSSFNMVVDDLFTIPCDVYGDPKPVITW--LLDDKPFTEGV-------VNEDGSLTIPNVNE---AHRGTFTCHAQNAAGNDTRTVTLTVHTTPTINAENQ---EKIALQNDDIVLEC-PAKALPPPVRLWTYEGEKIDSQ-----LIPHT--IREDGALVLQNVKLENTGVFVCQVSN-LAGEDSLSYTLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNKNGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGT-SQMTTHVDVQEPPIILPSTQTNNTAVVGDRVELKCYVEASPPASVTWFRRGIAI----GTDTKGYVVESDGTLVIQSASVEDATIYTCK--ASNPAGKAEANLQVT---VIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWY 1490          

HSP 12 Score: 68.1662 bits (165), Expect = 5.764e-11
Identity = 80/373 (21.45%), Postives = 145/373 (38.87%), Query Frame = 3
Query:  492 EAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYR-----ISNSAEIQCPLNEVGTVH------------WSRLGGLNIE---TSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGS-LHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVV-SHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTC 1544
            + + G D+ LSC+      Y T+ W K G  I        L  +  D + ++I ++   + +D+G+Y C                ++ SN+  Y ++  ++ R     I     +  PL E   +H            W+R G        T R    G  L+ +++  +D+G Y C   +  G  +  +  L +  P S   TP D      + V+ +C   G P P+V+W   G   L     +  +++V +D   L+I +    D G Y C   S       + +L      L   P + +      +  G   +F C+ +       I W++    + ++    IKI  +G L I+    + D+  Y+C
Sbjct:  439 QEFVGRDLNLSCTVESASAY-TIYWVKTGEDIIGGP----LFYHNTDTSVWTIPEL---SLKDAGEYEC----------------RVISNNGNYSVKTRVETRESPPEIFGVRNVSVPLGEAAFLHCSTRSAGEVEIRWTRYGATVFNGPNTERNPTNGT-LKIHHVTRADAGVYECMARNAGGMSTRKM-RLDIMEPPSVKVTPQDVYFNMREGVNLSCEAMGDPKPEVHWYFKGRHLL-----NDYKYQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARDTTDLM-----LATPPKVEIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKN-GKDLIKPDDYIKI-NEGQLHIMGAK-DEDAGAYSC 772          

HSP 13 Score: 68.1662 bits (165), Expect = 5.962e-11
Identity = 89/390 (22.82%), Postives = 144/390 (36.92%), Query Frame = 3
Query:  123 LNYITDTLTINAPVITEMPKSYFPRYG-TLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAY-------SGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGT------------VHWSRLGG---LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQ 1223
            L  + D  T   PV++    +     G T+ L C A G P P + W    S       +  ++P     +   +RL I   +        C A N+ G        T  A ++ +    P I ++         +   + L C   +G+P P ++W  NG  +T ++    + ++       + ++I N +  D G Y C AEN      + + NL        Y +       ISN    Q    E+              V W R G      ++  R   +G  L     +  DSG Y+C  T+++G   +A    V+ +P     TP   T   G   S  C V G+P P + W L G      E+       +  DG+LHI   +
Sbjct: 3849 LEMVLDVFT--PPVVSVKSDNPIKALGETITLFCNASGNPYPQLKWAKGGS-------LIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAG--------TSEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQCLA-QGKPVPQMRWTLNGTALTHSTPGITVASDS------TFIQINNVSLSDKGVYTCYAENV-----AGSDNL-------MYNVDVVQAPVISNGGTKQVIEGELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPGVLTPSSGSKFSLPCAVRGYPDPIISWTLNGNDIKDGENG----HTIGADGTLHIEKAE 4198          

HSP 14 Score: 63.5438 bits (153), Expect = 1.570e-9
Identity = 94/409 (22.98%), Postives = 153/409 (37.41%), Query Frame = 3
Query:  126 NYITDTLTINAPVITEMPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYA---------VSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAEN--AFSTVRSATSNL---KIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASF--EGYYL-RFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFV 1301
            N + +   + APVI+              + C  +G PAP +SW  L++  ++  G+     V+ +  G +  L I E  +       C+A+N  G A         VSP   T          S P +   + SG+   L C+   G P P + W  NG  I    N   +  +         L I    +E    Y C A+N     T+      +   KI ++   Y    E          I+C +    +       G+ +  S      E Y L +  + ++SD G+Y C   +K+G  ++   NL V      ++ P  + V +GD V+  C  SG P P + W           +T       +K  S+  S+   S AG YTC   + + +     +L V
Sbjct: 4034 NLMYNVDVVQAPVISNGGTKQVIEGELAVIECLVEGYPAPQVSW--LRNGNRVETGV---QGVRYVTDGRM--LTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIIT----------STPGVLTPS-SGSKFSLPCAV-RGYPDPIISWTLNGNDIKDGENGHTIGAD-------GTLHIEKA-EERHLIYECTAKNDAGADTLEFPVQTIVAPKISTSGNRYINGSE-----GTETVIKCEIESESSEFSWSKNGVPLLPSNNLIFSEDYKLIKILSTRLSDQGEYSCTAANKAGNATQK-TNLNVGVAPKIMERPRTQVVHKGDQVTLWCEASGVPQPAITWYK---DNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIV 4406          

HSP 15 Score: 58.5362 bits (140), Expect = 4.384e-8
Identity = 89/385 (23.12%), Postives = 152/385 (39.48%), Query Frame = 3
Query:  132 ITDTLTINAPVITEMPKSYFPRYGTLELSCRADGEPAPDISW-YDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKE-----AYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVG----TVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYS-RFRVSKDGS-LHISNTQTSDAGKYTC 1250
            I+D L+ +A + T +P  Y+P    +E++C   G P P + W +D +  +       + N  + +K        I   + +H     C A N++G A          +L R   + P  EKE     A  G+ + L+C+     P  +V W  +   + +   +     N+  LN      + N   +D G YYC A N     +     + I   + Y+  Q++L Y I     +    +  G    T+ + + G    E+      G  L  +N Q    G+Y C   +K+G+ SE  + + V  P    +   +  V  GD ++  C +       + W     S  F +D     R + S D S L+I      DA  Y+C
Sbjct: 2668 ISDELS-SANIQTIVP--YYP----VEINCVVSGSPHPKVYWLFDDKPLEPDSAAYELTNNGETLK--------IVRSQVEHAGTYTCEAQNNVGKARK-------DFLVR-VTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYAANEKTLN------VTNIQLDDEGFYYCTAVNEAGITKKFFKLIVI--ETPYFLDQQKL-YPIILGKRLTLDCSATGTPPPTILFMKDGKRLNESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGR-SEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITW-----SRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSC 3014          

HSP 16 Score: 55.8398 bits (133), Expect = 3.269e-7
Identity = 77/286 (26.92%), Postives = 114/286 (39.86%), Query Frame = 3
Query:  495 AYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAF-STVRSATSNL--------KIFSNSK-------YYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPL-PQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFV 1301
            A  G  VEL CS   G P+PT+ W K+G+ I    +S++ I        YS LK+   +  DSG+Y C A+N+  S+  SA  N+        K  SN K       Y + Q   +        +  P N  G +H+   G L I           L  ++L+  D   Y C++ ++       L +     P   ++T D   V  GD V   C V+  PL   V W       +  +D  Y    V  + SL + N +  D G Y C   +S+        L V
Sbjct: 4581 AAIGAIVELRCSA-AGPPHPTITWAKDGKLI---EDSKFEIA-------YSHLKVTLNSTSDSGEYTCMAQNSVGSSTVSAFINVDNNILPTPKPSSNQKNVAVITCYERNQAYSRGLTWEYNGVPMPKNLAG-IHFMNNGSLVI-----------LDTSSLKEGDLELYTCKVRNRRRHSIPHLTSAFEGVPE--VKTIDKVEVNNGDSVVLDCEVTSDPLTTHVVW-TKNDQKMLDDDAIY----VLPNNSLVLLNVEKYDEGVYKCVASNSIGKAFDDTQLNV 4836          

HSP 17 Score: 54.6842 bits (130), Expect = 6.193e-7
Identity = 92/468 (19.66%), Postives = 165/468 (35.26%), Query Frame = 3
Query:  213 LSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGN-------DVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVG----TVHWSRLGG--LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFP--LPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISL--PPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGA-----LQILKIDPNLDSNIYTCEA 1550
            L+C A+G P P   W   Q           + P + +       +++      H     C A+N +G AV          +N + ++ P  E               + L C   +      + W  NG+   + ++    +           L I +   +D G Y C   N       AT    +F       + +  +Y +  +  +  P    G     V W++ G    ++++ +   EG   +  + +++  G Y+C   +  G    +    ++  P       +  T ++G  + F C +        Q+ W L     +  E       R+S D  L I N   +D G+Y+C   +      +  N F  K  +   P I +    +N+T +E ST T  C      +  ITW++    E +       I   G      L+I +I    D+  YTCEA
Sbjct: 1935 LTCDAEGNPTPTAKWDFNQG----------DLPKEAVFVNNNHTVVVNNVTKYHTGVYKCYATNKVGQAVK--------TINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGV-GISWTVNGKPFLAETDGVQTLAGG------RFLHIVSAKTDDHGSYACTVTNEAGV---ATKTFNLFVQVPPTIVNEGGEYTVIENNSLVLPCEVTGKPNPVVTWTKDGRPVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRPMIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIW-LRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKND-----AGENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFK--DGEAIHIENIADIIPNGELNGNQLKITRIKEG-DAGKYTCEA 2365          

HSP 18 Score: 52.7582 bits (125), Expect = 2.789e-6
Identity = 102/479 (21.29%), Postives = 180/479 (37.58%), Query Frame = 3
Query:  204 TLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEK------EAYSGNDVELSCSPPEGRPYP-TVKWFKNGRQIT-SASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQ-----AENAF---STVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEV--GTVHWSRLG-GLNIET-----SRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEAL-INLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDG-SLHISNTQTSDAGKYTC--NCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKG-ALQILKIDPNLDSNIYTCEAS 1553
            +L L C   G+P P ++W       K    +G    VQ++  G   +  I   E  H+    C A N +G        T     + +  + P I+K       A  G  +   C   + + +   + W +N + I   A ++R  IT    L+    L I N  + D G+Y C+      EN+F   +TV    + + +  +     ++        ++  + CP        + W + G  ++IE            G  L+   ++  D+GKY C   + +G   + + +N++          P D    + + V  +C V   P  ++ W   G         S    + S +G  L++   + +D+ KYTC     +  D R    ++ V     E   V  +     T+  G+ +T  C        TITW +      ++   R      G  LQI K + + D   YTC A+
Sbjct: 2115 SLVLPCEVTGKPNPVVTW------TKDGRPVGDLKSVQVLSEG--QQFKIVHAEIAHKGSYICMAKNDVG--------TAEISFDVDIITRPMIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDAR--ITR---LSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKTAVEH-------STVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPL-----QSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRI-----TVNSGNPSTLHCPAKGSPSPTITWLK--DGNAIEPNDRYVFFDAGRQLQISKTEGS-DQGRYTCIAT 2552          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 99.7525 bits (247), Expect = 1.392e-20
Identity = 97/388 (25.00%), Postives = 173/388 (44.59%), Query Frame = 3
Query:  540 GRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIET---SRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKT--VLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGS-LHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALL----RVIYPDSGIQVMTPLNDETQLSLP 1667
            G P+P++KW KNG+++T   N R        + Q  +L+I   + + +GK+ C AEN  + V+     L +F+              +  +  + C    N    + W++ G L  ++   +R S +G  L   +L+ +D G Y C+  + +G  SEA +++ V  P    +   D +  +     ++  C+  G P+PQ+ W L G +       S     V+ D + + I+N   SD G YTC   +   + +   N+ V +      PVIS     Q +IEG  A   C V  +    ++W R  +       G ++  T G +  +    +LDS IY C A+ ++   +  +T  +    ++I    G  V+TP +  ++ SLP
Sbjct: 3831 GHPFPSIKWLKNGKEVTDDENIRI-------VEQGQVLQILRTDSDHAGKWSCVAEND-AGVKELEMVLDVFTPPVVSVKSDNPIKALGETITLFCNASGNPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGT-SEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQCLAQGKPVPQMRWTLNGTALTH----STPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQA-----PVISNGGTKQ-VIEGELAVIECLVEGYPAPQVSWLRNGNRVETGVQG-VRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPG--VLTP-SSGSKFSLP 4195          

HSP 2 Score: 93.9745 bits (232), Expect = 7.397e-19
Identity = 116/492 (23.58%), Postives = 190/492 (38.62%), Query Frame = 3
Query:  186 YFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIE-----KEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAEN-AFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGT----VHWSR----LGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFI-QTPDDKTVLEGDDVSFTCIVS-GFPLPQVYWELPGISALFPEDTSYSRFRVSKDGS-LHISNTQTSDAGKYTCNCHSSLDARHSSANL-FVKKRELEYYPV----------------ISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGR-IKIPTKGALQILKIDPNLDSNIYTCEAS 1553
            YF     + LSC A G+P P++ WY          G  + N  +  + G  S+ +       H+   Y C A +  G A     +T L        + P +E          G+ V   C    G+P+P ++WFKNG+ +    +  Y+  N+  L+      I     ED+G Y C  EN A   V+ A  NL +       +    ++  I     +QC    VG     + W +    L  LN        +G  L   + Q+ D G++ C   +  GQ S++   +V    +  +   P ++ ++EG D++ +C+V  G P P + W    I    P +   +  ++   GS L +      D GKYTC   S         N+  +KK E  Y P                 +++      +++G      C V       ITWY      P+    R   +     L + K D +  S +YTC+A+
Sbjct:  621 YFNMREGVNLSCEAMGDPKPEVHWY--------FKGRHLLNDYK-YQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARD---TTDLM-----LATPPKVEIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDLIKPDD--YIKINEGQLH------IMGAKDEDAGAYSCVGENMAGKDVQVA--NLSVGRVPTIIESPHTVRVNIERQVTLQCL--AVGIPPPEIEWQKGNVLLATLNNPRYTQLADGNLL-ITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLGHVPPEEQLIEGQDLTLSCVVVLGTPKPSIVW----IKDDKPVEEGPT-IKIEGGGSLLRLRGGNPKDEGKYTCIAVSPAGNSTLHINVQLIKKPEFVYKPEGGIVFKPTISGMDEKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYL--DGRPITPNSRDFTVTADNTLIVRKADKSY-SGVYTCQAT 1074          

HSP 3 Score: 93.2041 bits (230), Expect = 1.604e-18
Identity = 130/529 (24.57%), Postives = 208/529 (39.32%), Query Frame = 3
Query:   30 NYFLFLNEHYFLTNNFRSQSMFSYLIQIV-IFLNYITDTLTINAPVITEMPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGY--------AVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSI----LKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRI--SNSAEIQCPLN--EVGTVHWSRLGGLNIETSRASF----EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGS-LHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEA 1550
            NY      H        SQS  +Y   ++ I  N +   + +N P I               + C   G P P I W  L++ +++ +    +  ++I++ G + +++ T  ++ H  K  C A N  G           +PP  +         +S+  I+     G  + L C+   G PYP +KW K G           LI + PD  + S+    L I +  K D G Y CQA NA  T  ++ S + +    +  +   ++  R+    S  +QC      V  + W+ L G  +  S        +  +++ NN+ +SD G Y C   + +G  +      VVQAP   I     K V+EG+     C+V G+P PQV W   G       +T     R   DG  L I   ++ D+G Y C+  +   +   +  L V    L    +I+  P   T   GS  +  C V  + D  I+W    ++      G   I   G L I K +      IY C A
Sbjct: 3778 NYIARHMPHVVTKPREMSQSANAYPPPVIDISRNDVQPQVAVNQPTI---------------MRCAVTGHPFPSIKW--LKNGKEVTD----DENIRIVEQGQVLQILRT--DSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVS--------VKSDNPIKA---LGETITLFCN-ASGNPYPQLKWAKGGS----------LIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVS-VDVLVPPEINRDGIDMSPRLPAQQSLTLQCLAQGKPVPQMRWT-LNGTALTHSTPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPV--ISNGGTKQVIEGELAVIECLVEGYPAPQVSWLRNGNRV----ETGVQGVRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEV----LVSPKIITSTPGVLTPSSGSKFSLPCAVRGYPDPIISWTLNGNDIKDGENGHT-IGADGTLHIEKAEER--HLIYECTA 4246          

HSP 4 Score: 90.5077 bits (223), Expect = 1.039e-17
Identity = 114/449 (25.39%), Postives = 189/449 (42.09%), Query Frame = 3
Query:  501 SGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISN-SAEIQCPLNEVGT-VHWSRLG-GLNIETSRA-SF-----EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASF---IQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDG-SLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIE------GSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGA-----LQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQVTYWIEYVRFGSR 1775
            SGN   L C P +G P PT+ W K+G  I    N RY+       +    L+I      D G+Y C A N+  +     + L++         ++E    I   S+E+ C  N  G  V W + G  +N +T R  SF      G  + F + + SDSG+Y C + + +G+ +  L +  V  P S    + + + +T++    V   C+VSG P P+VYW L     L P+  +Y    ++ +G +L I  +Q   AG YTC   ++           V K   ++   ++ PP  +   E      G T    C   S + ++  ++   H+E +Q G    I +K A     L +  I  + D   Y C A  ++ + K  +  ++          + TP   + Q   P +L          +TL  S+TG     I +++ G R
Sbjct: 2492 SGNPSTLHC-PAKGSPSPTITWLKDGNAI--EPNDRYVF-----FDAGRQLQISKTEGSDQGRYTCIATNSVGS-DDLENTLEVIIPPVIDGERREAVAVIEGFSSELFCDSNSTGVDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGE-ARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYW-LFDDKPLEPDSAAY---ELTNNGETLKIVRSQVEHAGTYTCEAQNN-----------VGKARKDFLVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHA-HDESVQNG---VITSKYAANEKTLNVTNIQLD-DEGFYYCTAVNEAGITKKFFKLIV----------IETPYFLDQQKLYPIIL-------GKRLTLDCSATGTPPPTILFMKDGKR 2893          

HSP 5 Score: 90.1225 bits (222), Expect = 1.219e-17
Identity = 104/396 (26.26%), Postives = 162/396 (40.91%), Query Frame = 3
Query:  477 PAIEKE-----AYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYS-ILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLN--EVGTVHWSRLGG-LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKT--VLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTC---NCHSSLDARHSSANL----FVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYP 1610
            P IE E        GN   + C    GRP P V W +NG++I                 Q++ +L IRN  + D GKY C A N   T   A   + +F+   +   +         SA+I+C ++     T+ W + G   N++    S  G  L     Q  D G Y C  T+  G   +     V   P  +I    D+T   + G ++   C V G P P V W+  G  A+ P D   SR  +  +  L I++  T DAG+Y+C   N   +L   +++  +    FV+K    Y            +IE  T T  C V S    +I+W+RG  ++P+    R  I   G+   +      D   Y C AS ++    +    +L+++ P
Sbjct: 3217 PRIEDEERVLQGKEGNTYMVHCQV-TGRPVPYVTWKRNGKEI----------------EQFNPVLHIRNATRADEGKYSCIASNEAGTA-VADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKP--YIDETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKR-GDDAV-PND---SRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRKGGNLY-----------EVIENDTITMDCGVTSRPLPSISWFRG--DKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAG--TSDIDLILKILVP 3572          

HSP 6 Score: 89.3521 bits (220), Expect = 2.072e-17
Identity = 92/376 (24.47%), Postives = 158/376 (42.02%), Query Frame = 3
Query:  504 GNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNL-KIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVH--WSRLGGLNIET---SRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGD-DVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYP 1610
            G  + L CS   G P PT+ + K+G+++  +     +          S L I NP KE  G+Y C AEN     RS    + ++    K  K    ++ +  +   ++CP+ +   VH  WSR  G + +    +++S +   L        D+  Y C   + +G  +EA+  + V  P          T +  D  +   C   G P P++ W L G   L     +Y +     D SL I N + +  G+YTC   +   A  +  + +V   E+   P + +  +   ++EG   T RCEV  + +  + W +    EP  +   ++  TK +   L+     D   YTC A+ K+   +T  T  + V+ P
Sbjct: 2868 GKRLTLDCSA-TGTPPPTILFMKDGKRLNESDEVDII---------GSTLVIDNPQKEVEGRYTCIAENKAG--RSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGG-AEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQ----GDLSLRIDNIKPNQEGRYTCVAENK--AGRAEQDTYV---EISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLK--DGEPYTS-DLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQT--TTDVEVLVP 3216          

HSP 7 Score: 85.8853 bits (211), Expect = 2.398e-16
Identity = 118/478 (24.69%), Postives = 182/478 (38.08%), Query Frame = 3
Query:  204 TLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYA--------VSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSI----LKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLN--EVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSL-DARHS-SANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTA 1589
            TLE+ CR +G P P+ISW+ L  K  IL   G+       K G LS L I   +   E +  C A N  G A          PP     + + R              G    + C    G P P V W K+G   TS            DL Q+S     L +R     D G Y C A N     ++ T+++++    +    ++ L+ +  N+  + C +    V  V W R  G  IE          L   N   +D GKY C  ++++G      +  V   P +F        ++EG+     C + G P P + W L G      ++   S     +  +L I   Q  D G YTC   +S  D+      N++ K    E         Q    + G     +C V+ +   T+TW RG  ++ +    R  I     L+I  +    D+  Y+C A  ++  + T + A
Sbjct: 3052 TLEIPCRTEGIPPPEISWF-LDGK-PILEMPGVT-----YKQGDLS-LRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMR-----------VVEGRQTTIRCE-VFGNPEPVVNWLKDGEPYTS------------DLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQT-TTDVEVLVPPRIEDEERVLQGKEGNTYMVHCQVTGRPVPYVTWKR-NGKEIEQFNP-----VLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKP-TFETHETTFNIVEGESAKIECKIDGHPKPTISW-LKGGRPFNMDNIILS----PRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETI------DQTPKAVAGGEIILKCPVLGNPTPTVTWKRG--DDAVPNDSRHTIVNNYDLKINSVTTE-DAGQYSCIAVNEAGNLTTHYAA 3475          

HSP 8 Score: 78.5666 bits (192), Expect = 3.796e-14
Identity = 121/513 (23.59%), Postives = 205/513 (39.96%), Query Frame = 3
Query:  141 TLTINAP--VITEMPKSYFPRYG-TLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAI------EKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIF----SNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHW--SRLGGLNIETS-RASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVL--EGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDG-SLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPV-ISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGA-LQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYP 1610
            TLT++    +I+E+P       G T+E+ CRA G P    +W          NGI +    +      L  L I E +        C  +N  G        T     + + Q  P I         A  G+ VEL C   E  P  +V WF+ G  I + +   Y++ +         L I++ + ED+  Y C+A N       A +NL++      + K   +  +   + S+   + CP+  N +  + W  +    ++ +TS + S +   L     +++DSG Y C   + +G+ S++   + V  P +  ++   K V   EG++V+  C VSGFP+PQ+ W + G   +      Y    +S DG +LH  +      G Y C          S  N+     EL    V I     N  +  G   +  C++ +  D   T+    +         ++IP+ G  L I    P  ++  Y C  +  ++  K   T  L V+ P
Sbjct: 1263 TLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNK--------NGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAG--------TSQMTTHVDVQEPPIILPSTQTNNTAVVGDRVELKCYV-EASPPASVTWFRRGIAIGTDTKG-YVVESD------GTLVIQSASVEDATIYTCKASNPAG---KAEANLQVTVIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSF-QVEVIVPLNLDESKYKKKVFAKEGEEVTLGCPVSGFPVPQINWVVDG--TVVEPGKKYKGATLSNDGLTLHFDSVSVKQEGNYHC-------VAQSKGNILDIDVELSVLAVPIVGEDDNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSESDRPDNVQIPSDGHRLYITDAKPE-NNGKYMCRVT--NSAGKAERTLTLDVLEP 1735          

HSP 9 Score: 75.0998 bits (183), Expect = 4.426e-13
Identity = 99/421 (23.52%), Postives = 167/421 (39.67%), Query Frame = 3
Query:  339 SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPN-------KEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYK--MQKELKYRISNSAEIQCPLNE-VGT-VHWSRLGG---LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQN-QTLIEGSTATFRCEVVSHMDVT--ITWYRGPHNEPLQA-GGRI-KIPTKGALQILKIDPNLDSNIYTC 1544
            +RL I      HE    C A+N+ G  VS      +  L +    N  +  E   G ++ L+C   EG P PT KW                  NQ DL + ++    N         K  +G Y C A N        T N+ + +  ++     + EL   ++ S  ++C +++ +G  + W+  G       +  +    G +L   + +  D G Y C +T+++G  ++   NL VQ P + +    + TV+E + +   C V+G P P V W   G     P     S   +S+     I + + +  G Y C   + +     S ++ +  R     P+I    +N  T I+G    F+C +    +    I W R      L+A   RI ++     L IL +  N D   Y+C
Sbjct: 1878 TRLTILNANRDHEDIYTCVANNTAG-QVSKDFDVVVQVLPK--IKNAVVTLEINEGEEIILTCDA-EGNPTPTAKWD----------------FNQGDLPKEAVFVNNNHTVVVNNVTKYHTGVYKCYATNKVGQA-VKTINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVGISWTVNGKPFLAETDGVQTLAGGRFLHIVSAKTDDHGSYACTVTNEAGVATKTF-NLFVQVPPTIVNEGGEYTVIENNSLVLPCEVTGKPNPVVTWTKDG----RPVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITR-----PMIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTEN-DEGQYSC 2266          

HSP 10 Score: 73.9442 bits (180), Expect = 9.596e-13
Identity = 122/507 (24.06%), Postives = 197/507 (38.86%), Query Frame = 3
Query:  195 RYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEK-------EAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAEN-AFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASF--EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINL--VVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDG-SLHISNTQTSDAGKYTC-----------------NCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLD-SNIYTCEASLKSNLMKTRWTALLRVIYP 1610
             + T+ LSC A G+P PDI+W+      K    I I N   I+  G L  ++L IT  +     K  C A NS G             +N N  + P IEK       E+     V +SC P   RP   + W K G+ + S    +++ T+      Y + K+R   + DS KY C A N A +  R    ++ +  +     + + +     N + + CP   +   T+ W + G       R  F   G  L+ +  + SD G+Y C  T+  G  S+ L N   V+  P    +  +   V+EG      C  +   +  V W+  G++         S  ++   G  +   + + SD+G+YTC                 N   S+    SSAN+   +  + YYPV                   C V       + W     ++PL+        T     +  +   ++ +  YTCEA  ++N+ K R   L+RV  P
Sbjct: 2302 EHSTVTLSCPATGKPEPDITWF------KDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQD--------VNVNVITIPKIEKDGIPSDYESQQNERVVISC-PVYARPPAKITWLKAGKPLQS---DKFVKTSANGQKLY-LFKLR---ETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVG--SDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFCDSNSTGV-DVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANI---QTIVPYYPV----------------EINCVVSGSPHPKVYWLF--DDKPLEPDSAAYELTNNGETLKIVRSQVEHAGTYTCEA--QNNVGKARKDFLVRVTAP 2760          

HSP 11 Score: 70.0922 bits (170), Expect = 1.592e-11
Identity = 108/436 (24.77%), Postives = 173/436 (39.68%), Query Frame = 3
Query:  150 INAPVITEMPKSYFPRYGTL-ELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISN-SAEIQCPLNEVGTV--HWSRLG-GLNIETSRASFEGY-YLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFI-QTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPP--QNQTLIEGSTATFRCEVVSHMDVTITWY 1430
            +N P+I+    S+      L  + C   G+P P I+W  L   +    G+       + + G L+   + E    H     C+A N+ G        T       N ++    EK A   +D+ L C P +  P P   W   G +I S      LI +   + +   L ++N   E++G + CQ  N  +   S +  L +    K       +   +   + EI C    V  V   W++ G  L ++  + S +    LR      +D G Y C +T+++G  S+   ++ VQ P   +  T  + T + GD V   C V   P   V W   GI+      T    + V  DG+L I +    DA  YTC   +S  A  + ANL V    +   P I  P     +++ E    +  C V S+    I+WY
Sbjct: 1089 MNTPMISPGQSSFNMVVDDLFTIPCDVYGDPKPVITW--LLDDKPFTEGV-------VNEDGSLTIPNVNE---AHRGTFTCHAQNAAGNDTRTVTLTVHTTPTINAENQ---EKIALQNDDIVLEC-PAKALPPPVRLWTYEGEKIDSQ-----LIPHT--IREDGALVLQNVKLENTGVFVCQVSN-LAGEDSLSYTLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNKNGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGT-SQMTTHVDVQEPPIILPSTQTNNTAVVGDRVELKCYVEASPPASVTWFRRGIAI----GTDTKGYVVESDGTLVIQSASVEDATIYTCK--ASNPAGKAEANLQVT---VIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWY 1490          

HSP 12 Score: 69.707 bits (169), Expect = 1.747e-11
Identity = 88/381 (23.10%), Postives = 154/381 (40.42%), Query Frame = 3
Query:  495 AYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYC--QAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASF--EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQT--PDDKTVLEGDDVSFTCIVSGFPLPQVYWELPG----ISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLI-EGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVI 1604
            A  G +V L C P  G P P + W  +G  +      +    +   L     L   + + +  G Y+C  Q++     +    S L +    +   ++  L   IS S ++Q   ++  T  WS  G  +          +G+ L   + +  ++GKY+CR+T+ +G+ +E  + L V  P  F++     ++ ++  + +   C V+G P P V W++ G     S LF E  S  R       S  IS T  + AG              +S + F++       P        +T+  E  T T  C  VS  D  ITW +     PL     I       L IL  + + + +IYTC A+  +  +   +  +++V+
Sbjct: 1561 AKEGEEVTLGC-PVSGFPVPQINWVVDGTVVEPGKKYKGATLSNDGLT----LHFDSVSVKQEGNYHCVAQSKGNILDIDVELSVLAVPIVGEDDNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSESDRPDNVQIPSDGHRLYITDAKPENNGKYMCRVTNSAGK-AERTLTLDVLEPPVFVEPVFEANQKLIGNNPIILQCQVTGNPKPTVIWKIDGNDVDKSWLFDESLSLLRIEKLTGKSAQISCTAENKAGT-------------ASRDFFIQNIAA---PTFKNEGDQETIFRESETITLDCP-VSLGDFQITWMK--QGLPLTENDAIFTLDNTRLTILNANRDHE-DIYTCVANNTAGQVSKDFDVVVQVL 1915          

HSP 13 Score: 68.1662 bits (165), Expect = 5.622e-11
Identity = 79/372 (21.24%), Postives = 146/372 (39.25%), Query Frame = 3
Query:  492 EAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYR-----ISNSAEIQCPLNEVGTVH------------WSRLGG--LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGS-LHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVV-SHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTC 1544
            + + G D+ LSC+      Y T+ W K G  I        L  +  D + ++I ++   + +D+G+Y C                ++ SN+  Y ++  ++ R     I     +  PL E   +H            W+R G    N   +  +     L+ +++  +D+G Y C +   +G  S   + L +  P S   TP D      + V+ +C   G P P+V+W   G   L     +  +++V +D   L+I +    D G Y C   S       + +L      L   P + +      +  G   +F C+ +       I W++    + ++    IKI  +G L I+    + D+  Y+C
Sbjct:  439 QEFVGRDLNLSCTVESASAY-TIYWVKTGEDIIGGP----LFYHNTDTSVWTIPEL---SLKDAGEYEC----------------RVISNNGNYSVKTRVETRESPPEIFGVRNVSVPLGEAAFLHCSTRSAGEVEIRWTRYGATVFNGPNTERNPTNGTLKIHHVTRADAGVYEC-MARNAGGMSTRKMRLDIMEPPSVKVTPQDVYFNMREGVNLSCEAMGDPKPEVHWYFKGRHLL-----NDYKYQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARDTTDLM-----LATPPKVEIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKN-GKDLIKPDDYIKI-NEGQLHIMGAK-DEDAGAYSC 772          

HSP 14 Score: 65.0846 bits (157), Expect = 5.398e-10
Identity = 146/656 (22.26%), Postives = 244/656 (37.20%), Query Frame = 3
Query:  165 ITEMPKSYFPRYGTLELSCRADGEPAPDISW------YDLQSKQKILNGIGIN-NPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYK---MQKELKYRISNSAEIQCPLNEVGT--VHWSRLG-GLNIETSRASFEGYYLRFN--NLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVS-----GFPLPQVYWELPGISALFPEDTSYSRFRVSKDG-SLHISNTQTSDAGKYTCNC-----HSSLD-----------------------ARHSSANLFVKKRELEYYPVISLPP---------QNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKG-ALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVL----DPPTEKTADSVTLTWSSTGQVTYWIEYVRFGSREGWVIYKKDWPD--------TKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYV 1919
            I + PK+     G + L C   G P P ++W          S+  I+N   +  N V    AG  S                C A N  G   +  A+  +      F        E    + + + C     RP P++ WF+  + +      RY I+  PD +  +I K +     D GKY C+A N   T       LKI    K  K   +   L   ++ +  ++CP++ +    V W++ G  +N+  SR         F   N+Q++D G+Y C  T++ G+ S      V+  P   I         EGD ++ TC +         +  V W     S     D +     +S DG  L IS     +AG YTC        +SL+                       ARH   ++  K RE+        PP         Q Q  +   T   RC V  H   +I W +  + + +     I+I  +G  LQIL+ D +                   +W+    V   D+G++ +  + D   +  PPV+    D P +   +++TL  +++G     +++ + GS    +I+  D PD         ++ + +L       +  ++ N  G S ASV  + +
Sbjct: 3396 IDQTPKAV--AGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYS----------------CIAVNEAGNLTTHYAAEVIG--KPTFVRKGGNLYEVIENDTITMDCGV-TSRPLPSISWFRGDKPVYLYD--RYSIS--PDGSHITINKAK---LSDGGKYICRASNEAGT-SDIDLILKILVPPKIDKSNIIGNPLAI-VARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWTKD--SRALDGDLT-DNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILCTSLATVKCREHENNYIARH-MPHVVTKPREMSQSANAYPPPVIDISRNDVQPQVAVNQPT-IMRCAVTGHPFPSIKWLK--NGKEVTDDENIRIVEQGQVLQILRTDSD----------------HAGKWSC---VAENDAGVKELEMVLD---VFTPPVVSVKSDNPIKALGETITLFCNASGNPYPQLKWAKGGS----LIF--DSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVL 3986          

HSP 15 Score: 62.7734 bits (151), Expect = 2.125e-9
Identity = 94/409 (22.98%), Postives = 153/409 (37.41%), Query Frame = 3
Query:  126 NYITDTLTINAPVITEMPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYA---------VSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAEN--AFSTVRSATSNL---KIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASF--EGYYL-RFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFV 1301
            N + +   + APVI+              + C  +G PAP +SW  L++  ++  G+     V+ +  G +  L I E  +       C+A+N  G A         VSP   T          S P +   + SG+   L C+   G P P + W  NG  I    N   +  +         L I    +E    Y C A+N     T+      +   KI ++   Y    E          I+C +    +       G+ +  S      E Y L +  + ++SD G+Y C   +K+G  ++   NL V      ++ P  + V +GD V+  C  SG P P + W           +T       +K  S+  S+   S AG YTC   + + +     +L V
Sbjct: 4072 NLMYNVDVVQAPVISNGGTKQVIEGELAVIECLVEGYPAPQVSW--LRNGNRVETGV---QGVRYVTDGRM--LTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIIT----------STPGVLTPS-SGSKFSLPCAV-RGYPDPIISWTLNGNDIKDGENGHTIGAD-------GTLHIEKA-EERHLIYECTAKNDAGADTLEFPVQTIVAPKISTSGNRYINGSE-----GTETVIKCEIESESSEFSWSKNGVPLLPSNNLIFSEDYKLIKILSTRLSDQGEYSCTAANKAGNATQK-TNLNVGVAPKIMERPRTQVVHKGDQVTLWCEASGVPQPAITWYK---DNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIV 4444          

HSP 16 Score: 58.9214 bits (141), Expect = 3.964e-8
Identity = 89/385 (23.12%), Postives = 152/385 (39.48%), Query Frame = 3
Query:  132 ITDTLTINAPVITEMPKSYFPRYGTLELSCRADGEPAPDISW-YDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKE-----AYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVG----TVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYS-RFRVSKDGS-LHISNTQTSDAGKYTC 1250
            I+D L+ +A + T +P  Y+P    +E++C   G P P + W +D +  +       + N  + +K        I   + +H     C A N++G A          +L R   + P  EKE     A  G+ + L+C+     P  +V W  +   + +   +     N+  LN      + N   +D G YYC A N     +     + I   + Y+  Q++L Y I     +    +  G    T+ + + G    E+      G  L  +N Q    G+Y C   +K+G+ SE  + + V  P    +   +  V  GD ++  C +       + W     S  F +D     R + S D S L+I      DA  Y+C
Sbjct: 2668 ISDELS-SANIQTIVP--YYP----VEINCVVSGSPHPKVYWLFDDKPLEPDSAAYELTNNGETLK--------IVRSQVEHAGTYTCEAQNNVGKARK-------DFLVR-VTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYAANEKTLN------VTNIQLDDEGFYYCTAVNEAGITKKFFKLIVI--ETPYFLDQQKL-YPIILGKRLTLDCSATGTPPPTILFMKDGKRLNESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGR-SEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITW-----SRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSC 3014          

HSP 17 Score: 55.8398 bits (133), Expect = 3.270e-7
Identity = 77/286 (26.92%), Postives = 114/286 (39.86%), Query Frame = 3
Query:  495 AYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAF-STVRSATSNL--------KIFSNSK-------YYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPL-PQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFV 1301
            A  G  VEL CS   G P+PT+ W K+G+ I    +S++ I        YS LK+   +  DSG+Y C A+N+  S+  SA  N+        K  SN K       Y + Q   +        +  P N  G +H+   G L I           L  ++L+  D   Y C++ ++       L +     P   ++T D   V  GD V   C V+  PL   V W       +  +D  Y    V  + SL + N +  D G Y C   +S+        L V
Sbjct: 4619 AAIGAIVELRCSA-AGPPHPTITWAKDGKLI---EDSKFEIA-------YSHLKVTLNSTSDSGEYTCMAQNSVGSSTVSAFINVDNNILPTPKPSSNQKNVAVITCYERNQAYSRGLTWEYNGVPMPKNLAG-IHFMNNGSLVI-----------LDTSSLKEGDLELYTCKVRNRRRHSIPHLTSAFEGVPE--VKTIDKVEVNNGDSVVLDCEVTSDPLTTHVVW-TKNDQKMLDDDAIY----VLPNNSLVLLNVEKYDEGVYKCVASNSIGKAFDDTQLNV 4874          

HSP 18 Score: 54.299 bits (129), Expect = 7.971e-7
Identity = 92/468 (19.66%), Postives = 165/468 (35.26%), Query Frame = 3
Query:  213 LSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGN-------DVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVG----TVHWSRLGG--LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFP--LPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISL--PPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGA-----LQILKIDPNLDSNIYTCEA 1550
            L+C A+G P P   W   Q           + P + +       +++      H     C A+N +G AV          +N + ++ P  E               + L C   +      + W  NG+   + ++    +           L I +   +D G Y C   N       AT    +F       + +  +Y +  +  +  P    G     V W++ G    ++++ +   EG   +  + +++  G Y+C   +  G    +    ++  P       +  T ++G  + F C +        Q+ W L     +  E       R+S D  L I N   +D G+Y+C   +      +  N F  K  +   P I +    +N+T +E ST T  C      +  ITW++    E +       I   G      L+I +I    D+  YTCEA
Sbjct: 1935 LTCDAEGNPTPTAKWDFNQG----------DLPKEAVFVNNNHTVVVNNVTKYHTGVYKCYATNKVGQAVK--------TINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGV-GISWTVNGKPFLAETDGVQTLAGG------RFLHIVSAKTDDHGSYACTVTNEAGV---ATKTFNLFVQVPPTIVNEGGEYTVIENNSLVLPCEVTGKPNPVVTWTKDGRPVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRPMIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIW-LRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKND-----AGENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFK--DGEAIHIENIADIIPNGELNGNQLKITRIKEG-DAGKYTCEA 2365          

HSP 19 Score: 53.1434 bits (126), Expect = 2.113e-6
Identity = 103/476 (21.64%), Postives = 175/476 (36.76%), Query Frame = 3
Query:  204 TLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEK------EAYSGNDVELSCSPPEGRPYP-TVKWFKNGRQIT-SASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQ-----AENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLG-GLNIET-----SRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEAL-INLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGS-LHISNTQTSDAGKYTC--NCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKG-ALQILKIDPNLDSNIYTCEAS 1553
            +L L C   G+P P ++W       K    +G    VQ++  G   +  I   E  H+    C A N +G        T     + +  + P I+K       A  G  +   C   + + +   + W +N + I   A ++R  IT    L+    L I N  + D G+Y C+      EN+F    +      I    K     K       ++  + CP        + W + G  ++IE            G  L+   ++  D+GKY C   + +G   + + +N++          P D    + + V  +C V   P  ++ W   G         S    + S +G  L++   + +D+ KYTC     +  D R    ++ V     E   V  +     T+  G+ +T  C        TITW +      ++   R      G  LQI K + + D   YTC A+
Sbjct: 2115 SLVLPCEVTGKPNPVVTW------TKDGRPVGDLKSVQVLSEG--QQFKIVHAEIAHKGSYICMAKNDVG--------TAEISFDVDIITRPMIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDAR--ITR---LSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDK----DKNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPL-----QSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRI-----TVNSGNPSTLHCPAKGSPSPTITWLK--DGNAIEPNDRYVFFDAGRQLQISKTEGS-DQGRYTCIAT 2552          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Fly
Match: robo1 (gene:FBgn0005631 transcript:FBtr0071922)

HSP 1 Score: 260.381 bits (664), Expect = 3.712e-70
Identity = 225/859 (26.19%), Postives = 378/859 (44.00%), Query Frame = 3
Query:  213 LSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASF--EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP--VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQ--------VTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQI-VRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRSQRI 2744
            L+C+ +G+P P I W+  +  + +      ++ VQ           +   + Q   + +C A N +G AVS  AS  +A L  +F+  P   + A  G    L C PP+G P PT+ W K+G  +       +  +++  +     L I N    D G Y C A+N   T  S+ + L +     + K  K+       +A   C +  +    V W +  G NI  SRA    +   L  +N+  +D G YVC   +  GQ S A  +L+V AP +F + P +K V     V   C+ SG P P V+W   G+S L   ++S+ R  V+ DG+L I++ +  D G Y C+  S +D+  S+  +F++   L+  P  +I + P NQTL +GS AT  C    +    I W+   H   +QAG R  I    +L++  +  + DS  YTC AS +    +T W A L V  P  G   +    D +    PP        +  S++L W+ + +        + Y +EY     + GW++  +   DT++T+  L+P + Y FLVR+ N +G+S  S  +  +KT+  +    +  +D+     +++ +   + +   + I    V+LEW + V  D K    +EG +I                 H K     S Q  S+  +                                   DA+    +V  L  ++ YEF +  ++E  ++  + S S+  L +E++PS PP NI+     N+    + +  PP+   NG L G  + + A ++  +L +M  N T   + + NL     YS+ L+ F   G+G  S+ I
Sbjct:   75 LNCKVEGKPEPTIEWF--KDGEPVSTNEKKSHRVQFKDGALFFYRTMQGKKEQDGGEYWCVAKNRVGQAVSRHASLQIAVLRDDFRVEPKDTRVA-KGETALLECGPPKGIPEPTLIWIKDGVPLDDLKAMSFGASSRVRIVDGGNLLISNVEPIDEGNYKCIAQNLVGTRESSYAKLIVQVKPYFMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEEG-NIPVSRARILHDEKSLEISNITPTDEGTYVCEAHNNVGQIS-ARASLIVHAPPNFTKRPSNKKVGLNGVVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSHGRQHVAADGTLQITDVRQEDEGYYVCSAFSVVDS--STVRVFLQVSSLDERPPPIIQIGPANQTLPKGSVATLPCRATGNPSPRIKWFHDGH--AVQAGNRYSIIQGSSLRVDDLQLS-DSGTYTCTASGERG--ETSWAATLTVEKP--GSTSLHRAADPSTYPAPPGTPKVLNVSRTSISLRWAKSQEKPGAVGPIIGYTVEYFSPDLQTGWIVAAQRVGDTQVTISGLTPGTSYVFLVRAENTQGISVPSGLSNTIKTIEADFDAAS-ANDLS--AARTLLTGKSVELIDASAINASAVRLEWMLHVSADEK---YVEGLRI-----------------HYKDASVPSAQYHSITVM-----------------------------------DASAESFVVGNLKKYTKYEFFLTPFFE--TIEGQPSNSKTALTYEDVPSAPPDNIQ-IGMYNQTAGWVRWTPPPSQHHNGNLYGYKIEVSAGNTMKVLANMTLNATTTSVLLNNLTTGAVYSVRLNSFTKAGDGPYSKPI 858          

HSP 2 Score: 60.4622 bits (145), Expect = 1.342e-8
Identity = 83/310 (26.77%), Postives = 127/310 (40.97%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYG-TLELSCRADGEPAPDISWYDLQ-----SKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGT------------VHWSRLGGLNIETSRAS-FEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPAS 1031
            P   + PK     YG T    C   G+P P + W   +     S+ +IL+           K+  +S +  T+     E    C A N++G  +S  AS  + +   NF   P+ +K   +G  V+L C    G P P+V W K G       NS +    +  +     L+I +  +ED G Y C   +AFS V S+T  +++F        +     +I   A    P   V T            + W   G      +R S  +G  LR ++LQ+SDSG Y C  + + G+ S A   L V+ P S
Sbjct:  255 PYFMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEEGNIPVSRARILHD---------EKSLEISNITPTD-----EGTYVCEAHNNVG-QISARASL-IVHAPPNFTKRPSNKKVGLNGV-VQLPCM-ASGNPPPSVFWTKEGVSTLMFPNSSH---GRQHVAADGTLQITDVRQEDEGYYVC---SAFSVVDSST--VRVFLQVSSLDERPPPIIQI-GPANQTLPKGSVATLPCRATGNPSPRIKWFHDGHAVQAGNRYSIIQGSSLRVDDLQLSDSGTYTCTASGERGETSWAAT-LTVEKPGS 536          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Fly
Match: robo1 (gene:FBgn0005631 transcript:FBtr0343013)

HSP 1 Score: 260.381 bits (664), Expect = 3.712e-70
Identity = 225/859 (26.19%), Postives = 378/859 (44.00%), Query Frame = 3
Query:  213 LSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASF--EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP--VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQ--------VTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQI-VRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRSQRI 2744
            L+C+ +G+P P I W+  +  + +      ++ VQ           +   + Q   + +C A N +G AVS  AS  +A L  +F+  P   + A  G    L C PP+G P PT+ W K+G  +       +  +++  +     L I N    D G Y C A+N   T  S+ + L +     + K  K+       +A   C +  +    V W +  G NI  SRA    +   L  +N+  +D G YVC   +  GQ S A  +L+V AP +F + P +K V     V   C+ SG P P V+W   G+S L   ++S+ R  V+ DG+L I++ +  D G Y C+  S +D+  S+  +F++   L+  P  +I + P NQTL +GS AT  C    +    I W+   H   +QAG R  I    +L++  +  + DS  YTC AS +    +T W A L V  P  G   +    D +    PP        +  S++L W+ + +        + Y +EY     + GW++  +   DT++T+  L+P + Y FLVR+ N +G+S  S  +  +KT+  +    +  +D+     +++ +   + +   + I    V+LEW + V  D K    +EG +I                 H K     S Q  S+  +                                   DA+    +V  L  ++ YEF +  ++E  ++  + S S+  L +E++PS PP NI+     N+    + +  PP+   NG L G  + + A ++  +L +M  N T   + + NL     YS+ L+ F   G+G  S+ I
Sbjct:   75 LNCKVEGKPEPTIEWF--KDGEPVSTNEKKSHRVQFKDGALFFYRTMQGKKEQDGGEYWCVAKNRVGQAVSRHASLQIAVLRDDFRVEPKDTRVA-KGETALLECGPPKGIPEPTLIWIKDGVPLDDLKAMSFGASSRVRIVDGGNLLISNVEPIDEGNYKCIAQNLVGTRESSYAKLIVQVKPYFMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEEG-NIPVSRARILHDEKSLEISNITPTDEGTYVCEAHNNVGQIS-ARASLIVHAPPNFTKRPSNKKVGLNGVVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSHGRQHVAADGTLQITDVRQEDEGYYVCSAFSVVDS--STVRVFLQVSSLDERPPPIIQIGPANQTLPKGSVATLPCRATGNPSPRIKWFHDGH--AVQAGNRYSIIQGSSLRVDDLQLS-DSGTYTCTASGERG--ETSWAATLTVEKP--GSTSLHRAADPSTYPAPPGTPKVLNVSRTSISLRWAKSQEKPGAVGPIIGYTVEYFSPDLQTGWIVAAQRVGDTQVTISGLTPGTSYVFLVRAENTQGISVPSGLSNTIKTIEADFDAAS-ANDLS--AARTLLTGKSVELIDASAINASAVRLEWMLHVSADEK---YVEGLRI-----------------HYKDASVPSAQYHSITVM-----------------------------------DASAESFVVGNLKKYTKYEFFLTPFFE--TIEGQPSNSKTALTYEDVPSAPPDNIQ-IGMYNQTAGWVRWTPPPSQHHNGNLYGYKIEVSAGNTMKVLANMTLNATTTSVLLNNLTTGAVYSVRLNSFTKAGDGPYSKPI 858          

HSP 2 Score: 60.4622 bits (145), Expect = 1.342e-8
Identity = 83/310 (26.77%), Postives = 127/310 (40.97%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYG-TLELSCRADGEPAPDISWYDLQ-----SKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGT------------VHWSRLGGLNIETSRAS-FEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPAS 1031
            P   + PK     YG T    C   G+P P + W   +     S+ +IL+           K+  +S +  T+     E    C A N++G  +S  AS  + +   NF   P+ +K   +G  V+L C    G P P+V W K G       NS +    +  +     L+I +  +ED G Y C   +AFS V S+T  +++F        +     +I   A    P   V T            + W   G      +R S  +G  LR ++LQ+SDSG Y C  + + G+ S A   L V+ P S
Sbjct:  255 PYFMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEEGNIPVSRARILHD---------EKSLEISNITPTD-----EGTYVCEAHNNVG-QISARASL-IVHAPPNFTKRPSNKKVGLNGV-VQLPCM-ASGNPPPSVFWTKEGVSTLMFPNSSH---GRQHVAADGTLQITDVRQEDEGYYVC---SAFSVVDSST--VRVFLQVSSLDERPPPIIQI-GPANQTLPKGSVATLPCRATGNPSPRIKWFHDGHAVQAGNRYSIIQGSSLRVDDLQLSDSGTYTCTASGERGETSWAAT-LTVEKPGS 536          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Fly
Match: robo3 (gene:FBgn0041097 transcript:FBtr0077921)

HSP 1 Score: 202.986 bits (515), Expect = 2.303e-52
Identity = 175/614 (28.50%), Postives = 271/614 (44.14%), Query Frame = 3
Query:  111 IVIFLNYITDTLTINAPVITEMP-KSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGT----VHWSRLG-GLNIETSRAS-FEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL-FPEDTSYSRFRV--SKDGS--LHISNTQTSDAGKYT-CNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQ------VTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLS 1892
             ++FL   T     + P I E P  +  PR+    L+C+A+G P P I WY      KIL G    +    + AG L  L +     + +  +Y C A N LG A S  A+  +A L   F+  P   + A  G+   L C+ P G P PTV W K G+++    + R  I +  +L       I++  + D G+Y C A+N      S+ + LK+  + K Y ++      +   A +  P    G     V W R   G N+   R S  E   LR   + ++D G+Y C   +  G  + A+  L V AP  FIQ P  K+V  G D SF C   G P P ++W +   S L FP      RF    +++G   L ++  Q +D      CN  + + +  S   L +  +E    P+I   P NQTL   S AT +C+ +     TI+WYR     P+Q   ++ I T G L I  +D   D  +YTC AS ++   K+ W+  LR+  P +         ++T+    P        TA ++T+ W ++ +      + Y +E         W+       +   TVE+L+  + Y F+VR+ N  G S
Sbjct:    7 FIVFLLKWTHAQGSHPPRIVEHPIDTTVPRHEPATLNCKAEGSPTPTIQWYKDGVPLKILPG----SHRITLPAGGLFFLKVVNSRRETDAGIYWCEAKNELGVARSRNATLQVAVLRDEFRLEPQNTRIA-QGDTALLECAAPRGIPEPTVTWKKGGQKLDLEGSKRVRIVDGGNL------AIQDARQTDEGQYQCIAKNPVGVRESSLATLKV--HVKPYIIRGPHDQTVLEGASVTFPCRVGGDPMPDVLWLRTASGGNMPLDRVSVLEDRSLRLERVTIADEGEYSCEADNVVGAIT-AMGTLTVYAPPKFIQRPASKSVELGADTSFECRAIGNPKPTIFWTIKNNSTLIFPGAPPLDRFHSLNTEEGHSILTLTRFQRTDKDLVILCNAMNEVASITSRVQLSLDSQEDRPPPIIISGPVNQTLPIKSLATLQCKAIGLPSPTISWYR--DGIPVQPSSKLNITTSGDLIISDLDRQQDQGLYTCVASSRAG--KSTWSGFLRIELPTNPNIKFYRAPEQTKCPSAPGQPKILNATASALTIVWPTSDKAGASSFLGYSVEMYCTNQSRTWIPIASRLSEPIFTVESLTQGAAYMFIVRAENSLGFS 602          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Fly
Match: robo3 (gene:FBgn0041097 transcript:FBtr0335384)

HSP 1 Score: 202.986 bits (515), Expect = 2.303e-52
Identity = 175/614 (28.50%), Postives = 271/614 (44.14%), Query Frame = 3
Query:  111 IVIFLNYITDTLTINAPVITEMP-KSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGT----VHWSRLG-GLNIETSRAS-FEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL-FPEDTSYSRFRV--SKDGS--LHISNTQTSDAGKYT-CNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQ------VTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLS 1892
             ++FL   T     + P I E P  +  PR+    L+C+A+G P P I WY      KIL G    +    + AG L  L +     + +  +Y C A N LG A S  A+  +A L   F+  P   + A  G+   L C+ P G P PTV W K G+++    + R  I +  +L       I++  + D G+Y C A+N      S+ + LK+  + K Y ++      +   A +  P    G     V W R   G N+   R S  E   LR   + ++D G+Y C   +  G  + A+  L V AP  FIQ P  K+V  G D SF C   G P P ++W +   S L FP      RF    +++G   L ++  Q +D      CN  + + +  S   L +  +E    P+I   P NQTL   S AT +C+ +     TI+WYR     P+Q   ++ I T G L I  +D   D  +YTC AS ++   K+ W+  LR+  P +         ++T+    P        TA ++T+ W ++ +      + Y +E         W+       +   TVE+L+  + Y F+VR+ N  G S
Sbjct:    7 FIVFLLKWTHAQGSHPPRIVEHPIDTTVPRHEPATLNCKAEGSPTPTIQWYKDGVPLKILPG----SHRITLPAGGLFFLKVVNSRRETDAGIYWCEAKNELGVARSRNATLQVAVLRDEFRLEPQNTRIA-QGDTALLECAAPRGIPEPTVTWKKGGQKLDLEGSKRVRIVDGGNL------AIQDARQTDEGQYQCIAKNPVGVRESSLATLKV--HVKPYIIRGPHDQTVLEGASVTFPCRVGGDPMPDVLWLRTASGGNMPLDRVSVLEDRSLRLERVTIADEGEYSCEADNVVGAIT-AMGTLTVYAPPKFIQRPASKSVELGADTSFECRAIGNPKPTIFWTIKNNSTLIFPGAPPLDRFHSLNTEEGHSILTLTRFQRTDKDLVILCNAMNEVASITSRVQLSLDSQEDRPPPIIISGPVNQTLPIKSLATLQCKAIGLPSPTISWYR--DGIPVQPSSKLNITTSGDLIISDLDRQQDQGLYTCVASSRAG--KSTWSGFLRIELPTNPNIKFYRAPEQTKCPSAPGQPKILNATASALTIVWPTSDKAGASSFLGYSVEMYCTNQSRTWIPIASRLSEPIFTVESLTQGAAYMFIVRAENSLGFS 602          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Fly
Match: robo2 (gene:FBgn0002543 transcript:FBtr0077941)

HSP 1 Score: 199.134 bits (505), Expect = 4.873e-51
Identity = 226/902 (25.06%), Postives = 370/902 (41.02%), Query Frame = 3
Query:  159 PVITEMP-KSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLG-GLNIETSRAS-FEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVS----KDGSLHISNTQTSDAGKY-TCNCHSSLDARHSSANLFVKKRELEYY---PVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLD----PP-----TEKTADSVTLTWSSTGQ------VTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFG-KVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPAS--NVQSNLTSGV----VDFKFRLPEDATIVKS------IVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRS----LLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEG 2726
            P I E P  +  P+      +C+A+G P P I W+    + K   G    +   ++ AG L  L +     + +   Y C A N  G A S  A+  +A+L   F+  PA  + A  G    + C  P G P P + W KNG+ +    N R  I +  +L       I+   + D G+Y C  +N   T  SAT+ LK+       +  +     + +S   QC +  + +  V W R   G N+   R    E   L+ +++ + D G+Y C   +  G  +   I L V AP  F+  P ++ V  GD+V F C  +G P P +YW + G S+L        R  V+        L I+     D+GK  TCN   +L+A  S ++  V   + ++    P+I   P NQTL   S     C  +      ++WY       +Q   R  +   GAL I  +  + D  +YTC AS ++   K+ W+  LR+          TP N   +    P L     PP      EK  +SVTL+W+ + +      V Y IE       +GWV       +T  T   L P   Y FL+R+ N  GLS  S  +E +   +R        S +   E ++      +   S A +     +KL WQI+ G       +EGF +    +P     +             S    +        L S   NI+ A   + ++N + G     ++ K+R+    TI+         +TGL  ++ YEF +  +Y+  SV  + S S+     E++PS+ P  +      N + + + +  P     +G L   +V +   D+      +L ++  +     + + NL +   Y++ ++  N  G G
Sbjct:   91 PRIIEHPMDTTVPKNDPFTFNCQAEGNPTPTIQWFKDGRELKTDTG----SHRIMLPAGGLFFLKVIHSRRESDAGTYWCEAKNEFGVARSRNATLQVAFLRDEFRLEPANTRVA-QGEVALMECGAPRGSPEPQISWRKNGQTLNLVGNKRIRIVDGGNL------AIQEARQSDDGRYQCVVKNVVGTRESATAFLKVHVRPFLIRGPQNQTAVVGSSVVFQCRIGGDPLPDVLWRRTASGGNMPLRRVHVLEDRSLKLDDVTLEDMGEYTCEADNAVGGITATGI-LTVHAPPKFVIRPKNQLVEIGDEVLFECQANGHPRPTLYWSVEGNSSLLLPGYRDGRMEVTLTPEGRSVLSIARFAREDSGKVVTCN---ALNAVGSVSSRTVVSVDTQFELPPPIIEQGPVNQTLPVKSIVVLPCRTLGTPVPQVSWYLDGIPIDVQEHERRNLSDAGALTISDLQRHEDEGLYTCVASNRNG--KSSWSGYLRLD---------TPTNPNIKFFRAPELSTYPGPPGKPQMVEKGENSVTLSWTRSNKVGGSSLVGYVIEMFGKNETDGWVAVGTRVQNTTFTQTGLLPGVNYFFLIRAENSHGLSLPSPMSEPITVGTR-----YFNSGLDLSEARASLLSGDVVELSNASVVDSTSMKLTWQIINGK-----YVEGFYVYARQLPNPIVNNPAPVTSNTNPLLGSTSTSASASASASALISTKPNIAAAGKRDGETNQSGGGAPTPLNTKYRM---LTILNGGGASSCTITGLVQYTLYEFFIVPFYK--SVEGKPSNSRIARTLEDVPSEAPYGMEALL-LNSSAVFLKWKAPELKDRHGVLLNYHVIVRGIDTAHNFSRILTNVTIDAASPTLVLANLTEGVMYTVGVAAGNNAGVG 950          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Zebrafish
Match: robo3 (roundabout, axon guidance receptor, homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-000209-4])

HSP 1 Score: 204.527 bits (519), Expect = 1.175e-52
Identity = 226/850 (26.59%), Postives = 347/850 (40.82%), Query Frame = 3
Query:  123 LNYITDTLTINAPVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRL-IITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL-FPED--TSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQ------VTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQ--NIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRS 2612
            LN     L   AP I E P       G    L+C+A+G P P + WY    ++   +     +   ++ +G L  L I+    ++ +  VY C A N LG AVS  AS  +A L  +F+  P+ +    +G    + C PP G P PT+ W +N  ++    + R  I       +   L I N  K D+G Y C   N      S  + L +F    + +          ++ + QC +  +   T+ W +  G   E  R  FE      LR   ++  D G Y C   +  G+ +EA  +L V  P   +  P D+   +G  V+F C   G P P V+W+  G   L FP    +   RF VS  G L I++  + D+G Y C   S   +  + A L V+    +  P +I   P NQTL  G+TA  +C V+ +   +I W R      L    RI +   G LQI  +    DS  YTC AS  S   +T W+ +L V   +SG    +P+++  QL  PP     T+ T +SVTLTW            +Y IE     +   W          K TV  LSPN+ Y F+VR+ N  GLS  S  +E V+T   ++  PT +  + + ++Q    ++ + +     +    VK+ W + R        I+G+++ Y  V  S                             W  Q +    +  S V +NL  G                           YE  +  Y+        DS+SQ     EE+PS PP+  N+      N +++ + +  PP    NG +    V    NDS++
Sbjct:   51 LNGSRPRLEDAAPRIVEHPSDLIVSKGEPATLNCKAEGRPTPMVEWYK-DGERVETDREDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGVYVCVARNYLGEAVSRNASLEVAILRDDFRQTPS-DVVVAAGEPAVMECIPPRGHPEPTISWKRNNVKVND-KDERITI-------RGGKLMISNTRKSDAGMYVCVGTNMVGEKDSDPAELVVFERPMFVRRPVNQVVLADDTVDFQCEVQGDPAPTIRWKKEEG---ELPRGRFEIRADNSLRLTQVKAEDEGSYTCLSENSVGK-AEASGSLQVHVPPQIVVRPRDQISAQGRTVTFLCGTKGNPPPAVFWQKEGSQVLLFPSQPPSQSGRFSVSLSGELTITDVHSEDSGYYICQAISVAGSILTKALLEVESTPSDRIPPIIRQGPANQTLAPGTTAQLQCHVMGNPLPSIQWERD-GQRILGIDERISLMENGTLQITALQ-ETDSGAYTCVASSLSG--ETSWSGVLTVK--ESGGLSASPVSEPYQLPGPPQKPVVTDVTRNSVTLTWQPNAHEGGAAVTSYIIEAFSQSAGSTWQTVADFVKLEKHTVTGLSPNTIYLFIVRAVNAYGLSDPSPISEPVRT---QDVSPTGQG-VDHRQVQRELGEMSVQLHEPVLLTASSVKISWNVDRQSQ----YIQGYRLLYRPVGGS-----------------------------WS-QQEVKGATERSAVIANLLKGTE-------------------------YEIKIRPYFNE--FQGLDSRSQTLRTPEEVPSAPPRAVNVATVKLSNSSSISVSWQPPPTDMQNGVIQEYKVWCLGNDSQT 815          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Zebrafish
Match: robo3 (roundabout, axon guidance receptor, homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-000209-4])

HSP 1 Score: 204.527 bits (519), Expect = 1.184e-52
Identity = 226/850 (26.59%), Postives = 347/850 (40.82%), Query Frame = 3
Query:  123 LNYITDTLTINAPVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRL-IITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL-FPED--TSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQ------VTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQ--NIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRS 2612
            LN     L   AP I E P       G    L+C+A+G P P + WY    ++   +     +   ++ +G L  L I+    ++ +  VY C A N LG AVS  AS  +A L  +F+  P+ +    +G    + C PP G P PT+ W +N  ++    + R  I       +   L I N  K D+G Y C   N      S  + L +F    + +          ++ + QC +  +   T+ W +  G   E  R  FE      LR   ++  D G Y C   +  G+ +EA  +L V  P   +  P D+   +G  V+F C   G P P V+W+  G   L FP    +   RF VS  G L I++  + D+G Y C   S   +  + A L V+    +  P +I   P NQTL  G+TA  +C V+ +   +I W R      L    RI +   G LQI  +    DS  YTC AS  S   +T W+ +L V   +SG    +P+++  QL  PP     T+ T +SVTLTW            +Y IE     +   W          K TV  LSPN+ Y F+VR+ N  GLS  S  +E V+T   ++  PT +  + + ++Q    ++ + +     +    VK+ W + R        I+G+++ Y  V  S                             W  Q +    +  S V +NL  G                           YE  +  Y+        DS+SQ     EE+PS PP+  N+      N +++ + +  PP    NG +    V    NDS++
Sbjct:   51 LNGSRPRLEDAAPRIVEHPSDLIVSKGEPATLNCKAEGRPTPMVEWYK-DGERVETDREDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGVYVCVARNYLGEAVSRNASLEVAILRDDFRQTPS-DVVVAAGEPAVMECIPPRGHPEPTISWKRNNVKVND-KDERITI-------RGGKLMISNTRKSDAGMYVCVGTNMVGEKDSDPAELVVFERPMFVRRPVNQVVLADDTVDFQCEVQGDPAPTIRWKKEEG---ELPRGRFEIRADNSLRLTQVKAEDEGSYTCLSENSVGK-AEASGSLQVHVPPQIVVRPRDQISAQGRTVTFLCGTKGNPPPAVFWQKEGSQVLLFPSQPPSQSGRFSVSLSGELTITDVHSEDSGYYICQAISVAGSILTKALLEVESTPSDRIPPIIRQGPANQTLAPGTTAQLQCHVMGNPLPSIQWERD-GQRILGIDERISLMENGTLQITALQ-ETDSGAYTCVASSLSG--ETSWSGVLTVK--ESGGLSASPVSEPYQLPGPPQKPVVTDVTRNSVTLTWQPNAHEGGAAVTSYIIEAFSQSAGSTWQTVADFVKLEKHTVTGLSPNTIYLFIVRAVNAYGLSDPSPISEPVRT---QDVSPTGQG-VDHRQVQRELGEMSVQLHEPVLLTASSVKISWNVDRQSQ----YIQGYRLLYRPVGGS-----------------------------WS-QQEVKGATERSAVIANLLKGTE-------------------------YEIKIRPYFNE--FQGLDSRSQTLRTPEEVPSAPPRAVNVATVKLSNSSSISVSWQPPPTDMQNGVIQEYKVWCLGNDSQT 815          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Zebrafish
Match: robo3 (roundabout, axon guidance receptor, homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-000209-4])

HSP 1 Score: 204.142 bits (518), Expect = 1.564e-52
Identity = 223/839 (26.58%), Postives = 343/839 (40.88%), Query Frame = 3
Query:  156 APVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRL-IITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL-FPED--TSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQ------VTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQ--NIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRS 2612
            AP I E P       G    L+C+A+G P P + WY    ++   +     +   ++ +G L  L I+    ++ +  VY C A N LG AVS  AS  +A L  +F+  P+ +    +G    + C PP G P PT+ W +N  ++    + R  I           L I N  K D+G Y C   N      S  + L +F    + +          ++ + QC +  +   T+ W +  G   E  R  FE      LR   ++  D G Y C   +  G+ +EA  +L V  P   +  P D+   +G  V+F C   G P P V+W+  G   L FP    +   RF VS  G L I++  + D+G Y C   S   +  + A L V+    +  P +I   P NQTL  G+TA  +C V+ +   +I W R      L    RI +   G LQI  +    DS  YTC AS  S   +T W+ +L V   +SG    +P+++  QL  PP     T+ T +SVTLTW            +Y IE     +   W          K TV  LSPN+ Y F+VR+ N  GLS  S  +E V+T   ++  PT +  + + ++Q    ++ + +     +    VK+ W + R        I+G+++ Y  V  S                             W  Q +    +  S V +NL  G                           YE  +  Y+        DS+SQ     EE+PS PP+  N+      N +++ + +  PP    NG +    V    NDS++
Sbjct:   31 APRIVEHPSDLIVSKGEPATLNCKAEGRPTPMVEWYK-DGERVETDREDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGVYVCVARNYLGEAVSRNASLEVAILRDDFRQTPS-DVVVAAGEPAVMECIPPRGHPEPTISWKRNNVKVND-KDERITIRG-------GKLMISNTRKSDAGMYVCVGTNMVGEKDSDPAELVVFERPMFVRRPVNQVVLADDTVDFQCEVQGDPAPTIRWKKEEG---ELPRGRFEIRADNSLRLTQVKAEDEGSYTCLSENSVGK-AEASGSLQVHVPPQIVVRPRDQISAQGRTVTFLCGTKGNPPPAVFWQKEGSQVLLFPSQPPSQSGRFSVSLSGELTITDVHSEDSGYYICQAISVAGSILTKALLEVESTPSDRIPPIIRQGPANQTLAPGTTAQLQCHVMGNPLPSIQWERD-GQRILGIDERISLMENGTLQITALQ-ETDSGAYTCVASSLSG--ETSWSGVLTVK--ESGGLSASPVSEPYQLPGPPQKPVVTDVTRNSVTLTWQPNAHEGGAAVTSYIIEAFSQSAGSTWQTVADFVKLEKHTVTGLSPNTIYLFIVRAVNAYGLSDPSPISEPVRT---QDVSPTGQG-VDHRQVQRELGEMSVQLHEPVLLTASSVKISWNVDRQSQ----YIQGYRLLYRPVGGS-----------------------------WS-QQEVKGATERSAVIANLLKGTE-------------------------YEIKIRPYFNE--FQGLDSRSQTLRTPEEVPSAPPRAVNVATVKLSNSSSISVSWQPPPTDMQNGVIQEYKVWCLGNDSQT 784          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Zebrafish
Match: robo1 (roundabout, axon guidance receptor, homolog 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-000209-3])

HSP 1 Score: 189.504 bits (480), Expect = 7.475e-48
Identity = 215/882 (24.38%), Postives = 348/882 (39.46%), Query Frame = 3
Query:  156 APVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQ---IMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALF---PEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYR-----GPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNT-LIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVR 2732
            AP I E P       G    L+C+A+G P P + WY    + +       +NP     ++  G L   R++        E    C A N LG AVS  AS  +A L  +F+ NP ++    +G    + C PP G P PT+ W K+G  I    + R  I       +   L I N  K D+GKY C   N      S  + L +     + +        +  S E +C    + V T+ W +  G   +     +E + L+   L   D+G Y C+  +  G+ +EA   L V  P  F+  P ++    G  V+F C  +G P P ++W+  G   L          SRF VS+ G L I+  + SD G Y+C   +   +  + A L V     +  P ++   P NQT+    T    C+       TI W +       H+       R+K    GALQI +     D+ +YTC AS  S   +  W A L V    + +Q   P +     S P   D  T+ +  SV+L+W     +     +Y IE     +   W             ++ L P++ Y FLVR+ N  GLS  S  ++ VKT       P     +++ ++Q     + I + +   +    V+++W +     +    I+G+K+ Y   P         +G  +R               +W +                       F+   P + +   ++VT L     YEF V  ++     T  D +   TL  EE PS  P+ +    S +  T +++ +  PP    NG +    +    N+SR  + +   + +   + IP L    +Y L ++     G GV+
Sbjct:   70 APRIVEHPSDLIVSKGEPATLNCKAEGRPTPTVEWYKDGERVETDR----DNPRSHRMLLPTGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSHNASLEVAILRDDFRQNP-VDVMVAAGEPAVMECQPPRGHPEPTISWKKDGVNIDD-RDERITI-------RGGKLMITNTRKTDAGKYVCVGTNMMGERESEIAELTVLERPSFLRKPSSQSVLVDQSVEFRCEAQGDPVPTIRWRKEDGELPKGRYEIWEDHTLKLKRLTSGDAGTYTCQAENMMGK-TEASATLTVHVPPVFVVRPRNQVAGMGRTVTFQCEATGSPQPAIFWQKEGSQNLLFSSQPPPPSSRFSVSQTGDLTITAVERSDGGYYSCQALNIAGSVITKALLEVTDVISDRPPPIVRQGPTNQTVAVDGTVVLSCQATGTPIPTILWRKDGVLVSTHDS------RLKQLDTGALQI-RYAKLGDTGMYTCTASTPSG--EASWKAYLEVQEFGAPVQPGRPTDPNLIPSAPSKPDV-TDVSRTSVSLSWKPNLNAGATPTSYVIEAFSHAAGSSWQTLADHVKTESFVLKGLKPSAVYLFLVRAANAYGLSDPSPISDAVKT----QDVPPTSQGVEHGQIQRELGDVVIHLHNPTILSSSSVRVQWTV----EQQSQYIQGYKVMYRPSP---------EGAPQRV--------------DWAM-----------------------FEVGAPGEHS---AVVTQLKKGITYEFKVRPFFNEFQGTDSDIKVGKTL--EEAPSAAPRGVTVTGSGDNGTAVLVAWQPPPEEEQNGVVQEYKIWCLGNESRYHI-NRTVDGSTHSVLIPGLVAGVTYRLEVAAGTGAGPGVK 867          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Zebrafish
Match: robo2 (roundabout, axon guidance receptor, homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-001019-1])

HSP 1 Score: 170.244 bits (430), Expect = 5.224e-42
Identity = 185/714 (25.91%), Postives = 285/714 (39.92%), Query Frame = 3
Query:  444 LAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE------GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQ----APASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGI-SALFPEDTSY--SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKN-EEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNT 2519
            ++ L  +F+ NP  +    +G    L C PP G P PT+ W K+  +I    +   +   +        L I N  K D+G Y C   N      S T+ + +F    + +           + E +C +  +   ++ W +    ++E  R  ++       + LR      SD G + C   ++ G+  EA   L V+    A   F+  P D+ V +G   SF C   G P P V+W+  G  + LFP       SRF VS  G L I+  Q +DAG Y C   +   +  + A L V     +  P +I   P NQTL   S A  RC        TI+W +   +  L    R+ +   G+LQI  +  + DS IYTC A+  S   +T W+A L V   ++G  V+    DE +L  PP     T+ T +SV+L+W      ++   TY IE         W         T+ T++ L PN+ Y F+VR+ N +GLS  S  +E V+T  ++ S P    D ++ ++              L+P     +++ W + R        I+G+++ Y                         Q   L     W  Q D    S  S V S L  G+V                         YE  V  Y+        DS+S+     EE PS PPQ +      N+N+
Sbjct:    1 VSVLRDDFRQNPT-DVVVAAGEPAILECVPPRGHPEPTIYWKKDKVRIDEKDDRIKIRGGK--------LMISNTRKSDAGMYICVGTNMVGERDSETAQVTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPSIRWKKD---DVEIPRGRYDMKFDKDDFTLRIKKATASDEGTFTCVAENRVGK-MEASATLTVRVLGSAAPQFVIRPRDQIVAQGRTASFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRFSVSPSGDLTITTVQRADAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIIRQGPANQTLGVDSVALLRCHASGEPVPTISWLKDGVSL-LGKDPRMSLQDLGSLQIKGLRLS-DSGIYTCVAASSSG--ETSWSAFLEV--KEAGSLVVVKDRDENELPGPPSKPQVTDVTKNSVSLSWQPGLPGASAISTYVIEAFSQSVSNSWQTVADHAKTTQYTIKGLRPNTIYLFMVRAVNVQGLSDPSPMSEPVRT--QDISPPAQGVDHRHVQKELGEVIVRLHNPVVLSPT---TIQVTWTVDRQSQ----FIQGYRVLYR------------------------QMSGLSSPGAWQTQ-DVKVPSERSMVLSALKKGIV-------------------------YEIKVRPYFNE--FQGMDSESRTARTTEEAPSAPPQQVTVLTVGNQNS 634          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Xenopus
Match: lrrc8c (leucine rich repeat containing 8 VRAC subunit C [Source:Xenbase;Acc:XB-GENE-5797483])

HSP 1 Score: 200.29 bits (508), Expect = 3.031e-51
Identity = 184/607 (30.31%), Postives = 266/607 (43.82%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRL-IITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASF-EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL---FPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDV-TITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPP--TEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    K +  +     +   ++ +G L  L I+   + + +  VY C A N LG AVS  AS  +A L  +F+ NP+    A  G    + C PP G P PT+ W K+G  I    + R  I           L I    K D+GKY C   N      S  + L +     + +    +   + +S E +C    + V TV W +  G ++  SR    + + L+   +   D G Y C   +  G+ +EA   L VQ P +F+  P D+ V  G  V+F C  +G P P ++W+  G   L   +    S SRF VS+ G L I+  Q SD G Y C   +   +  + A L V     +  P VI   P NQT+    T    C + S + V TI W +     P Q   RIK    GALQI +     D+  YTC AS  S   +  W+A + V   + G+ V  P   +  L +P     P  T+ + ++VTL+W     S     +Y IE     S   W    ++       V+ L PN+ Y FLVR+ N  GLS  S  ++ VKT
Sbjct:   21 PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGDKVET-DKDDPRSHRMLLPSGSLFFLRIVHGRKIRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAV-GEPAVMECQPPRGHPEPTISWKKDGTPIDDDKDERITIRG-------GKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVRRPSNMAVTVDDSVEFKCEARGDPVPTVRWRKDDG-DLPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGK-AEASAVLTVQEPPNFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWQKEGSQNLLFSYQPPQSSSRFSVSQTGDLTITTVQKSDVGYYICQTLNVAGSITTKAFLEVTDVVADRPPPVIRQGPVNQTVAVDGTLIMNC-IASGIPVPTIHWRKDGILIPTQ-DSRIKQQDSGALQI-RYAKLSDTGRYTCTASTTSG--EANWSAYIEV--QEFGVPVQPPRATDPNL-IPSAPSKPEVTDVSKNTVTLSWQPNLNSGATPTSYLIEAFSHASGSSWQTVAENVKTDSFAVKALKPNAIYLFLVRAVNAYGLSDPSQISDPVKT 608          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Xenopus
Match: lrrc8c (leucine rich repeat containing 8 VRAC subunit C [Source:Xenbase;Acc:XB-GENE-5797483])

HSP 1 Score: 199.519 bits (506), Expect = 7.015e-51
Identity = 184/607 (30.31%), Postives = 267/607 (43.99%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRL-IITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASF-EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL---FPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDV-TITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPP--TEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    K +  +     +   ++ +G L  L I+   + + +  VY C A N LG AVS  AS  +A L  +F+ NP+    A  G    + C PP G P PT+ W K+G  I    + R  I       +   L I    K D+GKY C   N      S  + L +     + +    +   + +S E +C    + V TV W +  G ++  SR    + + L+   +   D G Y C   +  G+ +EA   L VQ P +F+  P D+ V  G  V+F C  +G P P ++W+  G   L   +    S SRF VS+ G L I+  Q SD G Y C   +   +  + A L V     +  P VI   P NQT+    T    C + S + V TI W +     P Q   RIK    GALQI +     D+  YTC AS  S   +  W+A + V   + G+ V  P   +  L +P     P  T+ + ++VTL+W     S     +Y IE     S   W    ++       V+ L PN+ Y FLVR+ N  GLS  S  ++ VKT
Sbjct:   70 PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGDKVET-DKDDPRSHRMLLPSGSLFFLRIVHGRKIRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAV-GEPAVMECQPPRGHPEPTISWKKDGTPIDDDKDERITI-------RGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVRRPSNMAVTVDDSVEFKCEARGDPVPTVRWRKDDG-DLPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGK-AEASAVLTVQEPPNFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWQKEGSQNLLFSYQPPQSSSRFSVSQTGDLTITTVQKSDVGYYICQTLNVAGSITTKAFLEVTDVVADRPPPVIRQGPVNQTVAVDGTLIMNC-IASGIPVPTIHWRKDGILIPTQ-DSRIKQQDSGALQI-RYAKLSDTGRYTCTASTTSG--EANWSAYIEV--QEFGVPVQPPRATDPNL-IPSAPSKPEVTDVSKNTVTLSWQPNLNSGATPTSYLIEAFSHASGSSWQTVAENVKTDSFAVKALKPNAIYLFLVRAVNAYGLSDPSQISDPVKT 657          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Xenopus
Match: lrrc8c (leucine rich repeat containing 8 VRAC subunit C [Source:Xenbase;Acc:XB-GENE-5797483])

HSP 1 Score: 199.519 bits (506), Expect = 8.070e-51
Identity = 184/607 (30.31%), Postives = 266/607 (43.82%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRL-IITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASF-EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL---FPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDV-TITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPP--TEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    K +  +     +   ++ +G L  L I+   + + +  VY C A N LG AVS  AS  +A L  +F+ NP+    A  G    + C PP G P PT+ W K+G  I    + R  I           L I    K D+GKY C   N      S  + L +     + +    +   + +S E +C    + V TV W +  G ++  SR    + + L+   +   D G Y C   +  G+ +EA   L VQ P +F+  P D+ V  G  V+F C  +G P P ++W+  G   L   +    S SRF VS+ G L I+  Q SD G Y C   +   +  + A L V     +  P VI   P NQT+    T    C + S + V TI W +     P Q   RIK    GALQI +     D+  YTC AS  S   +  W+A + V   + G+ V  P   +  L +P     P  T+ + ++VTL+W     S     +Y IE     S   W    ++       V+ L PN+ Y FLVR+ N  GLS  S  ++ VKT
Sbjct:   70 PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGDKVET-DKDDPRSHRMLLPSGSLFFLRIVHGRKIRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAV-GEPAVMECQPPRGHPEPTISWKKDGTPIDDDKDERITIRG-------GKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVRRPSNMAVTVDDSVEFKCEARGDPVPTVRWRKDDG-DLPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGK-AEASAVLTVQEPPNFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWQKEGSQNLLFSYQPPQSSSRFSVSQTGDLTITTVQKSDVGYYICQTLNVAGSITTKAFLEVTDVVADRPPPVIRQGPVNQTVAVDGTLIMNC-IASGIPVPTIHWRKDGILIPTQ-DSRIKQQDSGALQI-RYAKLSDTGRYTCTASTTSG--EANWSAYIEV--QEFGVPVQPPRATDPNL-IPSAPSKPEVTDVSKNTVTLSWQPNLNSGATPTSYLIEAFSHASGSSWQTVAENVKTDSFAVKALKPNAIYLFLVRAVNAYGLSDPSQISDPVKT 657          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Xenopus
Match: lrrc8c (leucine rich repeat containing 8 VRAC subunit C [Source:Xenbase;Acc:XB-GENE-5797483])

HSP 1 Score: 199.134 bits (505), Expect = 9.294e-51
Identity = 184/607 (30.31%), Postives = 266/607 (43.82%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRL-IITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASF-EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL---FPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDV-TITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPP--TEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    K +  +     +   ++ +G L  L I+   + + +  VY C A N LG AVS  AS  +A L  +F+ NP+    A  G    + C PP G P PT+ W K+G  I    + R  I           L I    K D+GKY C   N      S  + L +     + +    +   + +S E +C    + V TV W +  G ++  SR    + + L+   +   D G Y C   +  G+ +EA   L VQ P +F+  P D+ V  G  V+F C  +G P P ++W+  G   L   +    S SRF VS+ G L I+  Q SD G Y C   +   +  + A L V     +  P VI   P NQT+    T    C + S + V TI W +     P Q   RIK    GALQI +     D+  YTC AS  S   +  W+A + V   + G+ V  P   +  L +P     P  T+ + ++VTL+W     S     +Y IE     S   W    ++       V+ L PN+ Y FLVR+ N  GLS  S  ++ VKT
Sbjct:   30 PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGDKVET-DKDDPRSHRMLLPSGSLFFLRIVHGRKIRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAV-GEPAVMECQPPRGHPEPTISWKKDGTPIDDDKDERITIRG-------GKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVRRPSNMAVTVDDSVEFKCEARGDPVPTVRWRKDDG-DLPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGK-AEASAVLTVQEPPNFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWQKEGSQNLLFSYQPPQSSSRFSVSQTGDLTITTVQKSDVGYYICQTLNVAGSITTKAFLEVTDVVADRPPPVIRQGPVNQTVAVDGTLIMNC-IASGIPVPTIHWRKDGILIPTQ-DSRIKQQDSGALQI-RYAKLSDTGRYTCTASTTSG--EANWSAYIEV--QEFGVPVQPPRATDPNL-IPSAPSKPEVTDVSKNTVTLSWQPNLNSGATPTSYLIEAFSHASGSSWQTVAENVKTDSFAVKALKPNAIYLFLVRAVNAYGLSDPSQISDPVKT 617          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Xenopus
Match: lrrc8c (leucine rich repeat containing 8 VRAC subunit C [Source:Xenbase;Acc:XB-GENE-5797483])

HSP 1 Score: 199.134 bits (505), Expect = 9.550e-51
Identity = 184/607 (30.31%), Postives = 267/607 (43.99%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRL-IITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASF-EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL---FPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDV-TITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPP--TEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    K +  +     +   ++ +G L  L I+   + + +  VY C A N LG AVS  AS  +A L  +F+ NP+    A  G    + C PP G P PT+ W K+G  I    + R  I       +   L I    K D+GKY C   N      S  + L +     + +    +   + +S E +C    + V TV W +  G ++  SR    + + L+   +   D G Y C   +  G+ +EA   L VQ P +F+  P D+ V  G  V+F C  +G P P ++W+  G   L   +    S SRF VS+ G L I+  Q SD G Y C   +   +  + A L V     +  P VI   P NQT+    T    C + S + V TI W +     P Q   RIK    GALQI +     D+  YTC AS  S   +  W+A + V   + G+ V  P   +  L +P     P  T+ + ++VTL+W     S     +Y IE     S   W    ++       V+ L PN+ Y FLVR+ N  GLS  S  ++ VKT
Sbjct:   21 PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGDKVET-DKDDPRSHRMLLPSGSLFFLRIVHGRKIRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAV-GEPAVMECQPPRGHPEPTISWKKDGTPIDDDKDERITI-------RGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVRRPSNMAVTVDDSVEFKCEARGDPVPTVRWRKDDG-DLPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGK-AEASAVLTVQEPPNFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWQKEGSQNLLFSYQPPQSSSRFSVSQTGDLTITTVQKSDVGYYICQTLNVAGSITTKAFLEVTDVVADRPPPVIRQGPVNQTVAVDGTLIMNC-IASGIPVPTIHWRKDGILIPTQ-DSRIKQQDSGALQI-RYAKLSDTGRYTCTASTTSG--EANWSAYIEV--QEFGVPVQPPRATDPNL-IPSAPSKPEVTDVSKNTVTLSWQPNLNSGATPTSYLIEAFSHASGSSWQTVAENVKTDSFAVKALKPNAIYLFLVRAVNAYGLSDPSQISDPVKT 608          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Mouse
Match: Robo1 (roundabout guidance receptor 1 [Source:MGI Symbol;Acc:MGI:1274781])

HSP 1 Score: 193.741 bits (491), Expect = 3.949e-49
Identity = 178/605 (29.42%), Postives = 260/605 (42.98%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRL-IITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL---FPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPP--TEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    + +  +     +   ++ +G L  L I+   +++ +  VY C A N LG AVS  AS  +A L  +F+ NP+    A  G    + C PP G P PT+ W K+G  +    + R  I       +   L I    K D+GKY C   N      S  + L +     + K    L   + +SAE +C    + V TV W +  G   ++     + + L+   +   D G Y C   +  G+ +EA   L VQ P  F+  P D+ V  G  V+F C  +G P P ++W   G   L   +    S SRF VS+ G L I+N Q SD G Y C   +   +  + A L V     +  P VI   P NQT+    T    C        TI W +       Q   RIK    G LQI +     D+  YTC AS  S   +  W+A + V   + G+ V  P   +  L +P     P  T+ + ++VTL+W     S     +Y IE     S   W    ++       ++ L PN+ Y FLVR+ N  G+S  S  ++ VKT
Sbjct:   29 PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVET-DKDDPRSHRMLLPSGSLFFLRIVHGRKSRPDEGVYICVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAV-GEPAVMECQPPRGHPEPTISWKKDGSPLDD-KDERITI-------RGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGK-AEASATLTVQEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTLILSCVATGSPAPTILWRKDGVLVSTQ-DSRIKQLESGVLQI-RYAKLGDTGRYTCTASTPSG--EATWSAYIEVQ--EFGVPVQPPRPTDPNL-IPSAPSKPEVTDVSKNTVTLSWQPNLNSGATPTSYIIEAFSHASGSSWQTAAENVKTETFAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKT 615          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Mouse
Match: Robo1 (roundabout guidance receptor 1 [Source:MGI Symbol;Acc:MGI:1274781])

HSP 1 Score: 193.356 bits (490), Expect = 4.798e-49
Identity = 179/607 (29.49%), Postives = 261/607 (43.00%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRL-IITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL---FPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQI--LKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPP--TEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    + +  +     +   ++ +G L  L I+   +++ +  VY C A N LG AVS  AS  +A L  +F+ NP+    A  G    + C PP G P PT+ W K+G  +    + R  I       +   L I    K D+GKY C   N      S  + L +     + K    L   + +SAE +C    + V TV W +  G   ++     + + L+   +   D G Y C   +  G+ +EA   L VQ P  F+  P D+ V  G  V+F C  +G P P ++W   G   L   +    S SRF VS+ G L I+N Q SD G Y C   +   +  + A L V     +  P VI   P NQT+    T    C        TI W +       Q   RIK    G LQI   K+    D+  YTC AS  S   +  W+A + V   + G+ V  P   +  L +P     P  T+ + ++VTL+W     S     +Y IE     S   W    ++       ++ L PN+ Y FLVR+ N  G+S  S  ++ VKT
Sbjct:   39 PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVET-DKDDPRSHRMLLPSGSLFFLRIVHGRKSRPDEGVYICVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAV-GEPAVMECQPPRGHPEPTISWKKDGSPLDD-KDERITI-------RGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGK-AEASATLTVQEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTLILSCVATGSPAPTILWRKDGVLVSTQ-DSRIKQLESGVLQIRYAKLG---DTGRYTCTASTPSG--EATWSAYIEVQ--EFGVPVQPPRPTDPNL-IPSAPSKPEVTDVSKNTVTLSWQPNLNSGATPTSYIIEAFSHASGSSWQTAAENVKTETFAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKT 625          

HSP 2 Score: 118.242 bits (295), Expect = 5.139e-26
Identity = 107/409 (26.16%), Postives = 167/409 (40.83%), Query Frame = 3
Query:  393 NASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKE-----AYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASN---SRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKI-FSNSKYYKMQKELKYRISNSAEIQCPL---NEVGTVHWSRLGG-LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYW-----ELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYR-GPHN-----EPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCE 1547
            N  NSLGY       TG      +F   P I +         G    L+C   EGRP PT++W+K G ++ +  +   S  ++     L    I+  R  ++ D G Y C A N      S  ++L++      + +   ++   +   A ++C     +   T+ W + G  L+ +  R +  G  L     + SD+GKYVC  T+  G+    +  L V    SF++ P +  V   D   F C   G P+P V W     ELP            SR+ +  D +L I      D G YTC   + +    +SA L V++      P   + P++Q +  G T TF+CE   +    I W R G  N     +P Q+  R  +   G L I  +    D   Y C+
Sbjct:   20 NDDNSLGY-------TGSRLRQEDFP--PRIVEHPSDLIVSKGEPATLNCKA-EGRPTPTIEWYKGGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRK-SRPDEGVYICVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGELP-----------KSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQEP-----PHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQ-RSDVGYYICQ 400          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Mouse
Match: Robo2 (roundabout guidance receptor 2 [Source:MGI Symbol;Acc:MGI:1890110])

HSP 1 Score: 191.43 bits (485), Expect = 1.507e-48
Identity = 180/608 (29.61%), Postives = 259/608 (42.60%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGI-SALFPEDTSY--SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLP-PQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQI--LKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW--SSTGQV---TYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    ++   +     +   ++ +G L   R++        E    C A N LG AVS  AS  +A L  +F+ NP  +    +G    L C PP G P PT+ W K+  +I        +   +        L I N  K D+G Y C   N      S  + L +F    + +           + E +C +  +   TV W +    + +  R  ++    Y LR      +D G YVC   ++ G+  EA   L V+AP  F+  P D+ V +G  V+F C   G P P V+W+  G  + LFP       SR  VS  G L I+N Q SDAG Y C   +   +  + A L V     +  P I L  P NQTL    TA  +C+        I+W +      L    R  I  +G LQI  L+I    D+  YTC A+  S   +T W+A+L V    + I     +ND   L  PP     T+ + +SVTL+W   + G +    Y IE         W         T  TV  L PN+ Y F+VR+ N +GLS  S  ++ V+T
Sbjct:   31 PRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYK-DGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPT-DVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGK--------LMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKD---DADLPRGRYDIKDDYTLRIKKAMSTDEGTYVCIAENRVGK-VEASATLTVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTF-LGRDPRATIQDQGTLQIKNLRIS---DTGTYTCVATSSSG--ETSWSAVLDVTESGATISKNYDMND---LPGPPSKPQVTDVSKNSVTLSWQPGTPGVLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRT 615          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Mouse
Match: Robo2 (roundabout guidance receptor 2 [Source:MGI Symbol;Acc:MGI:1890110])

HSP 1 Score: 191.045 bits (484), Expect = 2.443e-48
Identity = 180/608 (29.61%), Postives = 259/608 (42.60%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGI-SALFPEDTSY--SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLP-PQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQI--LKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW--SSTGQV---TYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    ++   +     +   ++ +G L   R++        E    C A N LG AVS  AS  +A L  +F+ NP  +    +G    L C PP G P PT+ W K+  +I        +   +        L I N  K D+G Y C   N      S  + L +F    + +           + E +C +  +   TV W +    + +  R  ++    Y LR      +D G YVC   ++ G+  EA   L V+AP  F+  P D+ V +G  V+F C   G P P V+W+  G  + LFP       SR  VS  G L I+N Q SDAG Y C   +   +  + A L V     +  P I L  P NQTL    TA  +C+        I+W +      L    R  I  +G LQI  L+I    D+  YTC A+  S   +T W+A+L V    + I     +ND   L  PP     T+ + +SVTL+W   + G +    Y IE         W         T  TV  L PN+ Y F+VR+ N +GLS  S  ++ V+T
Sbjct:   31 PRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYK-DGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPT-DVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGK--------LMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKD---DADLPRGRYDIKDDYTLRIKKAMSTDEGTYVCIAENRVGK-VEASATLTVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTF-LGRDPRATIQDQGTLQIKNLRIS---DTGTYTCVATSSSG--ETSWSAVLDVTESGATISKNYDMND---LPGPPSKPQVTDVSKNSVTLSWQPGTPGVLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRT 615          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Mouse
Match: Robo2 (roundabout guidance receptor 2 [Source:MGI Symbol;Acc:MGI:1890110])

HSP 1 Score: 186.422 bits (472), Expect = 2.550e-47
Identity = 180/612 (29.41%), Postives = 259/612 (42.32%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQ----APASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGI-SALFPEDTSY--SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLP-PQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQI--LKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW--SSTGQV---TYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    ++   +     +   ++ +G L   R++        E    C A N LG AVS  AS  +A L  +F+ NP  +    +G    L C PP G P PT+ W K+  +I        +   +        L I N  K D+G Y C   N      S  + L +F    + +           + E +C +  +   TV W +    + +  R  ++    Y LR      +D G YVC   ++ G+  EA   L V+    AP  F+  P D+ V +G  V+F C   G P P V+W+  G  + LFP       SR  VS  G L I+N Q SDAG Y C   +   +  + A L V     +  P I L  P NQTL    TA  +C+        I+W +      L    R  I  +G LQI  L+I    D+  YTC A+  S   +T W+A+L V    + I     +ND   L  PP     T+ + +SVTL+W   + G +    Y IE         W         T  TV  L PN+ Y F+VR+ N +GLS  S  ++ V+T
Sbjct:   31 PRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYK-DGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPT-DVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGK--------LMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKD---DADLPRGRYDIKDDYTLRIKKAMSTDEGTYVCIAENRVGK-VEASATLTVRVRPVAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTF-LGRDPRATIQDQGTLQIKNLRIS---DTGTYTCVATSSSG--ETSWSAVLDVTESGATISKNYDMND---LPGPPSKPQVTDVSKNSVTLSWQPGTPGVLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRT 619          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. UniProt/SwissProt
Match: sp|O89026|ROBO1_MOUSE (Roundabout homolog 1 OS=Mus musculus OX=10090 GN=Robo1 PE=1 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 2.624e-48
Identity = 179/607 (29.49%), Postives = 261/607 (43.00%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRL-IITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL---FPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQI--LKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPP--TEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    + +  +     +   ++ +G L  L I+   +++ +  VY C A N LG AVS  AS  +A L  +F+ NP+    A  G    + C PP G P PT+ W K+G  +    + R  I       +   L I    K D+GKY C   N      S  + L +     + K    L   + +SAE +C    + V TV W +  G   ++     + + L+   +   D G Y C   +  G+ +EA   L VQ P  F+  P D+ V  G  V+F C  +G P P ++W   G   L   +    S SRF VS+ G L I+N Q SD G Y C   +   +  + A L V     +  P VI   P NQT+    T    C        TI W +       Q   RIK    G LQI   K+    D+  YTC AS  S   +  W+A + V   + G+ V  P   +  L +P     P  T+ + ++VTL+W     S     +Y IE     S   W    ++       ++ L PN+ Y FLVR+ N  G+S  S  ++ VKT
Sbjct:   29 PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVET-DKDDPRSHRMLLPSGSLFFLRIVHGRKSRPDEGVYICVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAV-GEPAVMECQPPRGHPEPTISWKKDGSPLDD-KDERITI-------RGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGK-AEASATLTVQEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTLILSCVATGSPAPTILWRKDGVLVSTQ-DSRIKQLESGVLQIRYAKLG---DTGRYTCTASTPSG--EATWSAYIEVQ--EFGVPVQPPRPTDPNL-IPSAPSKPEVTDVSKNTVTLSWQPNLNSGATPTSYIIEAFSHASGSSWQTAAENVKTETFAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKT 615          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. UniProt/SwissProt
Match: sp|Q9HCK4|ROBO2_HUMAN (Roundabout homolog 2 OS=Homo sapiens OX=9606 GN=ROBO2 PE=1 SV=2)

HSP 1 Score: 192.586 bits (488), Expect = 3.910e-48
Identity = 181/612 (29.58%), Postives = 259/612 (42.32%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGI-SALFPEDTSY--SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLP-PQNQTLIEGSTATFRCEVVSHMDVTITWYRG----PHNEPLQAGGRIKIPTKGALQI--LKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQVT-----YWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    ++   +     +   ++ +G L   R++        E    C A N LG AVS  AS  +A L  +F+ NP  +    +G    L C PP G P PT+ W K+  +I        +   +        L I N  K D+G Y C   N      S  + L +F    + +           + E +C +  +   TV W +    + +  R  ++    Y LR      +D G Y+C   ++ G+  EA   L V+AP  F+  P D+ V +G  V+F C   G P P V+W+  G  + LFP       SR  VS  G L I+N Q SDAG Y C   +   +  + A L V     +  P I L  P NQTL    TA  +C+        I+W +     P  +P     R  I  +G LQI  L+I    D+  YTC A+  S   +T W+A+L V    + I     L+D   L  PP     T+ T +SVTL+W      T     Y IE         W         T  TV  L PN+ Y F+VR+ N +GLS  S  ++ V+T
Sbjct:   31 PRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYK-DGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPT-DVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGK--------LMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKD---DADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK-MEASATLTVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPANQTLAVDGTALLKCKATGDPLPVISWLKEGFTFPGRDP-----RATIQEQGTLQIKNLRIS---DTGTYTCVATSSSG--ETSWSAVLDVTESGATISKNYDLSD---LPGPPSKPQVTDVTKNSVTLSWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRT 615          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. UniProt/SwissProt
Match: sp|O55005|ROBO1_RAT (Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.659e-47
Identity = 176/605 (29.09%), Postives = 260/605 (42.98%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRL-IITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL---FPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPP--TEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    + +  +     +   ++ +G L  L I+   +++ +  VY C A N LG AVS  AS  +A L  +F+ NP+    A  G    + C PP G P PT+ W K+G  +    + R  I       +   L I    K D+GKY C   N      S  +++ +     + K    L   + +SAE +C    + V T  W +  G   ++     + + L+   +   D G Y C   +  G+ +EA   L VQ P  F+  P D+ V  G  V+F C  +G P P ++W   G   L   +    S SRF VS+ G L ++N Q SD G Y C   +   +  + A L V     +  P VI   P NQT+    T T  C        TI W +       Q   RIK    G LQI +     D+  YTC AS  S   +  W+A + V   + G+ V  P   +  L +P     P  T+ + ++VTL W     S     +Y IE     S   W    ++       ++ L PN+ Y FLVR+ N  G+S  S  ++ VKT
Sbjct:   68 PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVET-DKDDPRSHRMLLPSGSLFFLRIVHGRKSRPDEGVYICVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAV-GEPAVMECQPPRGHPEPTISWKKDGSPLDD-KDERITI-------RGGKLMITYTRKSDAGKYVCVGTNMVGERESKVADVTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTFGWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGK-AEASATLTVQEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTVTNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTLTLSCVATGSPVPTILWRKDGVLVSTQ-DSRIKQLESGVLQI-RYAKLGDTGRYTCTASTPSG--EATWSAYIEVQ--EFGVPVQPPRPTDPNL-IPSAPSKPEVTDVSKNTVTLLWQPNLNSGATPTSYIIEAFSHASGSSWQTVAENVKTETFAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKT 654          

HSP 2 Score: 115.161 bits (287), Expect = 2.786e-24
Identity = 104/409 (25.43%), Postives = 167/409 (40.83%), Query Frame = 3
Query:  393 NASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKE-----AYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASN---SRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKI-FSNSKYYKMQKELKYRISNSAEIQCPL---NEVGTVHWSRLGG-LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYW-----ELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYR-GPHN-----EPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCE 1547
            N  NSLGY       TG      +F   P I +         G    L+C   EGRP PT++W+K G ++ +  +   S  ++     L    I+  R  ++ D G Y C A N      S  ++L++      + +   ++   +   A ++C     +   T+ W + G  L+ +  R +  G  L     + SD+GKYVC  T+  G+    + ++ V    SF++ P +  V   D   F C   G P+P   W     ELP            SR+ +  D +L I      D G YTC   + +    +SA L V++      P   + P++Q +  G T TF+CE   +    I W R G  N     +P Q+  R  +   G L +  +    D   Y C+
Sbjct:   49 NDDNSLGY-------TGSRLRQEDFP--PRIVEHPSDLIVSKGEPATLNCKA-EGRPTPTIEWYKGGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRK-SRPDEGVYICVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYVCVGTNMVGERESKVADVTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTFGWRKDDGELP-----------KSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQEP-----PHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTVTNVQ-RSDVGYYICQ 429          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. UniProt/SwissProt
Match: sp|Q9Y6N7|ROBO1_HUMAN (Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 2.179e-47
Identity = 178/605 (29.42%), Postives = 260/605 (42.98%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRL-IITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL---FPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPP--TEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    + +  +     +   ++ +G L  L I+   +++ +  VY C A N LG AVS  AS  +A L  +F+ NP+    A  G    + C PP G P PT+ W K+G  +    + R  I       +   L I    K D+GKY C   N      S  + L +     + K    L   + +SAE +C    + V TV W +  G   ++     + + L+   +   D G Y C   +  G+ +EA   L VQ P  F+  P D+ V  G  V+F C  +G P P ++W   G   L   +    S SRF VS+ G L I+N Q SD G Y C   +   +  + A L V     +  P VI   P NQT+    T    C        TI W +       Q   RIK    G LQI +     D+  YTC AS  S   +  W+A + V   + G+ V  P   +  L +P     P  T+ + ++VTL+W     S     +Y IE     S   W    ++       ++ L PN+ Y FLVR+ N  G+S  S  ++ VKT
Sbjct:   68 PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVET-DKDDPRSHRMLLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAV-GEPAVMECQPPRGHPEPTISWKKDGSPLDD-KDERITI-------RGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGK-AEASATLTVQEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTFVLSCVATGSPVPTILWRKDGVLVSTQ-DSRIKQLENGVLQI-RYAKLGDTGRYTCIASTPSG--EATWSAYIEVQ--EFGVPVQPPRPTDPNL-IPSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYIIEAFSHASGSSWQTVAENVKTETSAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKT 654          

HSP 2 Score: 118.242 bits (295), Expect = 3.534e-25
Identity = 107/409 (26.16%), Postives = 167/409 (40.83%), Query Frame = 3
Query:  393 NASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKE-----AYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASN---SRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKI-FSNSKYYKMQKELKYRISNSAEIQCPL---NEVGTVHWSRLGG-LNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYW-----ELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYR-GPHN-----EPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCE 1547
            N  NSLGY       TG      +F   P I +         G    L+C   EGRP PT++W+K G ++ +  +   S  ++     L    I+  R  ++ D G Y C A N      S  ++L++      + +   ++   +   A ++C     +   T+ W + G  L+ +  R +  G  L     + SD+GKYVC  T+  G+    +  L V    SF++ P +  V   D   F C   G P+P V W     ELP            SR+ +  D +L I      D G YTC   + +    +SA L V++      P   + P++Q +  G T TF+CE   +    I W R G  N     +P Q+  R  +   G L I  +    D   Y C+
Sbjct:   49 NDDNSLGY-------TGSRLRQEDFP--PRIVEHPSDLIVSKGEPATLNCKA-EGRPTPTIEWYKGGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRK-SRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGELP-----------KSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQEP-----PHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQ-RSDVGYYICQ 429          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. UniProt/SwissProt
Match: sp|Q7TPD3|ROBO2_MOUSE (Roundabout homolog 2 OS=Mus musculus OX=10090 GN=Robo2 PE=1 SV=2)

HSP 1 Score: 185.267 bits (469), Expect = 8.921e-46
Identity = 180/612 (29.41%), Postives = 259/612 (42.32%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQ----APASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGI-SALFPEDTSY--SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLP-PQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQI--LKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW--SSTGQV---TYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P I WY    ++   +     +   ++ +G L   R++        E    C A N LG AVS  AS  +A L  +F+ NP  +    +G    L C PP G P PT+ W K+  +I        +   +        L I N  K D+G Y C   N      S  + L +F    + +           + E +C +  +   TV W +    + +  R  ++    Y LR      +D G YVC   ++ G+  EA   L V+    AP  F+  P D+ V +G  V+F C   G P P V+W+  G  + LFP       SR  VS  G L I+N Q SDAG Y C   +   +  + A L V     +  P I L  P NQTL    TA  +C+        I+W +      L    R  I  +G LQI  L+I    D+  YTC A+  S   +T W+A+L V    + I     +ND   L  PP     T+ + +SVTL+W   + G +    Y IE         W         T  TV  L PN+ Y F+VR+ N +GLS  S  ++ V+T
Sbjct:   31 PRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYK-DGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPT-DVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGK--------LMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKD---DADLPRGRYDIKDDYTLRIKKAMSTDEGTYVCIAENRVGK-VEASATLTVRVRPVAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTF-LGRDPRATIQDQGTLQIKNLRIS---DTGTYTCVATSSSG--ETSWSAVLDVTESGATISKNYDMND---LPGPPSKPQVTDVSKNSVTLSWQPGTPGVLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRT 619          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. TrEMBL
Match: A0A5J4P2K6 (Roundabout, axon guidance receptor 2 OS=Paragonimus westermani OX=34504 GN=DEA37_0014480 PE=4 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 9.505e-105
Identity = 299/1041 (28.72%), Postives = 461/1041 (44.28%), Query Frame = 3
Query:   96 SYLIQIVIFLNYITDTLTINAPVITEMPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGI---GINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVS-PPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSA---SNSRYLITNQPDLNQYSI---LKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSY-----SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANL-----------FVKKRE----------------LEYYPVISLPPQNQTLIEGSTATFRCEV-----------------------VSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILK--------------------IDPNL-DSNIYTCEASLKSN----------LMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSST--------------------GQVTYWIEYVRFGS-REGWVIYKKDWPDTKITVENLSPNSWYQFLVRSR-NHKGLSRASVPTEYVKTLSRENSRPT-----LKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKR------KRYCSFQGRS----------LDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPE----DATIVKS--IVTGLNPFSCYEFTVEAYYENP---SVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIE--IPNLDDRKSYSLHLSVFNCRGEGVRSQRIYVPARTEP 2768
            S+L ++++  N  T T +  +PVI   P   F   G LE  C+ADG P P I+WYD  + Q++++ +   G  + + + +     RL+++ P     Y  YCNASNS G+  S PP    LAYL+  F  NP ++K  + G+ V L C PP+G P P+V W K+ + I +    + S  L T    L   +    L++   +  DSG Y C A N    VRS   +L +    ++ +  K+++ R   SA+  C       VHWSR  G  I+ +RA     YL   N+Q SD+G Y+C   + SG  +   + L V+ P +F +TPDD TV EG    F CI +G+P P +YWEL   + +FP D S      SR  + K+G L I N Q +DAGKY C  HSS+D  HSSA L           FV + E                    P+I LPP NQT   G   T  CE+                       +S  D TI W R              + TKG+LQ L                      D  L D+ IY C A +  N          L+++ WTA L ++    G  +   +  E  LS PP     T  T  +VTL W  +                     QV YW+E+ RF    +GW + + +WP T + +  L PN+ Y FL+R R N   +  AS P   V TL   + +       L S +  +++ +    +QI       +    +++ W  V+   +   ++ G+ I Y  + L +C+     G  K         YCS Q  S          L ++++  + +D  +  P + + S     +  +KF   E      T+ +S  ++  L PF CY+  V+A+  +P    +  R+S     L FE  PS PP+ I+  W    N + + +  PP   WNG L+G  ++++   + +      FN ++ +++  +  LD  K+Y + ++  NC+G G+RS+    P R +P
Sbjct:   17 SFLPEVILLRNDKTVTESPRSPVIRTPPTDMFSAEGVLEFVCQADGYPKPIINWYDGSTGQQVIDRVPTSGATSGIHVNQH--YGRLMVSNPTKNKIYTFYCNASNSAGWITSQPPVKGALAYLDSLFHQNP-MDKTVHEGDRVLLECRPPKGIPVPSVMWLKDDKPIAAQHGLAQSVNLTTPSKSLAHVTEEGNLQLNTVSLADSGSYTCVAVNLAGQVRSTHGHLTVEPRVRFLETPKDIRVRQGTSAKFHCRTEGNQLVHWSRADG-TIDPTRAELAEGYLLLKNVQFSDAGIYIC---AASGSIAADAV-LTVETPPTFSRTPDDLTVHEGQTAVFNCITTGYPKPSIYWELADKTPIFPSDNSMSVGMTSRIYLHKEGRLEIGNVQITDAGKYQCTAHSSVDRIHSSATLRVIPRSSNKTHFVSRLESSASKQESSRNEHHAYFTIAPIIGLPPVNQTRYVGDVITLDCELGITKPLPMVSTQSFSSVPEIVGDLSATDWTIAWQRA------------TVATKGSLQQLDFSRFVDEQRYSLLPGGSLQIFDAQLTDTGIYICSARVPFNLPMPEFQSPHLLQSNWTAHLNIV--PRGTPIRNDVGHENPLS-PPRGLKVTNLTDTTVTLAWEESIWADPGLSALDLGHRAENQPRQVAYWVEFYRFDRPLDGWTVVESNWPATTVKIGGLQPNTAYHFLIRPRWNFGRVGWASAPLGPVITLPTSDRKIVSDDWELDSHLLTKDLVNTVRNVQIHSLKWYAVAPQNLRVSW-TVQEKPRVLSLLNGYTIYYNKISLVQCIAGALDGVNKDPVLSDPNAYCSLQTGSSEPANDLYLRLQELQHLRVSADMNSPQPMNPIISTDVKAL--YKFNGAETNANKPTVYESSGLLRDLEPFHCYKIRVKAHTTSPLLGKIEGRESIPHTALTFESFPSLPPERIQARWITEEN-IELSWFAPPAIGWNGLLTGYAIYVYDELAHN---HQTFNISYSELQTHVDGLDGPKTYFIQMAAINCKGVGLRSK----PLRLDP 1023          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. TrEMBL
Match: A0A2H1CX77 (Immunoglobulin I-set domain protein OS=Fasciola hepatica OX=6192 GN=D915_000146 PE=4 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 3.146e-97
Identity = 294/1018 (28.88%), Postives = 451/1018 (44.30%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGI---GINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVS-PPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASN--SRYLIT----NQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLN-IETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPED-----TSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKREL-----------------------------EYYP---VISLPPQNQTLIEGSTATFRCEV------VSHM----------------DVTITWYR-----GPHNEPLQAG-----GRIKIPTKGALQILKIDPNLDSNIYTCEAS--------LKSN---LMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW----------------------SSTGQVTYWIEYVRFG-SREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKG-LSRASVPTEYVKTLSRE-----NSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGII--IEGFKIRYTMVPLSRCLDDGNQGHMKRK-------RYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGV------VDFKFRLPEDATIVK----------SIVTGLNPFSCYEFTVEAYYENP---SVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRSQRIYVPARTEP 2768
            PVI E+P   F   G LE +C+ADG P P I+W+D  + QK+++ +   G    + + +     RL+++ P     Y  YCNASNS G+ VS PP   GLAYL   F+ NP I+K  + G+ V L C PP G P P V WF +G  I + S    R  +T    +   L     L+I   +  D+G+Y C A N  +  +S  + L +   +++ +   +++     +A+ +C +     V W R  G   I+ +R      YL   N+Q SD+G YVC  T+     ++A+  L V+ P +F +TPDD TV+      F C+ +GFP P +YWELP  + +FP +     +++SRF + KDG+L I N Q SDAGKY C  HSS+D  HSSA L V  + +                             EYYP   +I LPP NQT + G      CE+      VS +                D T+TW R     G   E L         R  +   G+LQI       D+  YTC A         LK     L+++ WTA L+V+   S I        E  LS PP     T  T  ++TL W                      +  G +TYW+EY R   + EGW   +K+WP   + +  L PN+ Y FL+R R   G +   SVP   V T S +     NS+    SD   +E+      ++I+   L PI   ++++ W +     +  +I  I G+ I Y  + L +C+    Q   +R         YCS +  S    R+      +  +     ++  L + +      +D K   P D +  +           ++  L+PF CYE +V+ +  +        R+S +   + FE  PS PP+ +   W+   + L + +  PP   WNG L G  ++++   +R    +   + + K   I  L    +Y + L+   C+G G+RS+    P R +P
Sbjct:   33 PVIYEIPVDTFSADGVLEFTCQADGFPKPTITWFDAFTGQKVIDHVPSSGSTTGIHVNQH--YGRLMVSNPMRNKIYSFYCNASNSAGWTVSQPPVKGGLAYLETTFRQNP-IDKTVHQGDRVLLECIPPAGLPEPKVAWFHSGSLIAAQSGFPQRSNLTVDSASHTQLTDPGHLQISAASLADAGEYVCVAANNAAEQQSIPARLSVKPRARFIETPTDIRVAKGENAKFRCRVEGNQMVKWGRGSGEGLIDPTRIELADGYLLLKNVQPSDAGVYVC--TALGSIAADAM--LTVETPPTFSRTPDDLTVMVSQTARFFCVTTGFPQPSIYWELPDKTPVFPSEEVANPSTHSRFYLHKDGTLEIRNVQVSDAGKYQCTAHSSIDRVHSSATLRVISKSMHTHEDSEDSALLSRTPNIDSLNRNPHFHYEYYPLAPIIGLPPVNQTRVVGDLVILDCELGATRQPVSMVNELPIGNVNIPQNQASDWTVTWQRATLATGEIGEKLDLSRLVHEQRYSLLPGGSLQIFNAQLT-DTGSYTCSAQTWVQPDPILKKQSAILLQSNWTAHLKVVPVGSSINADQ--GHENPLS-PPRDLRVTNVTESTITLAWEDSNWLRPISNSIDQVNEITHNTGNGLITYWVEYYRPDRATEGWRTVEKNWPANTVQIGGLQPNTAYYFLIRPRWSFGRVGWVSVPLGPVFTKSTQHVEVGNSQTNFVSD---KELLQGMRNVEISRVHLHPISSKRMRVSWTV---HERPHVIQAITGYTIYYRKINLMQCVPSSLQTVDERAVSTELGDSYCSLRPVSDRTPRDL-----YQELQSMQRMRQQLATALTEPRLQMDVKANFPLDTSDTEPKGSVTYEGSGLIRDLDPFQCYEVSVKPHSTDSLFGKTEGRESVTHTAMTFESFPSLPPERVVAKWTGIHD-LTLSWSQPPVSHWNGLLRGYTIYLYDELARDHQ-TFNVSASEKTTVIKGLTGSNAYLIQLAACTCKGVGLRSK----PLRLDP 1022          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. TrEMBL
Match: A0A504YZE7 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_01703 PE=4 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 1.107e-96
Identity = 292/1023 (28.54%), Postives = 453/1023 (44.28%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGI---GINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVS-PPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASN--SRYLIT----NQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLN-IETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPED-----TSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKREL-----------------------------EYY---PVISLPPQNQTLIEGSTATFRCEV------VSHM----------------DVTITWYR-----GPHNEPLQAG-----GRIKIPTKGALQILKIDPNLDSNIYTCEASL-----------KSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPP-----TEKTADSVTLTW----------------------SSTGQVTYWIEYVRFG-SREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKG-LSRASVPTEYVKTLSRE-----NSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGII--IEGFKIRYTMVPLSRCLDDGNQGHMKRK-------RYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGV------VDFKFRLPEDATIVK----------SIVTGLNPFSCYEFTVEAYYENP---SVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRSQRIYVPARTEP 2768
            PVI E+P   F   G LE +C+ADG P P I+W+D  + QK+++ +   G    + + +     RL+++ P     Y  YCNASNS G+ VS PP   GLAYL   F+ NP ++K  + G+ V L C PP G P P V WF +G  I + S    R  +T    +   L     L+I   +  D+G+Y C A N  +  +S  + L +   +++ +   +++     +A+ +C +     V WSR  G   I+ +R      YL   N+Q SD+G YVC  T+     ++A+  L V+ P +F +TPDD TV+      F C+ +GFP P +YWELP  + +FP +     +++SRF + KDG+L I N Q SDAGKY C  HSS+D  HSSA L V  + +                             EYY   P+I LPP NQT + G      CE+      VS +                D T+TW R     G   E L         R  +   G+LQI       D+  YTC A              + L+++ WTA L V      + V +P+N +     P  L PP     T  T  ++TL W                      +  G +TYW+EY R   + EGW   +K+WP   + +  L PN+ Y FL+R R   G +   SVP   V T S +     NS+    SD   +E+      ++I+   L PI   ++++ W +     +  +I  I G+ I Y  + L +C+    Q   +R         YCS +  S    R+      +  +     ++   T+ +      +D K   P D +  +           ++  L+PF CYE +V+ +  +        R+S +   + FE  PS PP+ +   W+   + L + +  PP   WNG L G  ++++   +R    +   + + K   I  L    +Y + L+   C+G G+RS+    P R +P
Sbjct:   33 PVIYEIPVDTFSADGVLEFTCQADGFPKPTITWFDAFTGQKVIDHVPSSGSTTGIHVNQH--YGRLMVSNPMRNKIYSFYCNASNSAGWTVSQPPVKGGLAYLETTFRQNP-MDKTVHQGDRVLLECIPPVGLPEPKVAWFHSGSLIAAQSGFPQRSNLTVDSASHTQLTDPGHLQISAASLADAGEYVCVAANNAAEQQSFPARLSVKPRARFIETPTDIRVAKGENAKFRCRVEGNQMVKWSRGSGEGLIDPTRIELADGYLLLKNVQPSDAGVYVC--TALGSIAADAM--LTVETPPTFSRTPDDLTVMVSQTARFFCVTTGFPQPSIYWELPDKTPVFPSEEVANPSTHSRFYLHKDGTLEIRNVQVSDAGKYQCTAHSSIDRVHSSATLRVIPKSMHTHEDSEDSALLSRTPNTDSLNRNPHSYYEYYPLAPIIGLPPVNQTRVVGDLVILDCELGATRQPVSMVNELPIGNGNIPQNQASDWTVTWQRATLATGEIGEKLDLSRLVHEQRYSLLPGGSLQIFNAQLT-DTGSYTCSAQTWVQPDRISKKQSAILLQSNWTAHLNV------VPVGSPINADQGHENP--LSPPRDLRVTNVTESTITLAWEDSNWLRPISNSIDQVNEITHNTGNGLITYWVEYYRPDRATEGWRTVEKNWPANTVQIGGLQPNTAYYFLIRPRWSFGRVGWVSVPLGPVFTKSTQHVQVGNSQTNFISD---KELLQGMRNVEISRVHLHPISSKRMRVSWTV---HERPHVIQAITGYTIYYRKINLMQCVPTSLQKVDERAVSTELGDSYCSLRPASDRTPRDL-----YQELQSMQKMRQQSTTALTEPRLQMDVKANFPLDTSDTEPKGSVTYEGSGLIRDLDPFQCYEVSVKPHSTDSLFGKTEGRESVTHTAMTFESFPSLPPERVVAKWTGIHD-LTLSWSQPPVSHWNGLLRGYTIYLYDELARDHQ-TFNVSASEKTTVIKGLTGSNAYLIQLAAGTCKGVGLRSK----PLRLDP 1022          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. TrEMBL
Match: A0A4S2LAA1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009935 PE=4 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 1.002e-93
Identity = 288/1010 (28.51%), Postives = 440/1010 (43.56%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGI---GINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVS-PPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGR------------QITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRL--GGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPED-----TSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFV----------KKRE--------------LEYYPVISLPPQNQTLIEGSTATFRCEV-------------------VSHMDVTITWYR-----GPHNEPLQAGG-----RIKIPTKGALQILKIDPNLDSNIYTCEASLKSNL----------MKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTG--------------------QVTYWIEYVRFGS-REGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKG-LSRASVPTEYVKTLSR-------ENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGI--IIEGFKIRYTMVPLSRC-------LDDGNQGHMKRKR--YCSFQGRSLDDIRNWILQ-SDFWNI-----SPASNVQSNLTSGVVDFKFR---LPEDATIVK---------SIVTGLNPFSCYEFTVEAYYEN---PSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFK---KIEIPNLDDRKSYSLHLSVFNCRGEGVRSQ 2738
            PVI + P   +   G LE  C+ADG P P I WYD  + Q +++ +   G  + + + +     RL+I+ P     Y  YCNASNS G+ VS PP   GLAYL+  F+  P ++K  + G+ V L C PP+G P P V W ++G+             IT  S +   +T Q +L Q+  +++      DSG Y C A N     +S  + L I    ++ +  K+++ R     + +C       V W +   GG  I+ +R      YL   N+Q SD+G YVC  T+  G  ++A   L V+ P +F +TPDD TV EGD   F CI +G+P P +YWELP  + +FP D      + +RF +  DG L I+  + SDAGKY C  HSS+D  HSSA L V          K+ E                + P+I LPP NQT   G   T  CE+                   +   D T++WYR     G   E L   G     R  +   G+LQI+ + PN D+  YTC A     L          +++ WTA L ++    G  +      E  LS PP     T  T  +VTL W +                       +TYW+E+ R     EGW   +++W    + +  L  N+ Y FL+R R   G +   S P   V TLS        + +   L   + N+++ SI  +++I    L  +    +++ W +   +   GI  +I GF I Y    + RC       L+      +      YCS Q +  D      L+  DF  +      P  +  +  TS  +  + +   +P +  + +          ++  L PF CYE +V+++  N     +  R+S +   L FE  PS PP  I   W  +   + + +  PP   WNG LSG   +++   + +      FN T     +I I  L    +Y + ++   C+G G+RS+
Sbjct:   35 PVIRQPPTDTYSADGVLEFVCQADGVPKPIIHWYDASTGQTVIDRVPTSGSTSGIHVNQH--YGRLMISNPTRDKVYTFYCNASNSAGWTVSHPPVRGGLAYLDSVFRQLP-LDKTVHEGDRVLLECVPPKGVPKPYVLWLRDGKPFAMKGHLPQPVNITLPSLTSVQVTEQGEL-QFDSVRL-----ADSGSYVCVAGNIIGKTQSPAAKLTIQPRVRFIETPKDIRARQGMDVKFRCRTEGNHLVQWGKGQDGGGIIDHTRTELAEGYLLLKNVQPSDAGVYVC--TAPGGMAADA--QLTVETPPTFSRTPDDLTVHEGDVAVFHCITNGYPKPSIYWELPDKTPIFPSDHLTAANNKNRFYLHSDGRLEINGVKLSDAGKYQCTAHSSIDRIHSSAILQVIPDPHATAEGKRSERPHKNLENSNAQAHFPFAPIIGLPPANQTRTVGDLVTLDCELSISRASVQAGVHVHKQPMGIQSSDWTVSWYRNTASTGHKTELLDFSGFADAQRYSLLPGGSLQIVDVQPN-DAGSYTCSAHTLLRLYSSKYDAPLMLQSNWTAYLNIV--PLGTLIPPEYGQENPLS-PPRNVHVTNHTDTTVTLAWDAANWIDPGVGSRDSGDRFDGHHIPITYWVEFYRADRPLEGWKTVEQNWQANTVKIGGLETNTVYYFLIRPRWSDGRVGWVSPPIGPVLTLSSAFVGKSGDQTTSQLHKGLTNKDLVSIMERVEIHSLKLYALTPRHLRVSWTV---EEPPGILQLINGFTIYYREANILRCIAANLNLLNTAETADVAENESAYCSLQLKEGDSKSQLYLRLQDFQRLRTIAHQPPDSQYTPKTSSTMSLEVKADFVPNEKQLEQMHPVMLEGSGLLRDLEPFRCYEVSVKSHLTNGLLGKIEGRESVAHTVLTFESFPSLPPDRIAALWV-SATEVELTWTAPPVSAWNGLLSGYTSYVYDEFAHNY---QTFNTTINSEMRIRIRGLTSPSAYFIQMAAVTCKGVGLRSK 1020          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. TrEMBL
Match: A0A3R7GRP4 (Roundabout-like protein 1 OS=Clonorchis sinensis OX=79923 GN=Robo1 PE=4 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 1.139e-93
Identity = 298/1064 (28.01%), Postives = 450/1064 (42.29%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGI---GINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVS-PPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGR------------QITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRL--GGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPED-----TSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFV------------------------KKRELEYYPVISLPPQNQTLIEGSTATFRCEV-------------------VSHMDVTITWYR-----GPHNEPLQAGG-----RIKIPTKGALQILKIDPNLDSNIYTCEASLKSNL----------MKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPP-----TEKTADSVTLTWSSTG--------------------QVTYWIEYVRFGS-REGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKG-LSRASVPTEYVKTLSR-------ENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGII--IEGFKIRYTMVPLSRC-------LDDGNQGHMKRKR--YCSFQGRSLDDIRNWILQ-SDFWNI------SPASNVQSNLTSGVVDFKFR---LPEDATIVK---------SIVTGLNPFSCYEFTVEAYYENP---SVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFK---KIEIPNLDDRKSYSLHLSVFNCRGEGVRS---------------------QRIYVPARTEP--------PPYEQQAWF 2795
            PVI + P   +   G LE  C+ADG P P I WYD  + Q +++ +   G  + + + +     RL+I+ P     Y  YCNASNS G+ VS PP   GLAYL+  F+  P ++K  + G+ V L C PP+G P P V W ++G+             IT  S +   +T Q +L   S+         DSG Y C A N     +S  + L I    ++ +  K+++ R     + +C       V W +   GG  I+ +R      YL   N+Q SD+G YVC  T+  G  ++A   L V+ P +F +TPDD TV EGD   F CI +G+P P +YWELP  + +FP D      + +RF +  DG L I+  + SDAGKY C  HSS+D  HSSA L V                         +    + P+I LPP NQT   G   T  CE+                   +   D T++WYR     G   E L   G     R  +   G+LQI+ + PN D+  YTC A     L          +++ WTA L ++       + TP+  E     P  L PP     T  T  +VTL W +                       +TYW+E+ R     EGW   +++W    + +  L  N+ Y FL+R R   G +   S P   V TLS        + +   L   + N+++ SI  +++I    L  +    +++ W +   +   GI+  I GF I Y    + RC       L+      +      YCS Q +  D      L+  DF  +      SP S      TS  +  + +   +P +  + +          ++  L PF CYE +V+++  N     +  R+S +   L FE  PS PP  I   W  +   + + +  PP   WNG LSG   +++   + +      FN T     +I I  L    +Y + ++   C+G G+RS                     +R  +PA+T+          P+ QQ WF
Sbjct:   35 PVIRQPPTETYSADGVLEFVCQADGVPKPVIHWYDASTGQTVIDRVPTSGSTSGIHVNQH--YGRLMISNPTRDKVYTFYCNASNSAGWTVSHPPVKGGLAYLDSVFRQLP-LDKTVHEGDRVLLECVPPKGVPKPYVLWLRDGKPFAMKGHLPQSVNITLPSLTSVQVTEQGELQLDSV------RLTDSGSYVCVAGNIIGKTQSPAAKLTIQPRVRFIETPKDIRARQGMDVKFRCRTEGNHLVQWGKGQDGGGIIDHTRTELAEGYLLLKNVQPSDAGVYVC--TAPGGIAADA--QLTVETPPTFSRTPDDLTVHEGDVAVFHCITNGYPKPSIYWELPDKTPIFPSDHLTATNNNNRFYLHNDGRLEINRVKLSDAGKYQCTAHSSIDRIHSSAILQVIPDPHANAESHRSERPHKNLENSNAQAHFPFAPIIGLPPANQTRTVGDVVTLDCELSISRASVQTGLHVHKQPMGIQSSDWTVSWYRNTASTGHETELLDFSGFADAQRYSLLPGGSLQIVDVQPN-DAGSYTCSAHTLVRLYSSKYDAPLMLQSNWTAYLNIV------PLGTPIPPEYGQENP--LSPPRNVHVTNHTDTTVTLAWDAANWIDPGVGSRDSGDRFDGHHIPITYWVEFYRADRPLEGWKTVEQNWQANTVKIGGLETNTLYYFLIRPRWSDGRVGWVSPPIGPVLTLSSAFAGKSGDQTTGQLHKGLTNKDLVSIMERVEIHSLKLYALTPRHLRVSWTV---EEPPGILQLINGFTIYYREANILRCIAANLNLLNSAETADVAENESAYCSLQLKEGDSKSQLYLRLQDFQRLRTIAHQSPDSKYTPK-TSSTMSLEVKADFVPNEKQLEQMHPVMLEGSGLLRDLEPFRCYEVSVKSHLTNGLLGKIEGRESVAHTVLTFESFPSLPPDRIAALWV-SATEVELTWTAPPVSAWNGLLSGYASYVYDEFAHNY---QTFNTTINSEMRIRIRGLTSPSAYFIQMAAVTCKGVGLRSKPLKLNPDLRQPGLGVGWGYDERTGLPAKTQSTKNQPANVKPFIQQPWF 1068          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Cavefish
Match: ENSAMXT00000001796.2 (pep primary_assembly:Astyanax_mexicanus-2.0:20:23710211:23902940:-1 gene:ENSAMXG00000001638.2 transcript:ENSAMXT00000001796.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 201.83 bits (512), Expect = 7.164e-52
Identity = 219/878 (24.94%), Postives = 349/878 (39.75%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPV---QIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALF----PEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYR-----GPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQ----VTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLP-EDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSK-NRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRG 2720
            P I E P       G    L+C+A+G P+P + WY    + +       +NP     ++ +G L   R++        +    C A N LG AVS  AS  +A L  +F+ NPA +     G    L C PP G P PT+ W K+G  I    + R  I       +   L I N  K D+GKY C   N      S  + L +     + +    +      S E +C    +   T+ W +  G   +      E + L    +  +D G Y C   +  G+ +EA   L V  P +F   P ++ V  G  V+F C  +G P P ++W+  G   L     P   S SRF VS+ G L I++ Q SD G Y+C   +   +  + A L V     +  P VI   P+NQT+    T    C        T+ W +       H+       RI     GALQI +    +D+ +YTC A+  S   +  W A L V      +Q   P  D   +   P     T+ T  SVTL+W ++       +Y IE     S   WV            ++ L P++ Y FLVR+ N  GLS  S  T+ ++T   +++ PT++  + + ++Q     + + + +   +    V+++W +     +    I+G+K+ Y      R   D  +   +                        W +                F+ R P ED  +V  +  G+     YEF V  +++       DS+ +     EE PS  P+ +    S  N   +++ +  PP    NG +    +    N++R  +       TF  I IP+L     YS+ ++  N  G
Sbjct:   29 PRIVEHPSDLIVSKGEPATLNCKAEGRPSPTVEWYKDGERVETDR----DNPRSHRMLLPSGSLFFLRIVHGRRSKPDDGSYVCVARNYLGEAVSHNASLEVAILRDDFRQNPA-DVMVAEGEPAVLECQPPRGHPEPTISWRKDGTNIND-RDERITI-------RSGKLMITNARKSDAGKYVCVGTNMVGERESEIAELTVLERPSFTRRPSSVVVLADESVEFRCEARGDPFPTIRWRKEDGELPKGRYEILEDHTLSLQRVTPADVGSYSCLAENMVGK-AEASATLTVHVPPAFAVRPRNQVVGVGRTVTFQCEATGNPQPAIFWQREGSQNLLFSYQPPQPS-SRFSVSQTGDLTITDVQRSDGGLYSCQALNIAGSVITKALLEVTDVVSDRPPPVIRQGPENQTVAVDGTVLLNCVATGTPTPTLLWRKDGMLVSTHDS------RITQLDSGALQI-RYAKLVDTGVYTCVATSPSG--EASWKAYLAVEEFGVAVQPGRP-TDPNLIPSAPSKPEVTDVTRTSVTLSWKASPNGATPTSYVIEAFSHASGSSWVTLADHVKTESFILKGLKPSAVYLFLVRAANAYGLSDPSPITDAIRT---QDTPPTIQG-VDHRQIQKELGDVVVHLHNPTILSSSSVRVQWTV----EQQSQYIQGYKVMY------RPSSDSGEPRGQ------------------------WGV----------------FEVRTPGEDGAVVPQLKKGVT----YEFKVRPFFDE--FQGVDSEVKVARTLEEAPSGAPRGVTVTKSDTNGTAIVVAWQPPPVEEQNGAVQEYKIWCLGNETRYHINRTVDGSTF-SIVIPSLSPGIRYSVAVAASNGAG 820          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Cavefish
Match: robo1 (roundabout, axon guidance receptor, homolog 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-000209-3])

HSP 1 Score: 201.06 bits (510), Expect = 1.286e-51
Identity = 225/903 (24.92%), Postives = 353/903 (39.09%), Query Frame = 3
Query:  114 VIFLNYITDT---LTINAPVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALF----PEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYY--------PVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYR-----GPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFW-SKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRG 2720
            ++FL+  T T   L    P I E P       G    L+C+A+G P P + WY    + +       ++ + ++ +G L   R++        E    C A N LG AVS  AS  +A L   F+ NP+ +    +G    + C PP G P PT+ W K+G  +    + R  I           L I N  K D+GKY C   N      S  + L +     + +        +  S E +C    + V TV W +  G   E  +  FE    + L+   L  +D+G Y C   +  G+ +EA   L V  P  F   P ++ V  G  V+F C  +G P P ++W+  G   L     P   S SRF VS+ G L I+  +  DAG Y+C          + A   + K  LE          PV+   P NQT+    T    C+       TI W +       H+       R+K+   GALQI +     D+ +YTC AS  S   +  W A L V      +Q   P  D   +   P     T+ T  +V+LTW     S     +Y IE     S   W    +        ++ L P++ Y FLVRS N  GLS  S  ++ VK        P     +++ ++Q     + I + +   +    ++++W +     +    I+G+K+ Y                    R  S  G++ +D          W +                F+ R P + T   +++T L   + Y+F V  ++     T  D +   TL  EE PS  P+ ++      N  T+++ +  PP    NG +    +    N+SR  +       TF  + I  L     YS+ ++     G
Sbjct:    9 LLFLHICTGTRLRLEDYPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTVEWYKDGERVETDRDNSRSHRM-LLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSHNASLEVAILRDEFRQNPS-DVMVAAGEPAVMECQPPRGHPEPTISWKKDGVNVDD-RDERITIRG-------GKLMITNTRKSDAGKYVCVGTNMMGERESEIAELTVLERPSFLRRPSSQSVLVDQSVEFRCEAQGDPVPTVRWRKEDG---ELPKGRFEIRDDHTLKLKRLSSADAGSYTCLAENMMGK-TEATATLTVHVPPVFAVRPRNQVVGVGRTVTFQCEATGSPQPAIFWQREGSQNLLFSSQPPQPS-SRFSVSQTGDLTITGIERGDAGYYSCQA-------LNIAGSVITKALLEVTDIISDRPPPVVRQGPTNQTVAVDGTVVLGCQATGTPTPTILWRKDGVLVSTHDS------RLKLLDTGALQI-RYAKLGDTGMYTCIASTPSG--EASWKAYLEVQEFGVAVQPGRP-TDPNLIPSAPSKPEVTDVTRSTVSLTWKPDLNSGATPTSYIIEAFSHASGSSWQTLAEHVRTESYVLKGLKPSAVYLFLVRSANAYGLSDPSPISDAVKI----QDVPPTSQGVEHGQIQRELGDVVIHLHNPTILSSSSIRVQWTV----EQQSQYIQGYKVMY--------------------RVSSETGQTRND----------WAV----------------FEVRTPGEYT---ALITQLRKGTTYDFKVRPFFNEFQGTDSDIKVGKTL--EEAPSAAPKEVKVTENGDNGTTILLSWQPPPEDEQNGVVQEYRIWCLGNESRYHINRTVDGSTFSVV-ISGLVPGVRYSVEVAASTGAG 819          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Cavefish
Match: robo1 (roundabout, axon guidance receptor, homolog 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-000209-3])

HSP 1 Score: 201.06 bits (510), Expect = 1.464e-51
Identity = 225/903 (24.92%), Postives = 353/903 (39.09%), Query Frame = 3
Query:  114 VIFLNYITDT---LTINAPVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALF----PEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYY--------PVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYR-----GPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFW-SKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRG 2720
            ++FL+  T T   L    P I E P       G    L+C+A+G P P + WY    + +       ++ + ++ +G L   R++        E    C A N LG AVS  AS  +A L   F+ NP+ +    +G    + C PP G P PT+ W K+G  +    + R  I           L I N  K D+GKY C   N      S  + L +     + +        +  S E +C    + V TV W +  G   E  +  FE    + L+   L  +D+G Y C   +  G+ +EA   L V  P  F   P ++ V  G  V+F C  +G P P ++W+  G   L     P   S SRF VS+ G L I+  +  DAG Y+C          + A   + K  LE          PV+   P NQT+    T    C+       TI W +       H+       R+K+   GALQI +     D+ +YTC AS  S   +  W A L V      +Q   P  D   +   P     T+ T  +V+LTW     S     +Y IE     S   W    +        ++ L P++ Y FLVRS N  GLS  S  ++ VK        P     +++ ++Q     + I + +   +    ++++W +     +    I+G+K+ Y                    R  S  G++ +D          W +                F+ R P + T   +++T L   + Y+F V  ++     T  D +   TL  EE PS  P+ ++      N  T+++ +  PP    NG +    +    N+SR  +       TF  + I  L     YS+ ++     G
Sbjct:    9 LLFLHICTGTRLRLEDYPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTVEWYKDGERVETDRDNSRSHRM-LLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSHNASLEVAILRDEFRQNPS-DVMVAAGEPAVMECQPPRGHPEPTISWKKDGVNVDD-RDERITIRG-------GKLMITNTRKSDAGKYVCVGTNMMGERESEIAELTVLERPSFLRRPSSQSVLVDQSVEFRCEAQGDPVPTVRWRKEDG---ELPKGRFEIRDDHTLKLKRLSSADAGSYTCLAENMMGK-TEATATLTVHVPPVFAVRPRNQVVGVGRTVTFQCEATGSPQPAIFWQREGSQNLLFSSQPPQPS-SRFSVSQTGDLTITGIERGDAGYYSCQA-------LNIAGSVITKALLEVTDIISDRPPPVVRQGPTNQTVAVDGTVVLGCQATGTPTPTILWRKDGVLVSTHDS------RLKLLDTGALQI-RYAKLGDTGMYTCIASTPSG--EASWKAYLEVQEFGVAVQPGRP-TDPNLIPSAPSKPEVTDVTRSTVSLTWKPDLNSGATPTSYIIEAFSHASGSSWQTLAEHVRTESYVLKGLKPSAVYLFLVRSANAYGLSDPSPISDAVKI----QDVPPTSQGVEHGQIQRELGDVVIHLHNPTILSSSSIRVQWTV----EQQSQYIQGYKVMY--------------------RVSSETGQTRND----------WAV----------------FEVRTPGEYT---ALITQLRKGTTYDFKVRPFFNEFQGTDSDIKVGKTL--EEAPSAAPKEVKVTENGDNGTTILLSWQPPPEDEQNGVVQEYRIWCLGNESRYHINRTVDGSTFSVV-ISGLVPGVRYSVEVAASTGAG 819          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Cavefish
Match: robo1 (roundabout, axon guidance receptor, homolog 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-000209-3])

HSP 1 Score: 200.675 bits (509), Expect = 1.843e-51
Identity = 219/878 (24.94%), Postives = 347/878 (39.52%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALF----PEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEY-YPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYR-----GPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWS-KNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRG 2720
            P I E P       G    L+C+A+G P P + WY    + +       ++ + ++ +G L   R++        E    C A N LG AVS  AS  +A L   F+ NP+ +    +G    + C PP G P PT+ W K+G  +    + R  I           L I N  K D+GKY C   N      S  + L +     + +        +  S E +C    + V TV W +  G   E  +  FE    + L+   L  +D+G Y C   +  G+ +EA   L V  P  F   P ++ V  G  V+F C  +G P P ++W+  G   L     P   S SRF VS+ G L I+  +  DAG Y+C   +   +  + A L V     +   PV+   P NQT+    T    C+       TI W +       H+       R+K+   GALQI +     D+ +YTC AS  S   +  W A L V      +Q   P  D   +   P     T+ T  +V+LTW     S     +Y IE     S   W    +        ++ L P++ Y FLVRS N  GLS  S  ++ VK        P     +++ ++Q     + I + +   +    ++++W +     +    I+G+K+ Y                    R  S  G++ +D          W +                F+ R P + T   +++T L   + Y+F V  ++     T  D +   TL  EE PS  P+ ++   +  N  T+++ +  PP    NG +    +    N+SR  +       TF  + I  L     YS+ ++     G
Sbjct:   31 PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTVEWYKDGERVETDRDNSRSHRM-LLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSHNASLEVAILRDEFRQNPS-DVMVAAGEPAVMECQPPRGHPEPTISWKKDGVNVDD-RDERITIRG-------GKLMITNTRKSDAGKYVCVGTNMMGERESEIAELTVLERPSFLRRPSSQSVLVDQSVEFRCEAQGDPVPTVRWRKEDG---ELPKGRFEIRDDHTLKLKRLSSADAGSYTCLAENMMGK-TEATATLTVHVPPVFAVRPRNQVVGVGRTVTFQCEATGSPQPAIFWQREGSQNLLFSSQPPQPS-SRFSVSQTGDLTITGIERGDAGYYSCQALNIAGSVITKALLEVTDIISDRPPPVVRQGPTNQTVAVDGTVVLGCQATGTPTPTILWRKDGVLVSTHDS------RLKLLDTGALQI-RYAKLGDTGMYTCIASTPSG--EASWKAYLEVQEFGVAVQPGRP-TDPNLIPSAPSKPEVTDVTRSTVSLTWKPDLNSGATPTSYIIEAFSHASGSSWQTLAEHVRTESYVLKGLKPSAVYLFLVRSANAYGLSDPSPISDAVKI----QDVPPTSQGVEHGQIQRELGDVVIHLHNPTILSSSSIRVQWTV----EQQSQYIQGYKVMY--------------------RVSSETGQTRND----------WAV----------------FEVRTPGEYT---ALITQLRKGTTYDFKVRPFFNEFQGTDSDIKVGKTL--EEAPSAAPKEVKVTENGDNGTTILLSWQPPPEDEQNGVVQEYRIWCLGNESRYHINRTVDGSTFSVV-ISGLVPGVRYSVEVAASTGAG 823          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Cavefish
Match: robo2 (roundabout, axon guidance receptor, homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-001019-1])

HSP 1 Score: 200.29 bits (508), Expect = 2.449e-51
Identity = 215/832 (25.84%), Postives = 337/832 (40.50%), Query Frame = 3
Query:   99 YLIQIVIFLNYITDTLTI----NAPVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE------GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGI-SALFPEDTSY--SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKN-EEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNT 2519
            + I I   +++  D   +    + P I E P       G    L+C+A+G P P + WY    + +       ++ + ++ +G L   R++        E    C A N LG AVS  AS  +A L  +F+ NP  +    +G    L C PP G P PT+ W K+  +I    +   +   +        L I N  K D+G Y C   N      S T+ + +F    + +           + E +C +  +   +V W +    +++ +R  ++       Y LR       D G + C   ++ G+  EA   L V+AP  F+  P D+ V +G   +F C   G P P V+W+  G  + LFP       SRF VS  G L I+  Q +DAG Y C   +   +  + A L V     +  P +I   P NQTL     A  +C+       TI+W R      L    R+ +   G+LQI  I  + DS IYTC A+  S   +T W+A L V   +S   V     DE++L  PP     T+ T +SV+L+W      ++   +Y IE         W         T+ T+++L PN+ Y F+VR+ N +GLS  S  +E V+T  ++ S P    D ++ ++              L+P     +++ W + R        I+G+++ Y                         Q   L     W  Q D    S  + V S+L  G+V                         YEF V  Y+        DS+S+     EE PS PPQ +      N+N+
Sbjct:    7 FFIFICGLIHFQADGSRLRQEDSPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTVEWYKDGERVETDKDDSRSHRM-LLPSGSLFFLRIVHGRRSKPDEGAYVCVARNYLGEAVSRNASLEVALLRDDFRQNPT-DVVVAAGEPAILECVPPRGHPEPTIFWKKDKVRIDEKEDRIKIRGGK--------LMISNTRKSDAGMYVCVGTNMVGERDSETAQVTVFERPTFLRRPINQVVLEDEAVEFRCQVQGDPQPSVRWRKD---DVDVARGRYDIRYDKDDYVLRIKKASAGDEGTFTCVAENRVGK-LEASATLTVRAPPQFVIRPRDQIVAQGRTATFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRFSVSPSGDLTITGVQRADAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIIRQGPANQTLGVDGVALLKCQASGEPVPTISW-RKDGVSLLGKDPRMSLLDLGSLQIKNIRLS-DSGIYTCVAASSSG--ETSWSAFLEV--KESAGVVTIKNRDESELPGPPSKPQVTDVTKNSVSLSWQPGLTGASVTTSYVIEAFSQSVSNSWQTVADHVKTTQYTIKSLRPNTIYLFMVRAVNAQGLSDPSPMSEPVRT--QDISPPAQGVDHRHVQKELGEVIVRLHNPVVLSPT---TIQVTWTVDRQSQ----FIQGYRVVYR------------------------QTSGLSSPGPWQSQ-DVKVPSERTVVLSSLKKGIV-------------------------YEFKVRPYFNE--FQGMDSESRTARTTEEPPSAPPQQVTVLTVGNQNS 757          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010567.1 (pep scaffold:Pmarinus_7.0:GL479154:561817:685780:1 gene:ENSPMAG00000009565.1 transcript:ENSPMAT00000010567.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 213.386 bits (542), Expect = 2.364e-56
Identity = 181/610 (29.67%), Postives = 274/610 (44.92%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPV---QIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFEG-YYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGI-SALFPEDTSY--SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEY-YPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW-----SSTGQVTYWIEYVRFGSRE---GWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G PAP + WY    + +       ++P     ++  G L   R++        E    C A N LG AVS  AS  +A + RN++S+P+  K A     V + C PP G P PTV W +NG  +T   + R  I       +   L I N  K D+G Y C   N      S  + L +F    + +    L     + AE +C +  +   TV W +  G   + SR   +  Y LR   +  +D G Y C   ++ G+ +EA  +LVV AP  F+  P D+ V +G   +F C  +G P P V+W+  G  + LFP   S   SRF VS+ G L I++ Q SD+G YTC   S   +  + A L V     +   P+I   P NQTL  GS A   C+ +     ++ W +      L    R+ + + G L I  +   +D+ +YTC A   S   +T W+A + V   ++G+       + + L+ PP     T+ T ++VTL+W     S    + Y+I      S+     W            T+  L PN+ Y F+VR+ N  GLS  S  ++ V+T
Sbjct:   30 PRIAEHPSDLIVSRGEPATLNCKAEGRPAPTVEWYKDGERVETDR----DDPRSHRMLLPTGSLFFLRIVHGRRTKTDEGSYVCVARNYLGEAVSRNASLEVANIRRNYRSSPSAVKVAAREPAV-MECRPPRGHPEPTVSWKRNGVALTD-KDERVTI-------RGGKLMISNTQKADAGMYVCVGTNMVGERDSEPAELAVFERPTFARKPMNLVMLADSDAEFRCEVHGDPPPTVRWRKEDGDLPKGSRFEIQDDYTLRVERVGGTDEGTYTCVGENRVGK-AEASASLVVHAPPQFVVRPRDQIVAQGQSATFLCETTGNPPPAVFWQREGSQNLLFPNQPSQPSSRFSVSQTGHLTITDVQRSDSGYYTCQALSVAGSILAKALLEVGDALADSPPPIIRQGPANQTLAVGSVALLACQAMGMPTPSVHWLKDGSKLSL-GSARLGLQSGGTLSIKDVQ-LMDAGLYTCVAVSPSG--ETTWSAFMDV--QENGVPSQPQPPEPSSLAAPPSKPRVTDVTKNTVTLSWQLPEPSGPSPILYYIIEAFRDSQSVSTSWQTVATHVTRDAFTLRGLRPNTIYLFIVRAANAHGLSDPSPVSDPVRT 619          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Sea Lamprey
Match: neo1b (neogenin 1b [Source:ZFIN;Acc:ZDB-GENE-131121-320])

HSP 1 Score: 107.842 bits (268), Expect = 5.374e-24
Identity = 75/275 (27.27%), Postives = 126/275 (45.82%), Query Frame = 3
Query:  504 GNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKY------RISNSAEIQCPLNE--VGTVHWSRLGGLNIETSRASF-EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFV 1301
            G+ V L C       +  V+WFK GR IT   +S+ ++ +  DL       ++N +  D GKY+CQ      T  +  +NL +    +  ++   L++      R+ ++A ++C +      +VHW+R G  ++ + R S   G  +R +N+Q  D+G Y C I +++ +       L V  P   +  P+++     DD+   C   G P P + W   G   + P+D     F    DGSLH+     SD G Y C   S +D   ++A L V
Sbjct:   17 GDSVVLDCGAEVTGLWNEVRWFKEGRSITE--DSQVMVLSSGDL------LLQNASMADGGKYFCQLVFGGRTFTNQGTNLSVLPEMESNRLCVVLRHPVDVSVRLGHTATLECVVAGFPAPSVHWTR-GTESVLSERFSVVAGGIMRIDNVQEDDAGDYTCIIKAQN-ETQRLYAKLTVLEPPRILHGPENRNASVSDDIILECQAEGRPRPVISWFQNG-DLIIPDD-----FIQIVDGSLHVLGVMRSDEGVYQCMAESEVDGMQAAAQLVV 275          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002502.1 (pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-1 gene:ENSPMAG00000002253.1 transcript:ENSPMAT00000002502.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 2.424e-23
Identity = 129/496 (26.01%), Postives = 219/496 (44.15%), Query Frame = 3
Query:  210 ELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVS-PPASTGLAYLNRNFQSNPAIEK-EAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSK-----YYKMQKELKYRISNSAEIQCPLNEVGT----VHWSRLGG--LNIETSRASFEGYYLRFNNLQM--SDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPT---KGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLN 1643
            +L C   G P   ISW  L+  ++I  G   N     +   PL  ++ T+      Y   C A+N  GY  S  P +     +   F  +  +E     +G   EL C      P   V W K+ R+I +A N R +     ++ + +ILK+    K DSG Y C A N    V S  ++ +I    +     + +  K+    + ++A++ C +   GT    V WS+ G   ++ +  R  FE        L++  SD G Y C  T+ +G+ S     L +  P SF+   + + VL G   +F C VSG     V W   G   L  + +    FR S    L +   + + AG+Y+C   +S      SA+LFVK+   +++      P +  +  G +A+F C  V    + + WY+   +  + AG + ++ T   +  L IL  + + DS  YTC+  ++++  +   TALL+V+ P   ++ + P+ 
Sbjct: 6171 DLGCHVTGSPPFKISW--LKDNKEIRPGT--NYKFSFVDNTPLLTILKTDKRDSGVY--VCRAANEAGYDTSCAPVTIKERRVAPTF--DQKLESLNVTTGERAELECHVTGSVPI-KVTWAKDNREIRAAGNYRMIFME--NIARLTILKV---GKLDSGIYTCAASN---DVGSDVTSTEITVKDQAVPPSFVRKLKKTDAILHSTAQMDCRV--AGTVPILVAWSKNGVEIVDGDKYRCLFEENTASLEILKVDKSDDGSYTCTATNVAGRDS-CSTTLSIIEPPSFLMKMEPQEVLSGSRATFQCAVSGTEPLLVKW-YKGNQELRTDISHSISFRDSV-ALLIVEKVKLAFAGEYSCQVSNSAGKTSCSASLFVKE-PAKFFS----KPSDLDVKAGDSASFICSFVGTPKIAVNWYK--EDNQIVAGHKFQVTTVEGQSTLDILATEIS-DSGNYTCK--IQNDSGQDNCTALLKVLDPPYFVKSLEPME 6634          

HSP 2 Score: 95.5153 bits (236), Expect = 7.814e-20
Identity = 95/347 (27.38%), Postives = 154/347 (44.38%), Query Frame = 3
Query:  558 VKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNS-AEIQCPLN--EVGTVHWSRLGGLNIETSRA---SFEG--YYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPED---TSYSRFRVSK---DGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKID--PNLDSNIYTCEA 1550
            V W KNG +I      R L   + +     ILK+   +K D G Y C A N  +   S ++ L I     +  M+ E +  +S S A  QC ++  E   V W + G   + T  +   SF      L    ++++ +G+Y C++++ +G+ S    +L V+ PA F   P D  V  GD  SF C   G P   V W        + ED    +  +F+V+      +L I  T+ SD+G YTC   +  D+   +    +K  +  Y+ V SL P   T   G++  F C+V    ++ +TWY+G       +G + K   +    +L++      D   Y+CEA
Sbjct: 6376 VAWSKNGVEIVDGDKYRCLF--EENTASLEILKV---DKSDDGSYTCTATNV-AGRDSCSTTLSIIEPPSFL-MKMEPQEVLSGSRATFQCAVSGTEPLLVKWYK-GNQELRTDISHSISFRDSVALLIVEKVKLAFAGEYSCQVSNSAGKTS-CSASLFVKEPAKFFSKPSDLDVKAGDSASFICSFVGTPKIAVNW--------YKEDNQIVAGHKFQVTTVEGQSTLDILATEISDSGNYTCKIQN--DSGQDNCTALLKVLDPPYF-VKSLEPMEGTF--GTSVYFECQVAGAPEIRVTWYKGSQK---LSGAKYKTMFQHNTAVLEVKNFEKADVGTYSCEA 6697          

HSP 3 Score: 93.2041 bits (230), Expect = 3.674e-19
Identity = 95/379 (25.07%), Postives = 167/379 (44.06%), Query Frame = 3
Query:  513 VELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGT----VHWSRLGGL--NIETSRASFEG--YYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIP---TKGALQILKIDPNLDSNIYTCEASLK--SNLMKTRWTALLRVIYP 1610
            V L CS  +G P   V WFKN  ++   ++ R  ++    +N  ++L+IR+   EDS  Y C+A+N   TV S T  + +     + K  + ++ R ++   ++  L+  G+    V W +       I+  RA  E     LR  N   +D G+Y C++ +  G+  E+  N+ ++ P  F +   +  V EG   +    + G     + W    +     ED ++S         L I   + S AG+YTC+  +   A+  SA L VK+       V  +   N T+  G  A F C V   + +T+ W +   +E L++  + K+       +L+++  D   D+  Y CE      S++     T L R++ P
Sbjct: 4360 VHLDCSL-KGSPVIKVTWFKNDNEV--KADGRVQLSF---VNNVAVLEIRDSETEDSADYTCEAQNEVGTV-SCTCAVSVKEIPSFKKPLESMEVRGNSDVTLEVELD--GSPPFDVKWVKNARELPKIDKYRAKLENTTATLRIGNFSAADVGQYSCKVKNNVGK-DESHANIKLKEPPKFTKKFINSEVSEGSSATLNATLIGSQPMTIAWSKDKLK--IAEDENHSISYKDNHAILTIVKAEKSHAGEYTCDAKNEAGAQSCSAVLSVKE---PATFVDKMESVNVTV--GEVAFFECRVAGSVPITVRWRK--DHELLKSSKKFKMTFTNNVASLKLMSTD-KFDTGEYYCEVQNDGGSSICNATLTILDRIVPP 4718          

HSP 4 Score: 89.3521 bits (220), Expect = 6.362e-18
Identity = 112/488 (22.95%), Postives = 202/488 (41.39%), Query Frame = 3
Query:  201 GTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWS--RLGGLNIETSRASFEGYY--LRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTK---GALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTP 1637
            G + L C   G P   ++W+      K  N +  +  VQ+     ++ L I + E +      C A N +G  VS   +  +  +  +F+  P    E    +DV L     +G P   VKW KN R++      R  + N       + L+I N +  D G+Y C+ +N      S  +N+K+    K+ K     +    +SA +   L  ++  T+ WS  +L     E    S++  +  L     + S +G+Y C   +++G  S + + L V+ PA+F+   +   V  G+   F C V+G     V W       L      +     +   SL + +T   D G+Y C   +   +   +A L +  R +   P      +N   +  + A   C++     +T++W++G   E +    + KI  +     ++IL     +D   YTC+A   +    + W A ++V+ P S  +V+ P
Sbjct: 4358 GLVHLDCSLKGSPVIKVTWF------KNDNEVKADGRVQLSFVNNVAVLEIRDSETEDSADYTCEAQNEVG-TVSCTCAVSVKEIP-SFK-KPLESMEVRGNSDVTLEVE-LDGSPPFDVKWVKNARELPKIDKYRAKLENTT-----ATLRIGNFSAADVGQYSCKVKNNVGKDESH-ANIKLKEPPKFTKKFINSEVSEGSSATLNATLIGSQPMTIAWSKDKLKIAEDENHSISYKDNHAILTIVKAEKSHAGEYTCDAKNEAGAQSCSAV-LSVKEPATFVDKMESVNVTVGEVAFFECRVAGSVPITVRWRKD--HELLKSSKKFKMTFTNNVASLKLMSTDKFDTGEYYCEVQNDGGSSICNATLTILDRIVP--PTFVRKLKNGDCVLHAKAVLECKLAGSSPLTVSWFKGV--EEISDSDKFKISFEDNTAKVEILNAS-QVDEGTYTCKADNAAG-TDSCW-AKVKVMEPPSFKEVIKP 4819          

HSP 5 Score: 88.9669 bits (219), Expect = 7.785e-18
Identity = 108/387 (27.91%), Postives = 165/387 (42.64%), Query Frame = 3
Query:  513 VELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSK-----YYKMQKELKYRISNSAEIQCPLNEVGT----VHWSRLGGLNI--ETSRASFEG--YYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQA---PASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGR---IKIPTKGALQILKIDPNLDSNIYTCEAS--LKSNLMKTRWTALLRVIYP 1610
            V L C    G P     WFK+   ITS  N + +      LN  +IL++RN    +SG+Y C+AEN    + SATS   +    +     + +  K+++     +A   C     GT    V W + G      E  R SFE    +L   NL  +D  +Y C +++  G+ S A  +L V+    P SF Q     +V  G+     C V+G P  ++ W L     + P  T+Y    V     L I  T   D+G Y C   +      S A + +K+R +   P      ++  +  G  A   C V   + + +TW +   N  ++A G    I +     L ILK+   LDS IYTC AS  + S++  T  T   + + P
Sbjct: 5978 VRLECEVA-GTPVIKTSWFKDDVLITSGLNRKPV----QKLN-LAILELRNVQYSESGEYVCKAEN---DIGSATSVAMLTVTERKNPPVFTRKLKDVQGVEGGAAMFDC--RATGTPPFAVAWFKHGKEITPGEKYRMSFEENVVFLEILNLATNDEEEYSCTVSNDVGKISCAA-SLEVKERKNPPSFDQQLAPASVTAGEPADLGCHVTGSPPFKISW-LKDNKEIRP-GTNYKFSFVDNTPLLTILKTDKRDSGVYVCRAANEAGYDTSCAPVTIKERRV--APTFDQKLESLNVTTGERAELECHVTGSVPIKVTWAK--DNREIRAAGNYRMIFMENIARLTILKVG-KLDSGIYTCAASNDVGSDVTSTEITVKDQAVPP 6345          

HSP 6 Score: 84.7297 bits (208), Expect = 1.691e-16
Identity = 122/511 (23.87%), Postives = 207/511 (40.51%), Query Frame = 3
Query:  213 LSCRADGEPAPDISW---YDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDV-----ELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIF---SNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGG--LNIETSRASFEGY--YLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYW-----ELPGISALFPEDTSYSR----FRVSKDG----SLHISN-----------TQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIP---TKGALQILKIDPNLDSNIYTCEAS--LKSNLMKTRWTALLRVIYPD 1613
              CR  G     + W   ++L    K       NN   +       +L+ T+     EY  YC   N  G ++    +  L  L+R     P   ++  +G+ V      L C      P  TV WFK   +I+ +   ++ I+ + +  +  IL   N ++ D G Y C+A+NA  T  S  + +K+    S  +  K Q+ L   + +   +    + + +V W + G   L    SR SF+     +  + +  + +G+Y C++++  G  +     L V+ PA F        V  GD  SF C  +G P   V W     EL          T+ S       ++ D     S  ISN           +  +DAG+Y C   +       +ANL VK+R++   P      Q   +  G  + F C V   + + ITW +  +N+ +++GG  +I        L ++K D + +  +YTC+A+    S+   T+     R I PD
Sbjct: 4641 FECRVAGSVPITVRWRKDHELLKSSKKFKMTFTNNVASL-------KLMSTDKFDTGEY--YCEVQNDGGSSI---CNATLTILDRIVP--PTFVRKLKNGDCVLHAKAVLECKLAGSSPL-TVSWFKGVEEISDSD--KFKISFEDNTAKVEIL---NASQVDEGTYTCKADNAAGT-DSCWAKVKVMEPPSFKEVIKPQEALPGAVVSFTSVVSGTDPL-SVKWFKDGTELLPSRNSRISFKNLSAVIELDKVDSTAAGEYSCQVSNAVGTET-CSATLFVKEPAKFETKLQSTNVNLGDTASFNCTFTGTPEITVRWFRKDEELQDSDKFKIVTTATSSSLEVLNITSDDVKPYSCRISNEAGEDSCINSLSVQADAGEYVCTAANEAGTSSCNANLIVKERKV--APTFDQKLQPVEVTAGDPSEFECHVTGSLPIKITWSK--NNKEIRSGGNYRITFLDNTPRLIVMKTDRS-EGGVYTCKATNETGSDHCSTQLEVKERTIPPD 5123          

HSP 7 Score: 83.9593 bits (206), Expect = 2.754e-16
Identity = 101/406 (24.88%), Postives = 162/406 (39.90%), Query Frame = 3
Query:  153 NAPVITEMPKSYFPRYGTLE-LSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQ--IMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEK-----EAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAF-STVRSATSNLKIFSNSKYYKMQ-KELKYRISNSAEIQCPLNEVGT----VHWSRLGGLNIETSR----ASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPS-EALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRE 1313
            N P  T   K +    GT     CR  G P     WY         +G+ +++     I     ++ L I   +  H  +  C   N +       AS       ++ +  P+ EK     E  +G   EL C     RP   + W KN R+I S  N +         +  + L +    KEDSG Y C+A N   S   SA   +K  +    +  Q KE    ++    ++C ++  GT    V W +      ++ +     S     L    L ++D G Y C++ + +G+ S  A++ + +  P  F +T + + VL G+ V F  IV+G     V W       L P D     FR ++   L +S   ++ AG++TC   ++      SA LFVK  E
Sbjct: 5592 NPPYFTRKLKDWQAVEGTAATFDCRVTGTPPFSFIWYK--------HGVELSSGEDYVISAEENVATLDIHNVKLTHAGEYTCRVFNDVD-----SASCSAKLEAKDKKVPPSFEKKPDPVEVTAGESFELECLIAGSRPI-RISWLKNNREIRSVGNYKLFF-----YDNAARLTVLKAGKEDSGTYVCKAVNEVGSDTCSAQVTVKDHAVPPTFVRQLKETDGILNAPVSLECKIS--GTMPISVSWYKDQEELFDSQKYKLTTSDHTVNLEILELGIADGGNYTCKVNNVAGKDSCSAILRVTIAEPPGFSKTLEYQEVLLGEYVRFQSIVTGTEPLSVKW-FADSKELKPTDNCSISFRGNR-ALLELSQVDSASAGEFTCQVANAAGIETCSAKLFVKVSE 5974          

HSP 8 Score: 80.8777 bits (198), Expect = 2.557e-15
Identity = 121/504 (24.01%), Postives = 205/504 (40.67%), Query Frame = 3
Query:  210 ELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNF--QSNPAIEK-EAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNS---KYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRL---GGLNIETSRASFEGYYLRF---------NNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSK------DGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPT---KGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTP 1637
            E  C   G     I+W    SK       G N  +  +   P  RLI+ + + + E  VY C A+N  G   S   ST L    R      +  +E  E  +G   +  C      P+  V W K+ R I S  N ++       L+  + L I   +K D G Y C+A NA +   + T++L +        + +  K     +S++A ++C L+  G+V  S +   G   I    A  E Y + F           +  SD+  Y C+ T+ SG  + +  +L V  P SF +T + + V+ G  V F   VSG     V W        F +D      R  K        +L + +   + AG Y+C   ++  +   SANL VK     +   +    ++  +  G TA F        ++ + WY+   N  ++   + ++     +  L++L +D + D  IYTC+  +++   +    A L  + P + I+ + P
Sbjct: 5044 EFECHVTGSLPIKITW----SKNNKEIRSGGNYRITFLDNTP--RLIVMKTD-RSEGGVYTCKATNETG---SDHCSTQLEVKERTIPPDFDEKLESLEVTAGLSADFECHVTGSAPF-RVTWTKDNRDIRSGGNYKFTF-----LDNTAHLTILKADKGDIGTYTCKAANA-AGSAACTADLSVKDRPVAPSFVRKLKTTDAALSSTAHLECKLS--GSVPISVVWFKGSEEI----AQGERYKMTFVENVATLEIQKVVASDAFSYTCKATNVSGSEA-STADLKVIEPPSFTKTVESQHVVPGASVEFKSSVSGTEPLTVKW--------FRDDNELMSGRRCKITFLNGVATLKLDDVDAASAGVYSCQVSNAAASETCSANLTVKAERANFRRRV----KDSQVSNGETAVFSTSFSGTPEIVVFWYK--QNNLIEESDKYRVAISEGESTLEVLNVDKS-DEGIYTCK--IQNEAGEDSCLATLATLEPPNFIKGLEP 5506          

HSP 9 Score: 78.9518 bits (193), Expect = 8.438e-15
Identity = 87/356 (24.44%), Postives = 149/356 (41.85%), Query Frame = 3
Query:  546 PYPTVKWFKNGRQITSASNSRYLITNQPDL-NQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAE----IQCPLNEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINL---VVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELP-GISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVK--------KRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGA---LQILKIDPNLDSNIYTCEAS 1553
            P P++ W+ N R +    NSRY +T +  + +  S L+I    ++DSG Y   A N+  +  S  S L I  + ++  +     Y     AE     Q  + ++  +H   +    +E         + R   L+    G+Y  R++ + G   + ++ +   + +AP   I+  +D   +EGDD  F C+V G P P V W    G S +F         +   D S   + ++ SDAG Y+C   + +      + LFV+         +  E  P    P   + + E  T  F CEVV      + W +      +Q    + +  +G    LQI  + P  D+ +Y CEA+
Sbjct: 2491 PTPSITWYLNNRPLQK--NSRYKVTIKSQMHDNVSSLEIEAVRQQDSGSYKVFAINSEGSAESIAS-LIIAMHDQHNAVPGAEDYTHVTVAEKTKAFQVRMEKILGLHTDEVQIKPLEEKEPMVIHSFERIKTLR----GRY--RLSFQEGTKQKPMVTMFGEMHEAP-QIIKATEDMFCIEGDDAMFECLVFGDPEPSVTWAKEMGRSTMF--------MKAGVDISWLSTLSRASDAGDYSCVAKNVVGEVECCSALFVEMPAESSVDNKVSETPPAFLKPLTGKKVYENGTLIFVCEVVGKPPPEVLWMK--DRRLIQPLSNVVMEQEGCHYILQIKDVKPT-DAGVYVCEAT 2825          

HSP 10 Score: 78.1814 bits (191), Expect = 1.482e-14
Identity = 88/388 (22.68%), Postives = 158/388 (40.72%), Query Frame = 3
Query:  492 EAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRS-ATSNLKIFSNSKYYKMQ-KELKYRISNSAEIQC------PLNEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITS--KSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYW-----ELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGA---LQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRV 1601
            E   G+ V L C    G P   V W+K  +++ S    +    N       + L++R+  K D+G Y C+AEN F +  S A+ ++    N  Y+  + K+ +     +A   C      P + +   H   L         A      L  +N++++ +G+Y CR+ +   S   S  L     + P SF + PD   V  G+     C+++G    ++ W     E+  +        +Y  F       L +      D+G Y C   + + +   SA + VK   +    V  L   +  L   +  +  C++   M ++++WY+    E L    + K+ T      L+IL++    D   YTC+ +  +   K   +A+LRV
Sbjct: 5508 EIVVGSTVHLECQVA-GTPQIRVSWYKGSQKLKSGDKCKMAFKNN-----LATLELRSLTKADTGDYSCKAENDFGSATSLASLSVSERKNPPYFTRKLKDWQAVEGTAATFDCRVTGTPPFSFIWYKHGVELSSGEDYVISAEENVATLDIHNVKLTHAGEYTCRVFNDVDSASCSAKLEAKDKKVPPSFEKKPDPVEVTAGESFELECLIAGSRPIRISWLKNNREIRSVG-------NYKLFFYDNAARLTVLKAGKEDSGTYVCKAVNEVGSDTCSAQVTVKDHAVPPTFVRQLKETDGIL--NAPVSLECKISGTMPISVSWYK--DQEELFDSQKYKLTTSDHTVNLEILELGI-ADGGNYTCKVNNVAG--KDSCSAILRV 5875          

HSP 11 Score: 70.4774 bits (171), Expect = 3.471e-12
Identity = 109/506 (21.54%), Postives = 190/506 (37.55%), Query Frame = 3
Query:  147 TINAPVITEMPKSYFPRYGTLELS--------CRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATS--NLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWS-RLGGLNIETSRA---SFEGYY--LRFNNLQMSDSGKYVCRITSKSGQPS-EALINLVV-QAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWEL--------PGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCN------------CHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEA 1550
            + +A +  + P  +F +   L++         C   G P   ++WY      K  N I   +  Q+      S L I   E        C   N  G       +  L  L+  +        E   G  V   C    G P   V W+K  ++++ A   +Y    Q   +  ++L+++N  K D G Y C+AEN+  + +++ S    +      + +M K ++  I + A+    +      H S  LG   +  S     SFE     L   +L++SD+G+Y C+++++ G  S  A +++   +   +F Q  +    + GD     C ++G    +++W          P     F ++T +          L I     SD+G+YTC             C +++ A    A +F KK      P+  L  +     EG        V     + ITW +   +     G  +      AL  LK     DS +Y C+A
Sbjct: 6520 SCSASLFVKEPAKFFSKPSDLDVKAGDSASFICSFVGTPKIAVNWY------KEDNQIVAGHKFQVTTVEGQSTLDILATEISDSGNYTCKIQNDSG---QDNCTALLKVLDPPYFVKSLEPMEGTFGTSVYFECQVA-GAPEIRVTWYKGSQKLSGA---KYKTMFQ---HNTAVLEVKNFEKADVGTYSCEAENSLGSAKTSASLAGKERKHPPSFSRMLKNMQQVIGDCAKFDARVTGTPPFHVSWFLGDSELSYSDKHVISFEDNVASLSIFSLKVSDAGEYTCKVSNEDGSISCSAKLDVTERKTKPTFDQKLEPVEAVVGDPAELECHLTGSLPIKIFWMKDKKDIRPGPNCKMTFFDNTPH----------LTIYKLDKSDSGEYTCKAVNDIGSDNSCTCETAI-AERKVAPMFTKK------PLEILDEE-----EGKGVKLDSRVSGSQPIAITWTKDDKDLHAHPGRELSFKNNIALMSLKSTKVSDSGLYVCKA 6987          

HSP 12 Score: 69.707 bits (169), Expect = 5.895e-12
Identity = 121/510 (23.73%), Postives = 199/510 (39.02%), Query Frame = 3
Query:  201 GTLELSCRADGEPAPDISWYDLQSKQKILNGIGIN-NPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAI------EKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATS-NLKIFSNSKYYKMQ-KELKYRISNSAEIQCPLNEVGT----VHWSRLG-----GLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSG-QPSEALINLVVQAPA-SFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYW-----ELPGIS---ALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKI---PTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTP 1637
            G++ L C   G P    SW+    K  +L   G+N  PVQ +    L    +   E+  EY   C A N +G A      T +A L    + NP +      + +   G      C    G P   V WFK+G++IT     +Y ++ + ++     L+I N    D  +Y C   N    +  A S  +K   N   +  Q           A++ C +   G+    + W +       G N + S        L        DSG YVCR  +++G   S A + +  +  A +F Q  +   V  G+     C V+G    +V W     E+        +F E+   +R  + K G L        D+G YTC   + + +  +S  + VK + +    V  L   +  L   STA   C V   + + + W +  +   +  G + +        +L+ILK+D + D   YTC A+  +   +   +  L +I P S +  M P
Sbjct: 5976 GSVRLECEVAGTPVIKTSWF----KDDVLITSGLNRKPVQKLNLAILELRNVQYSES-GEY--VCKAENDIGSA------TSVAMLTVTERKNPPVFTRKLKDVQGVEGGAAMFDCRAT-GTPPFAVAWFKHGKEITPG--EKYRMSFEENV---VFLEILNLATNDEEEYSCTVSNDVGKISCAASLEVKERKNPPSFDQQLAPASVTAGEPADLGCHVT--GSPPFKISWLKDNKEIRPGTNYKFSFVD-NTPLLTILKTDKRDSGVYVCRAANEAGYDTSCAPVTIKERRVAPTFDQKLESLNVTTGERAELECHVTGSVPIKVTWAKDNREIRAAGNYRMIFMEN--IARLTILKVGKL--------DSGIYTCAASNDVGSDVTSTEITVKDQAVPPSFVRKLKKTDAIL--HSTAQMDCRVAGTVPILVAWSK--NGVEIVDGDKYRCLFEENTASLEILKVDKS-DDGSYTCTATNVAG--RDSCSTTLSIIEPPSFLMKMEP 6446          

HSP 13 Score: 65.4698 bits (158), Expect = 1.071e-10
Identity = 108/472 (22.88%), Postives = 186/472 (39.41%), Query Frame = 3
Query:  141 TLTINAPVITEMPKSY-FPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGP---LSRLIITEPEAQHEYKVYCNASNSLG----YAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLN-EVGTVHWSRLGGLNIETSRASFEG----YYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDG---SLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHN-EPLQAGGRIKIPTKGALQIL 1505
            T ++ AP I E  +S   P++G      R  G+P P+  W+         NGI +    +I    P   +  L+I +  A+    V   A N +G    +A     +  +    +     PA EK+  +  + ELS       P+  VKWFK  ++I S    +Y + +   ++  S+L I   +  D      +     ST R       +    ++ K  ++++   S   E++C +  E     W   G      ++  F      + L   ++   D G+Y   +    G+ +   + +  +A  + +Q   D ++ EGD   F    S  P  +  W L G   + P +    R  +  D     L I +    D GKY+       D + S+  L VK  EL        P ++ +++EG+  +  C+V         WY   HN E L+A  R++  TKG  Q L
Sbjct: 1474 TPSMEAPKILERIQSQTVPQFGEAHFRVRVVGKPDPECQWFK--------NGIKLEKSERIYWYWPEDNVCELVIRDVIAEDSASVMVKAINVVGETSSHAFLLVQAKQVITFTQPLADVPAKEKDTMATFECELS------EPFVKVKWFKGDQEIFSG--DKYRMHSDRKVHMLSVLTIEVYDDADFTCALIEEPETKSTARLIVETAPL----EFTKELEDIEVPESLGGELECVVTREDSDGKWYHKGKEIEAGAKYQFSSRRGRHTLLIRDVAKEDQGEYTFEV---EGKTTVGRLKMKPRA-VTLMQGLGDLSLCEGDIAQFEVRFS-HPGVEGQW-LKGTEEVQPSE----RVHIVIDKQAQQLLIEDLNKEDGGKYSFIAFEQ-DIK-STGKLDVKSVELLQ------PLKDVSVVEGTKGSMECKVSQAEVPGAKWY---HNGELLKASDRVQFITKGTKQRL 1904          

HSP 14 Score: 63.1586 bits (152), Expect = 4.781e-10
Identity = 59/205 (28.78%), Postives = 91/205 (44.39%), Query Frame = 3
Query:  909 YYLRFNNLQMSDSGKY--VC--RITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKI 1511
            ++L   N  + D G Y  VC   I+S   +  E  ++          Q+ +DK   EG+ V  TC    F +P +  +    S L      Y+     K   L I NT   DAG+YTC  +  ++A    A L V+ + LE+  VI    Q + + E  T T  CE V+  D  ++WY+  ++E LQ G +  + + G    L I
Sbjct: 7379 HHLVVTNCTLQDRGNYRVVCGPHISSAKLEVYELRLD----------QSLEDKQTTEGETVELTCT---FSVPNLTVQWYRNSKLIQPSQKYTLEVSEKQHRLVIHNTNLEDAGQYTCR-YEDIEA---PAELTVEAKPLEFTKVI----QTEEVRENETHTLECE-VTFEDADVSWYK--NDEELQEGPKYSLSSDGCAHYLTI 7559          

HSP 15 Score: 62.7734 bits (151), Expect = 7.097e-10
Identity = 111/524 (21.18%), Postives = 200/524 (38.17%), Query Frame = 3
Query:   93 FSYLIQIVIFLNYITDTLTINAPVITEMPKSYFPRYGTLEL-SCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVG--TVHWSRLGGLNIETSRASF----EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGS-----------LHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYP 1610
            F+  IQ    LN IT    I+ P I +  +    R G   L  C+ +  P  +  W+    + +++  I  +N  +I     +S+L I + +     +  C A+N  G+ VS  A   +  +            +++SG  V+L        P   V W K+      +    Y I ++   +   IL I N      G Y C+A N F +  + ++ L +     + K  + +K  +     ++C +++    TV W++ G     + + SF    +   L     +++D+G YVC  +S++G  S A    V   PA       +    +G  V   C + G P+ +V W        F  D       V  DG            L I +++T D+  YTC   + +     +  + VK+      P    P ++  +   S  T   E+       + W +     P     R K+    A   +      D   Y+C+  +K+N+ K    A +++  P
Sbjct: 4041 FAGKIQSTAQLN-ITKEEPIDPPSIIKRLEPQRVREGDPALFECQIEEVPLVNFQWF----RGEVI--IKTSNKYKISTENFISKLEIVDTQTAEAGEYTCKATNPAGF-VSCTADLKVIEMRPPSFVKKLEPIKSFSGKAVQLIAEVSGTHPIAIV-WSKD--GDDISDGDSYAIRSE---HNQCILAIGNVAVAHQGTYACKATNEFGS-DTCSAQLSVTDKPSFSKALQPVKAAVGTPLRLECEVDDDKGVTVAWTKSGKEIRPSRKLSFTFKNKLAVLEILKSELADTGDYVCTASSEAGSESTASSVEVKADPAGLRALQPEVKEAKG-LVHLDCSLKGSPVIKVTW--------FKNDN-----EVKADGRVQLSFVNNVAVLEIRDSETEDSADYTCEAQNEVGTVSCTCAVSVKE-----IPSFKKPLESMEVRGNSDVTLEVELDGSPPFDVKWVKNARELPKIDKYRAKLENTTATLRIGNFSAADVGQYSCK--VKNNVGKDESHANIKLKEP 4528          

HSP 16 Score: 62.7734 bits (151), Expect = 7.785e-10
Identity = 104/492 (21.14%), Postives = 196/492 (39.84%), Query Frame = 3
Query:  204 TLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAI------EKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSK-----YYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASFEGYY----LRFNNLQM--SDSGKYVCRITSKSGQPS-EALINLVVQA-PASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKID--PNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDS 1616
            T+ L C+  G P   +SWY  +  QK+ +G    +  ++     L+ L +            C A N  G A      T LA L+ + + NP        + +A  G      C      P+  + W+K+G +++S  +  Y+I+ + ++   + L I N     +G+Y C+    F+ V SA+ + K+ +  K     + K    ++     S E++C +     +  S L       S  +++ ++     R   L+    DSG YVC+  ++ G  +  A + +   A P +F++   +   +    VS  C +SG     V W       LF +   Y         +L I     +D G YTC  ++       SA L V   E    P  S   + Q ++ G    F+  V     +++ W+    ++ L+      I  +G   +L++    +  +  +TC+ +  + +        ++V  P S
Sbjct: 5514 TVHLECQVAGTPQIRVSWY--KGSQKLKSG----DKCKMAFKNNLATLELRSLTKADTGDYSCKAENDFGSA------TSLASLSVSERKNPPYFTRKLKDWQAVEGTAATFDCRVTGTPPFSFI-WYKHGVELSSGED--YVISAEENV---ATLDIHNVKLTHAGEYTCR---VFNDVDSASCSAKLEAKDKKVPPSFEKKPDPVEVTAGESFELECLIAGSRPIRISWLKNNREIRSVGNYKLFFYDNAARLTVLKAGKEDSGTYVCKAVNEVGSDTCSAQVTVKDHAVPPTFVRQLKETDGILNAPVSLECKISGTMPISVSW-YKDQEELF-DSQKYKLTTSDHTVNLEILELGIADGGNYTCKVNNVAGKDSCSAILRVTIAE---PPGFSKTLEYQEVLLGEYVRFQSIVTGTEPLSVKWF--ADSKELKPTDNCSISFRGNRALLELSQVDSASAGEFTCQVANAAGIETCSAKLFVKVSEPGS 5977          

HSP 17 Score: 62.003 bits (149), Expect = 1.311e-9
Identity = 59/205 (28.78%), Postives = 86/205 (41.95%), Query Frame = 3
Query:  792 KYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPAS---------------------FIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSY-SRFRV-----SKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYY 1325
            +YRI  SA+ Q               G+   T R +F             DSG++ C  T+++G  S +   L+VQ   S                     F+Q P  + ++EG  V F C + G P P VYW+  GI    P  T Y  R++V     + + SL IS T + DAG+YTC   +      +SA L ++  E E Y
Sbjct:  414 EYRIERSADFQIAFQ----------AGVASLTIREAF-----------AEDSGRFTCTATNEAGTVSTSSY-LLVQGEESIFLEDSEASGTDTGGDGIAPYFVQKPQPQHLVEGGSVVFHCQIKGSPKPHVYWKKSGI----PLTTGYRRRYKVHYNKETGECSLEISMTFSDDAGEYTCVVRNKQGDAAASARL-MEDAEYEAY 591          

HSP 18 Score: 58.5362 bits (140), Expect = 1.525e-8
Identity = 105/495 (21.21%), Postives = 188/495 (37.98%), Query Frame = 3
Query:  180 KSYFPRYGTLELS----CRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPT----VKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELK---YRISNSAEIQCPLNEVGT----VHWSRLG-----GLNIETSRASFEGY-YLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVV---QAPASFIQTP----DDKTVLEGDDVSFTCIVSGFPLPQVYW--------ELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKID--PNLDSNIYTCEA 1550
            KS  P  GT   S    C+  G P   ++WY    K   L+G       Q   A     L +   E        C A NSLG      A T  +   +  +  P+  +   +   V   C+  + R   T    V WF    +++ +   +++I+ + ++   SI  ++     D+G+Y C+  N   ++ S ++ L +          ++L+     + + AE++C L   G+    + W +       G N + +   F+   +L    L  SDSG+Y C+  +  G  +       +   +    F + P    D++   EG  V     VSG     + W          PG    F  + +           + + +T+ SD+G Y C   +          L +K+R+  + P      Q+ T++EG T +  C V     + I W +    + +Q  G++ I        L+I      D+  YTC+A
Sbjct: 6628 KSLEPMEGTFGTSVYFECQVAGAPEIRVTWYKGSQK---LSGAKYKTMFQHNTA----VLEVKNFEKADVGTYSCEAENSLG-----SAKTSASLAGKERKHPPSFSRMLKNMQQVIGDCAKFDARVTGTPPFHVSWFLGDSELSYSD--KHVISFEDNVASLSIFSLK---VSDAGEYTCKVSNEDGSI-SCSAKLDVTERKTKPTFDQKLEPVEAVVGDPAELECHLT--GSLPIKIFWMKDKKDIRPGPNCKMT--FFDNTPHLTIYKLDKSDSGEYTCKAVNDIGSDNSCTCETAIAERKVAPMFTKKPLEILDEE---EGKGVKLDSRVSGSQPIAITWTKDDKDLHAHPGRELSFKNNIAL----------MSLKSTKVSDSGLYVCKAENEAGTATFKVTLNIKERK--HAPNFDKKVQSLTVVEGDTLSASCRVSGSEPLQIMWLK--DRKEVQPFGKVSIAYSEGDCTLEISQVTKADAGEYTCKA 7083          

HSP 19 Score: 53.9138 bits (128), Expect = 3.532e-7
Identity = 42/162 (25.93%), Postives = 64/162 (39.51%), Query Frame = 3
Query: 1050 DKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSR---FRVSKD---GSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYY----------------PVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGR 1469
            D TV+EG+ V   C V+GFP P + W        F E+    R   F+++      SL I      D+G++TC   +      +S+ L V+  E  +                 P     PQ Q L+EG +  F C++       + W +     PL  G R
Sbjct:  385 DTTVVEGESVRMECQVAGFPTPAIMW--------FREEYRIERSADFQIAFQAGVASLTIREAFAEDSGRFTCTATNEAGTVSTSSYLLVQGEESIFLEDSEASGTDTGGDGIAPYFVQKPQPQHLVEGGSVVFHCQIKGSPKPHVYWKKS--GIPLTTGYR 536          

HSP 20 Score: 53.5286 bits (127), Expect = 4.661e-7
Identity = 73/347 (21.04%), Postives = 128/347 (36.89%), Query Frame = 3
Query:  390 CNASNSLGYAVSPPASTGLA--YLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISN---------SAEIQCPLNEVGTVHWSR-------LGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPAS----------------------------FIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGS---LHISNTQTSDAGKYTC---NCHSSLDA 1274
            C A N +G   S    T +A   +   F   P    +   G  V+L       +P   + W K+ + +  A   R L       N  +++ +++    DSG Y C+AEN      + T+  K+  N K  K       ++ +         SA  +   +E   + W +        G ++I  S        L  + +  +D+G+Y C+  +++G    + + +  +AP +                            F++ P +  V E   V FT  V G P+P V W    I   + +     R  V + G+   L I     +DAG Y C   N H  +++
Sbjct: 6887 CKAVNDIGSDNSCTCETAIAERKVAPMFTKKPLEILDEEEGKGVKLDSRVSGSQPI-AITWTKDDKDL-HAHPGRELSFK----NNIALMSLKSTKVSDSGLYVCKAEN-----EAGTATFKVTLNIKERKHAPNFDKKVQSLTVVEGDTLSASCRVSGSEPLQIMWLKDRKEVQPFGKVSIAYSEGDC---TLEISQVTKADAGEYTCKAVNEAGSDI-SKVKVTTKAPEAGKPARKTAAPVAAPTAAPAPVVVDGKIFFVEEPKNAKVEEKGTVKFTAKVGGEPIPTVKW----IKGKWRQLNHGGRLTVQQKGADALLEIREATKTDAGPYRCVANNRHGEIES 7214          

HSP 21 Score: 51.2174 bits (121), Expect = 2.544e-6
Identity = 45/170 (26.47%), Postives = 63/170 (37.06%), Query Frame = 3
Query:  894 ASFEGYYLRFN----------NLQMSDSGKYVCRITSKSGQPS-------------------EALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSY--SRFRVSKDGS---LHISNTQTSDAGKYTCNCHSSLDARHSSANLFV 1301
            +S +G+YL  N          ++ + D G Y+C+  + +G+ S                    AL  L+ +AP  F Q    K    G DVSF C V G P P + W        F  D      +F V   G    L + N    D G Y C   +S     + A L V
Sbjct: 2946 SSMDGHYLIANKSGYVSLEIKHVSLLDRGMYLCKAVNGAGESSCRAALNISQRFADSGDRGESALEFLITEAPPKFTQPLGTKRCAPGCDVSFECQVIGEPAPDIAW--------FRNDVELRGGQFDVRSMGKKQILTVKNVSKCDEGSYKCTASNSSGTAQTEATLSV 3107          

HSP 22 Score: 49.6766 bits (117), Expect = 7.520e-6
Identity = 55/209 (26.32%), Postives = 89/209 (42.58%), Query Frame = 3
Query: 1032 FIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISN-TQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKI--DPNLDSNIYTCEASLKSNLMKTRWTALLRVI--YPDSGIQVMTPLN 1643
            FI    D TV EGD  +FT  ++     QV W   G   +   +      R     SL I+  ++    G+Y C   +      S+A L + K E    P I    + Q + EG  A F C++     V   W+RG     ++   + KI T+  +  L+I      ++  YTC+A+  +  +    TA L+VI   P S ++ + P+ 
Sbjct: 3967 FITQLQDATVPEGDKATFTASITH--AAQVNWYHSGRPVVASAEVKC--LREGDHNSLTITKASKEEHEGEYACEAINFAGKIQSTAQLNITKEEPIDPPSIIKRLEPQRVREGDPALFECQIEEVPLVNFQWFRG--EVIIKTSNKYKISTENFISKLEIVDTQTAEAGEYTCKATNPAGFVSC--TADLKVIEMRPPSFVKKLEPIK 4167          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Sea Lamprey
Match: cntn3b (contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645])

HSP 1 Score: 100.138 bits (248), Expect = 1.825e-21
Identity = 118/461 (25.60%), Postives = 173/461 (37.53%), Query Frame = 3
Query:  207 LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL------------NEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYY--PVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTC 1544
            +   CRA G P P   W        + NG  +        AG    LI+  P    +  V+ C  +NS+G  +S  A    AYL  +F+S P        G  V L C+PP      T  W  N       S+ R  ++ Q   N Y I K+      D G Y C   N  +  R A+    +   S     + E +  +  S +    L            N V  + W ++ G     +        L   N Q  D G Y C   + +G+ S A   + V AP  +IQ   +     GD +S+ C   G P P   W   G+    P   S SRF V  +G L +   Q  D G Y C   +     +S   L VK    ++   P+  + P  +    G  A  +CE  +    + TW +G  N  +    R+ I   G+L I  +  + D+  YTC
Sbjct:   28 VSFRCRASGHPPPLYRW--------LKNGTEVPITGHYSLAG--GSLIVRNPSEGRDGGVFQCLVTNSVGSIISVEARLQFAYL-ESFRSKPRGTVAVRQGQGVVLICAPPPYSGELTFVWLFNEMYDYMRSDGRRFVS-QVTGNLY-IAKVE---ATDVGSYTCMVHNTVTNTRVASPPTPLLIKSGRSMGEYEPRIEVGFSPKTHTLLGHTVRLECFALGNPVPVISWRKIDGQLPSKAYLMEANAVLEIPNFQHEDGGNYECNAENVAGKNS-AQGKITVYAPPHWIQPISNVEQGIGDKLSWDCKAGGKPPPTYRWLRNGVP--LP---SESRFSVMANGELILQELQPWDRGMYQCLAENKHGRIYSHGELRVKASAPDFRSNPLKRVTPAAR----GGQAVIKCEPKAWPRPSFTWTKG--NAMVMDNERMSITQNGSLWIRSVT-DEDAGTYTC 459          

HSP 2 Score: 78.9518 bits (193), Expect = 5.727e-15
Identity = 123/506 (24.31%), Postives = 191/506 (37.75%), Query Frame = 3
Query:  504 GNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVG--TVHWSRLG-GLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQP-SEALINLVVQAPASFIQTPDDKT--VLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSH---MDVTITW----------YRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQ-----VTYWIEYVRFGSREGWVIYKKDWPDT------KITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLS 1931
            G+ V L C    G P P + W K   Q+ S +   YL      +   ++L+I N   ED G Y C AEN  +   SA   + +++   + +    ++  I +     C        T  W R G  L  E+  +      L    LQ  D G Y C   +K G+  S   + +   AP  F   P  +      G      C    +P P   W       +  E     R  ++++GSL I +    DAG YTC   + L + +S+  L +K+        I++ P  + +  G +  + C+  SH   +D+   W              H + LQ     K  T     I ++      N YTC A  ++++  T   A+L V  P                  PP      E T+ +V LTW          ++Y I+     +  GW+      PD       + TV  L+P   Y+F V + N  G S AS P+  +KT S
Sbjct:  222 GHTVRLECFA-LGNPVPVISWRKIDGQLPSKA---YL------MEANAVLEIPNFQHEDGGNYECNAEN-VAGKNSAQGKITVYAPPHWIQPISNVEQGIGDKLSWDCKAGGKPPPTYRWLRNGVPLPSESRFSVMANGELILQELQPWDRGMYQCLAENKHGRIYSHGELRVKASAP-DFRSNPLKRVTPAARGGQAVIKCEPKAWPRPSFTWTKGNAMVMDNE-----RMSITQNGSLWIRSVTDEDAGTYTCTVENHLGSANSTGRLILKESTR-----ITVVPSLKMVSVGESIVWPCQ-ASHDPSLDIVFVWSLNGQRIDMEKDAEHYQLLQGS---KSQTSDLALIKRLQLRHRGN-YTCTA--QTSVDNTSAWAMLMVRGPPG----------------PPGAVVAEEATSTTVRLTWKRGSNNHSPIISYKIQARAPVASTGWLNVHTS-PDIISGDSEQATVVGLTPWMDYEFTVLAINALGESEASRPSRMIKTQS 681          

HSP 3 Score: 68.5514 bits (166), Expect = 1.050e-11
Identity = 102/445 (22.92%), Postives = 168/445 (37.75%), Query Frame = 3
Query:  177 PKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHE--YKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYK---MQKELKYRISNSAEIQCPLNE--VGTVHWSRLGGLNIETSRASF-EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFP-LPQVY-WELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDA-----------GKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNE 1448
            PK++     T+ L C A G P P ISW  +  +        + +   +M+A      ++  P  QHE      CNA N  G      A   +          P    E   G+ +   C    G+P PT +W +NG  +   S SR+ +    +L    IL+   P   D G Y C AEN    + S    L++ +++  ++   +++         A I+C        +  W++   + ++  R S  +   L   ++   D+G Y C + +  G  + +   L+++        P  K V  G+ + + C  S  P L  V+ W L G      +D  + +        L  S +QTSD            G YTC   +S+D   + A L V+            PP       G       E  +   V +TW RG +N 
Sbjct:  215 PKTHTLLGHTVRLECFALGNPVPVISWRKIDGQ--------LPSKAYLMEA----NAVLEIPNFQHEDGGNYECNAENVAG---KNSAQGKITVYAPPHWIQPISNVEQGIGDKLSWDCK-AGGKPPPTYRWLRNG--VPLPSESRFSVMANGEL----ILQELQP--WDRGMYQCLAENKHGRIYSH-GELRVKASAPDFRSNPLKRVTPAARGGQAVIKCEPKAWPRPSFTWTKGNAMVMDNERMSITQNGSLWIRSVTDEDAGTYTCTVENHLGS-ANSTGRLILKESTRITVVPSLKMVSVGESIVWPCQASHDPSLDIVFVWSLNGQRIDMEKDAEHYQL-------LQGSKSQTSDLALIKRLQLRHRGNYTCTAQTSVDNTSAWAMLMVRG-----------PP-------GPPGAVVAEEATSTTVRLTWKRGSNNH 608          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008186.1 (pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 gene:ENSPMAG00000007342.1 transcript:ENSPMAT00000008186.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.8265 bits (242), Expect = 1.410e-20
Identity = 95/375 (25.33%), Postives = 151/375 (40.27%), Query Frame = 3
Query:  495 AYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQY---SILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEV---GTVHWSRLGGLNIETSRAS-FEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTP-DDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSR---FRVSKD--GSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTR 1580
            A SG+  EL+C+   G P P  +W ++G            +   PD  +    S L I +   EDSG Y C+  N+F  V + +  L I +          LK  +S +AE  C ++     G V W   G     T+  S  +G  L  +    SD G Y C    + G  ++    L+++  +  I +   ++ V  G+  S  C+V G P P + W L G  AL   D  + R        D  G L+++  + +D G Y C   ++       A + V+       P I  P +N T I G  A   C V+ +   +I W R     PL    R  +   G L++  +   +D   Y C   ++     +R
Sbjct:   69 AASGSRSELACTA-AGHPAPRSRWLRDG------------VPLPPDRRRGAGGSGLVITDTTVEDSGAYVCEVWNSFG-VAAVSGRLTIKAPVVVRVDPHRLKTTLSGTAEFSCEVSGAAGDGMVTWFHNGDPPTPTASVSGAQGERLSVHAAGRSDGGTYQCVARGEGGDTAQDFSILMLEDGSPKIASSFSERVVSPGEPFSLQCVVRGSPPPTIAWTLDGEPALS-RDAPHRRGNHIVTPGDVTGYLNVTGARVTDGGVYRCQAGNAAGQAEYQARINVRGS-----PSIR-PMRNVTAIAGREAYLHCRVIGYPYYSIRWLR--EGTPLPYNHRQTVFANGTLRLADVQKGMDEGAYICSVLVQPGASPSR 420          

HSP 2 Score: 89.7373 bits (221), Expect = 3.936e-18
Identity = 193/886 (21.78%), Postives = 320/886 (36.12%), Query Frame = 3
Query:  213 LSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNR-NFQSNPAIEK----EAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQA--ENAFSTVRSATSNLKIFSNSKYYKM----QKELKYR----ISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELP---GISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTL-IEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGA----LQILKIDPNL--DSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPT----EKTADSVTLTWSS-----TGQVTYWIEYVRFGSREGWVIYKKDWPDT--KITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENS--RPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFK-KIEIPNLDDRKSYSLHLSVFNCRGEGVRSQRIYV 2750
            L C   G P P I+W  L  +  +           I+  G ++  +        +  VY C A N+ G A          Y  R N + +P+I       A +G +  L C    G PY +++W + G  +    N R  +     L    + K       D G Y C    +   S  RS    +K     + ++M    Q +  Y     +S  + I+   ++ G     RLG   +ET+   F    L  N  Q+ + G Y C   +++   S     L+V+ P  F+  P D+  + G  V   C   G+P+P++ W+     G     P  +   RF+   +GSL +   Q  D G Y C   + +    S + L   K      P +     N TL   G  +  +C       + I W +       +   R  + T+      L  L+I P +  DS  +TC A              +     D G+  +T       +  PP  DPP     E  A ++TL W+S     +    + IEY             KD   T  + T+ +L P + Y F V ++N  G   AS P++ +   ++E +   P L+                     L P     +++ W++  G  + G +I G++I Y                                              P S   S           RL         ++  L  F+ Y   V+A+  N + +   S        E++PS+PP NI+   S + + + + +  PP    NG L G  V  +       LG ++   T + + ++ +L+   +YSL +  F   G+GVRS   +V
Sbjct:  259 LQCVVRGSPPPTIAW-TLDGEPALSRDAPHRRGNHIVTPGDVTGYLNVTGARVTDGGVYRCQAGNAAGQA---------EYQARINVRGSPSIRPMRNVTAIAGREAYLHCRV-IGYPYYSIRWLREGTPL--PYNHRQTVFANGTLRLADVQK-----GMDEGAYICSVLVQPGASPSRSLIVTVKEPPLIQPFEMPAVTQGQRVYVPCVIVSGDSPIRITWHKDGQPLPPRLGA-QVETTE--FISSLLIPNVTQLHN-GNYTCLARNEAATVSHG-SQLIVRVPPRFVVQPKDQDGIFGKPVVLNCSADGYPIPKIIWKYSKGNGNPQFQPVLSGGGRFQPLGNGSLLLRQVQEEDGGFYLCQVSNGVGTDISKSMLLNVK-----IPALVTSQANVTLATRGQHSNLQCSARGERPIIIRWEKEETLIDPERMFRYVVYTQDTGDELLSTLQILPTVRGDSGFFTCHA--------------INSYGEDRGLIQLT-------VQEPP--DPPEVEVREVNARTITLRWTSGFDGNSPITAFDIEYKNRSDTWEQKQRTKDISSTINQATIIDLHPATHYVFRVYAKNRIG---ASEPSKDLPITTQEAAPDGPPLE-------------------VILEPQSSQSIRVTWKVPHGHLRNG-VIRGYQIGYR------------------------------------------EAEPGSGALSQFN------IVRLESTGERESCLLHHLKKFTRYAVMVQAF--NLAGSGPSSSEAYAATLEDVPSKPPANIQAA-SISADAITLSWSPPPRDAHNGLLQGYRVIYYPVLPDGELGDVRNLTTSQLRADLRDLEKFTNYSLQVLAFTRAGDGVRSVATFV 1019          

HSP 3 Score: 63.1586 bits (152), Expect = 4.723e-10
Identity = 109/484 (22.52%), Postives = 178/484 (36.78%), Query Frame = 3
Query:  210 ELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRN--FQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAE---IQCPLNEV--GTVHWSRLGGLNIETSRASFEGY----------YLRFNNLQMSDSGKYVCRITSKSGQPS-EALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTS-DAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVS-HMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRV 1601
            EL+C A G PAP   W        + +G+ +  P    +    S L+IT+   +      C   NS G A    A +G   +      + +P   K   SG   E SC          V WF NG   T         T      Q   L +    + D G Y C A           S L +   S   K+      R+ +  E   +QC +      T+ W+  G   +        G           YL     +++D G Y C+  + +GQ   +A IN V  +P+  I+   + T + G +    C V G+P   + W   G    +       R  V  +G+L +++ Q   D G Y C+      A   S +L V  +E    P +  P +   + +G      C +VS    + ITW++     P + G +++     +  ++     L +  YTC A  ++  +      ++RV
Sbjct:   76 ELACTAAGHPAPRSRW--------LRDGVPL--PPDRRRGAGGSGLVITDTTVEDSGAYVCEVWNSFGVA----AVSGRLTIKAPVVVRVDPHRLKTTLSGT-AEFSCEVSGAAGDGMVTWFHNGDPPTP--------TASVSGAQGERLSVHAAGRSDGGTYQCVARGEGGDTAQDFSILMLEDGSP--KIASSFSERVVSPGEPFSLQCVVRGSPPPTIAWTLDGEPALSRDAPHRRGNHIVTPGDVTGYLNVTGARVTDGGVYRCQAGNAAGQAEYQARIN-VRGSPS--IRPMRNVTAIAGREAYLHCRVIGYPYYSIRWLREGTPLPY-----NHRQTVFANGTLRLADVQKGMDEGAYICSVLVQPGA-SPSRSLIVTVKE----PPLIQPFEMPAVTQGQRVYVPCVIVSGDSPIRITWHKDGQPLPPRLGAQVETTEFISSLLIPNVTQLHNGNYTCLARNEAATVSHGSQLIVRV 521          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Nematostella
Match: EDO45383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT26])

HSP 1 Score: 102.449 bits (254), Expect = 1.179e-22
Identity = 116/491 (23.63%), Postives = 196/491 (39.92%), Query Frame = 3
Query:  207 LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQT-PDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSK-------DGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAG-GRIKIP-------TKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVM 1631
            ++  C+  G P+P+++W        + +G  +N  V        + L+IT           CNASN LG  +S  A+  + Y    F + P  +K    G  V   C   +G P PTV W KNG  + ++ + R+        +  + L I N N+ DSG Y C                                    N++ I  P N+                     E  +L  +NL  +D   Y CR  + +G+ +   +NL V  P  F+Q+  D++T+ E D+++ TC + G PL  V W L   + L P+    SR  +++       + +L I N    D   Y C    + +   ++ +       ++Y P     P+N+T+ E S  T  C++      ++TW +   N PL     RI +        T  +L I  +    D   Y+C+A + +   K+    LL V YP   ++++
Sbjct:   14 VKFECQTTGNPSPNVTW--------LKSGSAVNTSVDPRFYSNDTILMITNVSRIDSGTYSCNASNELGI-ISAEAALDVRY-GPEFVNVPQ-DKTPNEGWSVTFECHT-KGNPPPTVTWLKNGSALNTSVDPRFY-------SNGTHLMITNVNRTDSGAYRC------------------------------------NASSILGPEND-------------------GNETSFLMISNLNRTDEASYTCRAKNAAGEKTSGSVNLAVNYPPKFLQSLKDEETLNETDNLTLTCKLEGKPLATVVW-LKDNTELEPD----SRLIITQPSSVDSGESTLTIINVHRHDEAYYKC---LANNTVDTTTSTTNTSVVVQYPPKFFQSPKNETVTEKSNVTLTCQLECKPKCSVTWLK--DNTPLDTSPDRITVTHPGSYGNTTSSLTITNL-VRTDEARYSCKA-INAAGEKSSEQGLLTVNYPPKFLEIL 418          

HSP 2 Score: 62.7734 bits (151), Expect = 5.305e-10
Identity = 51/170 (30.00%), Postives = 71/170 (41.76%), Query Frame = 3
Query: 1044 PDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEAS 1553
            P  KT  EG  V F C  +G P P V W   G +     +TS      S D  L I+N    D+G Y+CN  + L    + A L V+     Y P     PQ++T  EG + TF C    +   T+TW +  +   L      +  + G   ++      DS  Y C AS
Sbjct:    3 PKGKTTTEGQVVKFECQTTGNPSPNVTWLKSGSAV----NTSVDPRFYSNDTILMITNVSRIDSGTYSCNASNELGIISAEAALDVR-----YGPEFVNVPQDKTPNEGWSVTFECHTKGNPPPTVTWLK--NGSALNTSVDPRFYSNGTHLMITNVNRTDSGAYRCNAS 161          

HSP 3 Score: 60.077 bits (144), Expect = 3.703e-9
Identity = 90/381 (23.62%), Postives = 149/381 (39.11%), Query Frame = 3
Query:  156 APVITEMPKSYFPRYG-TLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTG-------LAYLNRNFQS-------NPAIEKEAYSGN-----------------------DVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQ-YSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNL-------KIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETS----RASFEGYY------LRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVL-EGDDVSFTCIVSGFPLPQVYW 1127
             P    +P+   P  G ++   C   G P P ++W        + NG  +N  V        + L+IT           CNAS+ LG     P + G       ++ LNR  ++       N A EK + S N                       ++ L+C   EG+P  TV W K+  ++    +SR +IT    ++   S L I N ++ D   Y C A N   T  S T+         K F + K   + +  K  ++ + +++C      +V W +     ++TS      +  G Y      L   NL  +D  +Y C+  + +G+ S     L V  P  F++    + +  E D+++ TC + G PL  V W
Sbjct:   87 GPEFVNVPQDKTPNEGWSVTFECHTKGNPPPTVTW--------LKNGSALNTSVDPRFYSNGTHLMITNVNRTDSGAYRCNASSILG-----PENDGNETSFLMISNLNRTDEASYTCRAKNAAGEKTSGSVNLAVNYPPKFLQSLKDEETLNETDNLTLTCK-LEGKPLATVVWLKDNTEL--EPDSRLIITQPSSVDSGESTLTIINVHRHDEAYYKCLANNTVDTTTSTTNTSVVVQYPPKFFQSPKNETVTE--KSNVTLTCQLEC--KPKCSVTWLK-DNTPLDTSPDRITVTHPGSYGNTTSSLTITNLVRTDEARYSCKAINAAGEKSSEQGLLTVNYPPKFLEILKAEEMRNETDNLTLTCKLEGKPLATVLW 446          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Nematostella
Match: EDO49553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL7])

HSP 1 Score: 98.5969 bits (244), Expect = 4.001e-21
Identity = 121/480 (25.21%), Postives = 196/480 (40.83%), Query Frame = 3
Query:  207 LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKA---GPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPP-------EGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIET--SRASFEG--YYLRFNNLQMSDSGKYVCRITSKSGQP---SEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDG---SLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKI-DPNL-DSNIYTCEASLKSNLMKTR 1580
             +LSC   G P P++ W+    + ++L       P +  KA   G +S L + E E   +    C  +N+ G   S    T L    R  +    I +E      +E+    P        GRP PTV W+KNG+++    +             Y  L I    +ED+G Y C A N             + S  + +++Q            ++ P     +V W R     +    SR +F+G  Y L   ++++ D+G+Y C  ++  G+    +E  +N   +AP  F+       V EGD+VS+ C V+G P P V W     +     DT   R+++  DG   SL +S     D G Y C   +S  +  SSA L V K+  +  P +     +   +EG+ A F           +TWYR  ++  ++   R  +   G    L I D  L D+  Y C A+ +   + +R
Sbjct:   33 FQLSCNVTGRPQPEVQWF----RDEVLI-----KPSRRFKASYDGNVSALTVKEAELDDDGVYKCVVTNNFGSVSSKADVTVLKKHLRPERDYAPIFEEKQFLEPLEIQVRQPVEVSYHVRGRPKPTVTWWKNGKELRDGKHVEIRSGGT-----YHTLYILRSEEEDAGSYKCLARN------------DVGSAERLFEVQ------------VEEP-----SVTWYRNKNEIVPDGRSRTTFDGETYKLILQDIKIKDAGQYECIASNPIGKAFCTAEMTVNKR-EAPV-FVSKLRPLFVTEGDNVSWMCKVAGMPRPTVEWYRD--NQPLRADT---RWKMDFDGRVCSLFLSEADCKDKGVYNCVITNSAGSAFSSAELQVDKKANK--PKVIEKMNDVQTVEGTEARFDVRFSGLPRPEVTWYR--NSIKVRNESRFHLSEDGDRYSLTITDTKLVDTGTYKCVATNEGGKITSR 458          

HSP 2 Score: 50.0618 bits (118), Expect = 5.673e-6
Identity = 47/179 (26.26%), Postives = 79/179 (44.13%), Query Frame = 3
Query: 1059 VLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDG---SLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKREL----EYYPVISLPPQNQTLIEGSTATFR--CEVVSHM----DVTITWYRGPHNEPLQAGGRIKIPTKGALQILKI--DPNLDSNIYTCEA 1550
            + EGDD   +C V+G P P+V W    +  + P      RF+ S DG   +L +   +  D G Y C   ++  +  S A++ V K+ L    +Y P+     + +  +E      R   EV  H+      T+TW++  + + L+ G  ++I + G    L I      D+  Y C A
Sbjct:   27 ITEGDDFQLSCNVTGRPQPEVQWFRDEV-LIKPS----RRFKASYDGNVSALTVKEAELDDDGVYKCVVTNNFGSVSSKADVTVLKKHLRPERDYAPIF----EEKQFLEPLEIQVRQPVEVSYHVRGRPKPTVTWWK--NGKELRDGKHVEIRSGGTYHTLYILRSEEEDAGSYKCLA 194          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Nematostella
Match: EDO49558 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM2])

HSP 1 Score: 96.2857 bits (238), Expect = 2.007e-20
Identity = 100/354 (28.25%), Postives = 144/354 (40.68%), Query Frame = 3
Query:  540 GRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNS---AEIQCPLNEVGTVHWSRLGGLNIETSRASFEG----YYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQA--PASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRV--SKDGS-LHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKREL--EYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKI-DPNL-DSNIYTCEAS 1553
            G P P V WF  G+ I    N R            S+L I N   +D   Y C+A N    V  ++  L        +  + ELK  +  S    E++        V W + G L   +S  + E     + L   N  + D G+Y C   +K G+ S     LV +   P  FI  P    ++EG    F   VSG P P+V W   G   + P      RF++   KD S L I + + +D G+YTC   S       S  L V +  +  E+   IS    N  L EG  A F   +       +TWY+     P++ GGR +I +      L I D  L D+  Y+C+A+
Sbjct:  194 GEPKPVVLWFCEGKPI--EENRRVYTMRD---GSTSVLVIENAELDDEAMYTCKAINDLGEVECSSEMLPTDEAGPKFLQRLELKEVVEGSRTDLEVEVSGKPKPVVEWLKDGELVKPSSLMTLETEGQVHTLTIMNTTLDDEGEYTCIAKNKVGEVSCTAELLVEEGMRPPQFIVKPSSLQIMEGKMAKFEARVSGLPGPEVEWLRDG-RPIKP----GRRFQIEFEKDRSVLTIIDAKLNDEGEYTCVATSKAGKDSCSVELLVDEAVVPPEFVRKIS----NIELTEGEIARFDVRITGTPAPEVTWYK--DEVPIEDGGRFEIYSDDDKHSLVIRDCALSDTGSYSCKAT 531          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Nematostella
Match: EDO49554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL8])

HSP 1 Score: 95.5153 bits (236), Expect = 4.044e-20
Identity = 145/588 (24.66%), Postives = 232/588 (39.46%), Query Frame = 3
Query:  207 LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPE----GRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSR--ASFEGYY--LRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPA--SFIQTPDDKTVLEGDDVSFTCIVSGFPLPQV--YWELPGISALFPEDTSYSRFRVSKDG---SLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTAT------FRCEVVSHMDVTITWYRGPHNEPLQAGGRIKI--PTKGALQILKIDP--NLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQVTYWIEYVRFGSREGWVIYKKDWPDT-KITVENLSPNSWYQFLVRSRNHKGLS 1892
            ++L C+    P P ++WY   +  K      +++ +     G  SRL I +     E    C+  N LG A S      L    RN +  P I  E     +VE      E    G P P V+W++    +T     R+ I+ + D+  YS L +R+  ++DSG Y   A+N        T                 L  R+S   +         T+ W R        +R  AS+EG    L    +++SD+G Y C  T+  G  S +    + +  A  +F+    +   LE  D+     + GFP P V  Y +   I           R ++ +DG   SL I+N +  DAG Y C   + L    S A + V++R  E+ P   + P+    +E  TA       F   +  +    + WYRG     ++ GGR  I    +  +  L ID     DS  Y C AS  +     + TALL +   D   +V+ P  D+    + P+     E+   S+ +      +VT++ +      RE   I  K   DT  I +   +P     ++  + N  GL+
Sbjct:   32 IDLVCKVSVNPKPTVTWYKGDALVK------LDDRISAHFDGRFSRLSIQKATKDDEGIYICDVQNELGKAFS---KVELTVRKRNVK--PQIVGEIKDAEEVERGEVRFEVRVTGFPKPRVEWYRGPVHLTDG--GRFSISEKEDM--YS-LTVRDLKRDDSGTYKLVAQNTVGKCDKYT-----------------LVCRVSGKPK--------PTITWFRDNTPVHTDNRVVASYEGSVSALELKEMKLSDAGLYKCTATNSQGSTSSSAEVTIKRKDAIPTFVVGLKETEGLESSDMRLDVKIGGFPRPTVEFYKDYDLI-------VDSERHKILEDGDRCSLIITNLRPEDAGTYKCVITNLLGVETSEAVIRVQER--EHAPRFDVKPEFLRKVEDVTALETEQVWFEIPIQGYPRPIVEWYRGTTR--IKDGGRFTISESEENDMYSLVIDEARTEDSGPYKCVASNDAG----KTTALLNL---DVNEKVVQPEFDK---EVKPIEVKHGEEATTSLEIKGKPKPKVTWYKDGKVL--RESKNIQLKSIGDTYSIRIVRTAPEDVGTYMCEATNKAGLA 555          

HSP 2 Score: 74.3294 bits (181), Expect = 2.156e-13
Identity = 114/508 (22.44%), Postives = 202/508 (39.76%), Query Frame = 3
Query:  150 INAPVITEMPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVY-CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENA-FSTVRSATSNLKIFSNSKYYKMQ-KELKYRISNSAEIQCPLNEVG--TVHWSRLGGLNIETSRASF----EGYYLRFNNLQMSDSGKYVCRITSKSG-QPSEALINLVVQAPA-------SFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDG-----SLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKG---ALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLR 1598
            +   ++ E+  +     G +    R  G P P + WY                PV +   G   R  I+E E  +   V      +S  Y +    + G                + Y+     L C    G+P PT+ WF++   +   +++R + + +      S L+++     D+G Y C A N+  ST  SA   +K       + +  KE +   S+   +   +      TV + +   L +++ R       +   L   NL+  D+G Y C IT+  G + SEA+I +  +  A        F++  +D T LE + V F   + G+P P V W   G + +        RF +S+       SL I   +T D+G Y   C +S DA  ++A L +   E    P      +   +  G  AT   E+       +TWY+    + L+    I++ + G   +++I++  P  D   Y CEA+ K+ L   ++   ++
Sbjct:  109 VKPQIVGEIKDAEEVERGEVRFEVRVTGFPKPRVEWY--------------RGPVHLTDGG---RFSISEKEDMYSLTVRDLKRDDSGTYKLVAQNTVGKC--------------DKYT-----LVCRV-SGKPKPTITWFRDNTPV--HTDNRVVASYE---GSVSALELKEMKLSDAGLYKCTATNSQGSTSSSAEVTIKRKDAIPTFVVGLKETEGLESSDMRLDVKIGGFPRPTVEFYKDYDLIVDSERHKILEDGDRCSLIITNLRPEDAGTYKCVITNLLGVETSEAVIRVQEREHAPRFDVKPEFLRKVEDVTALETEQVWFEIPIQGYPRPIVEW-YRGTTRI----KDGGRFTISESEENDMYSLVIDEARTEDSGPY--KCVASNDAGKTTALLNLDVNEKVVQPEFDKEVKPIEVKHGEEATTSLEIKGKPKPKVTWYK--DGKVLRESKNIQLKSIGDTYSIRIVRTAPE-DVGTYMCEATNKAGLASRKFDITIK 564          

HSP 3 Score: 63.1586 bits (152), Expect = 4.932e-10
Identity = 89/396 (22.47%), Postives = 151/396 (38.13%), Query Frame = 3
Query:  213 LSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAI--------EKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRS-ATSNLKIFSNSKYYKMQKELKYRISNSAEIQC--------------PLNE--VGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDK-----TVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKR 1310
            L CR  G+P P I+W+   +       +  +N V     G +S L + E +        C A+NS G   S    T         +   AI        E E    +D+ L      G P PTV+++K+   I  +   + L     D ++ S++ I N   ED+G Y C   N      S A   ++   ++  + ++ E   ++ +   ++               P+ E   GT      G   I  S  + + Y L  +  +  DSG Y C  ++ +G+ + AL+NL V      +Q   DK      V  G++ + +  + G P P+V W   G   +  E  +     +    S+ I  T   D G Y C   +         ++ +K R
Sbjct:  197 LVCRVSGKPKPTITWFRDNTP------VHTDNRVVASYEGSVSALELKEMKLSDAGLYKCTATNSQGSTSSSAEVT--------IKRKDAIPTFVVGLKETEGLESSDMRLDVKIG-GFPRPTVEFYKDYDLIVDSERHKIL----EDGDRCSLI-ITNLRPEDAGTYKCVITNLLGVETSEAVIRVQEREHAPRFDVKPEFLRKVEDVTALETEQVWFEIPIQGYPRPIVEWYRGTTRIKDGGRFTISESEEN-DMYSLVIDEARTEDSGPYKCVASNDAGKTT-ALLNLDVN--EKVVQPEFDKEVKPIEVKHGEEATTSLEIKGKPKPKVTWYKDG--KVLRESKNIQLKSIGDTYSIRIVRTAPEDVGTYMCEATNKAGLASRKFDITIKGR 566          

HSP 4 Score: 60.8474 bits (146), Expect = 3.197e-9
Identity = 78/292 (26.71%), Postives = 119/292 (40.75%), Query Frame = 3
Query:  492 EAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAEN----AFS----TVRSATSNLKIFSNSKYYKM--QKELKYRISNSAEIQCPLNE--VGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDT---SYSRFRVSKDGS---LHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRE 1313
            E   GND++L C      P PTV W+K G  +    +    I+   D  ++S L I+   K+D G Y C  +N    AFS    TVR      +I    K  +   + E+++ +  +     P  E   G VH +  G  +I       + Y L   +L+  DSG Y                 LV Q            TV + D  +  C VSG P P + W        F ++T   + +R   S +GS   L +   + SDAG Y C   +S  +  SSA + +K+++
Sbjct:   25 EVTEGNDIDLVCKVSVN-PKPTVTWYK-GDALVKLDDR---ISAHFD-GRFSRLSIQKATKDDEGIYICDVQNELGKAFSKVELTVRKRNVKPQIVGEIKDAEEVERGEVRFEVRVTG-FPKPRVEWYRGPVHLTDGGRFSISEKE---DMYSLTVRDLKRDDSGTY----------------KLVAQ-----------NTVGKCDKYTLVCRVSGKPKPTITW--------FRDNTPVHTDNRVVASYEGSVSALELKEMKLSDAGLYKCTATNSQGSTSSSAEVTIKRKD 271          

HSP 5 Score: 56.225 bits (134), Expect = 6.860e-8
Identity = 45/151 (29.80%), Postives = 60/151 (39.74%), Query Frame = 3
Query: 1059 VLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKI 1511
            V EG+D+   C VS  P P V W   G  AL   D   S     +   L I      D G Y C+  + L    S   L V+KR ++  P I    ++   +E     F   V       + WYRGP +  L  GGR  I  K  +  L +
Sbjct:   26 VTEGNDIDLVCKVSVNPKPTVTW-YKG-DALVKLDDRISAHFDGRFSRLSIQKATKDDEGIYICDVQNELGKAFSKVELTVRKRNVK--PQIVGEIKDAEEVERGEVRFEVRVTGFPKPRVEWYRGPVH--LTDGGRFSISEKEDMYSLTV 170          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Nematostella
Match: EDO40996 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5L2])

HSP 1 Score: 80.8777 bits (198), Expect = 2.305e-16
Identity = 73/264 (27.65%), Postives = 102/264 (38.64%), Query Frame = 3
Query:  540 GRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYC----QAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEI-QCPL--NEVGTVHWSRLGGLNIETSRASFEGYY-LRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKK 1307
            G P P + W  NG  +  A + R  I     L   +I   ++ +K D G Y C    Q  N    +RS    L++   + +          I     + +C +  +    V W + G +    SR +  G   L    +  SD+G Y C  TS   QP  A   L V  P  FI+   D     G  V+F C   G P P VYW   G           + F    DG L + +   SD G Y C   +SL +  +SA L V K
Sbjct:   42 GLPSPRISWRHNGNDLNLAGDKRRKILPDGSLLFITIEHTKS-SKPDEGNYQCVASSQVNNLDYEIRSRIVKLQVAGEADFVVTPPSRVVAIKGKHTVLECAVKGSPKPVVKWYKNGQIVTYDSRVTIIGESNLEIMQVVPSDAGTYKCEATSSGSQPVSAETRLKVNYPPVFIKRLRDHNAYTGSVVTFNCTADGNPKPNVYWSKNGYK------IGSTDFTKVGDGFLKVEDLLPSDMGMYQCFATNSLGSIQASAELSVYK 298          

HSP 2 Score: 67.781 bits (164), Expect = 6.095e-12
Identity = 80/299 (26.76%), Postives = 120/299 (40.13%), Query Frame = 3
Query:  111 IVIFLNYITDTLTINAPVITEMPKSYFPRYGTLEL-SCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLII--TEPEAQHEYKVYCNAS---NSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSG 983
            +V F  + T T +  AP   E P     +     L  CRA G P+P ISW   +     LN  G +   +I+  G L  + I  T+     E    C AS   N+L Y +             +F   P     A  G    L C+  +G P P VKW+KNG+ +T   +SR  I  + +L    ++        D+G Y C+A ++ S   SA + LK+     + K  ++      +     C    N    V+WS+ G     T        +L+  +L  SD G Y C  T+  G
Sbjct:    1 LVSFFLFSTVTSSQLAPFFLEEPSDIVVKKNRQALLKCRAGGLPSPRISW---RHNGNDLNLAG-DKRRKILPDGSLLFITIEHTKSSKPDEGNYQCVASSQVNNLDYEIRSRIVKLQVAGEADFVVTPPSRVVAIKGKHTVLECAV-KGSPKPVVKWYKNGQIVT--YDSRVTIIGESNLEIMQVV------PSDAGTYKCEATSSGSQPVSAETRLKVNYPPVFIKRLRDHNAYTGSVVTFNCTADGNPKPNVYWSKNGYKIGSTDFTKVGDGFLKVEDLLPSDMGMYQCFATNSLG 286          

HSP 3 Score: 58.151 bits (139), Expect = 7.447e-9
Identity = 74/308 (24.03%), Postives = 120/308 (38.96%), Query Frame = 3
Query: 1032 FIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSL---HISNTQTS--DAGKYTCNCHSSL-DARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSL--PPV----LDPPTEKTADSVTLTWSSTGQV---TYWIEYVRFGSREGWVIYKKDWP---DTKITVENLSPNSWYQFLVRSRNHKGLSRAS 1901
            F++ P D  V +       C   G P P++ W   G       D    R ++  DGSL    I +T++S  D G Y C   S + +  +   +  VK +       +  PP     I+G      C V       + WY+  + + +    R+ I  +  L+I+++ P+ D+  Y CEA+                    SG Q   P++ ET+L +  PPV    L      T   VT   ++ G      YW       S+ G+ I   D+    D  + VE+L P+    +   + N  G  +AS
Sbjct:   19 FLEEPSDIVVKKNRQALLKCRAGGLPSPRISWRHNGNDLNLAGD---KRRKILPDGSLLFITIEHTKSSKPDEGNYQCVASSQVNNLDYEIRSRIVKLQVAGEADFVVTPPSRVVAIKGKHTVLECAVKGSPKPVVKWYK--NGQIVTYDSRVTIIGESNLEIMQVVPS-DAGTYKCEAT-------------------SSGSQ---PVSAETRLKVNYPPVFIKRLRDHNAYTGSVVTFNCTADGNPKPNVYW-------SKNGYKIGSTDFTKVGDGFLKVEDLLPSDMGMYQCFATNSLGSIQAS 291          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Medaka
Match: robo1 (roundabout guidance receptor 1 [Source:NCBI gene;Acc:101157073])

HSP 1 Score: 212.616 bits (540), Expect = 4.429e-55
Identity = 230/884 (26.02%), Postives = 352/884 (39.82%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQ---IMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALF----PEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEY-YPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYR-----GPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLP-EDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNT-LIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRS 2735
            P I E P       G    L+C+A+G P P + WY    + +       +NP     ++ +G L   R++        E    C A N LG AVS  AS  +A L  +F+ NPA +    +G    L C PP G P PT+ W K+G  I    + R  I           L I N  K D+GKY C   N      S  + L +     + +        +  S E +C    + V TV W +  G   +      E + L+   L  +D G Y C   +  G+ +EA   L V  P +F+  P ++ V  G  V+F C  +G P P ++W+  G   L     P   S SRF VS+ G L I++ + SD G Y+C   +   +  + A L V     +   PVI   P NQT+    T    C    +   TI W +       H+       R+K    GALQI +     D+  YTC AS  S   +  W + + V    S IQ   P  D   +   P     TE T  SVTL+W     +     +Y IE     S   W    +        ++ L P++ Y FLVR+ N  GLS  S  T+ VKT       P     + + ++Q    ++ I + +   +    V+++W +     +     +G+++ Y   P         +G  K +                      W++                F+ R P ED+ +V  +  G+     Y+F V  ++     T  D +   TL  EE PS PP+ +    S +  T +I+ +  PP    NG +    +    N+SR  +       TF  + IP+L     YS+ ++     G GV+S
Sbjct:   31 PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTVEWYKDGERVETDR----DNPRSQRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSHNASLEVAILRDDFRQNPA-DVMVAAGEPAVLECQPPRGHPEPTISWKKDGVNIDD-RDERITIRG-------GKLMITNARKSDAGKYVCVGTNMVGERDSEVAELTVLERPSFVRRPGSQVVLVDQSVEFRCEARGDPVPTVRWRKDDGELPKGRYEIREDHTLKIRRLTSADVGSYTCVAENMMGK-AEASATLTVHVPPAFVVRPRNQVVGVGRTVTFQCEATGNPQPAIFWQREGSQNLLFSYQPPQPS-SRFSVSQTGDLTITDAERSDMGYYSCQALNIAGSVITKALLEVTDVVSDRPPPVIRQGPTNQTVPVDGTVDLNCMAAGNPTPTILWRKDGVLVSTHDS------RVKQLDTGALQI-RYAKLGDTGTYTCIASTPSG--EASWKSFVEVQEFGSPIQPHRP-TDPNLIPSAPSKPEVTEVTRTSVTLSWKPNLNAGATPTSYIIEAFSHASGSSWQTLAEHVKTESFVLKGLKPSAVYLFLVRAANAYGLSDPSPITDAVKT----QDIPPTSQGVDHRQIQRELGEVVIHLHNPTILSSSSVRVQWTV----EQQSQYTQGYRVMYRPSP---------EGPQKSE----------------------WSV----------------FEVRAPTEDSAVVTQLRKGVT----YQFKVRPFFNEFQGTDSDVKIGKTL--EEAPSAPPRKVTVTESGDNGTAIIVSWQPPPEEDQNGVVQEYKIWCLGNESRYHINRTVDGSTF-SVLIPSLAPGIRYSVEVAASTGAGPGVKS 827          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Medaka
Match: ENSORLT00000012598.2 (roundabout homolog 1 [Source:NCBI gene;Acc:101156600])

HSP 1 Score: 206.453 bits (524), Expect = 2.901e-53
Identity = 221/878 (25.17%), Postives = 358/878 (40.77%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPV---QIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFE---GYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISAL---FPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYP-VISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYR-GPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQ-----VTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWS-KNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEG 2726
            P I E P       G    L+C+A+G P P + WY    + +       +NP     ++ +G L   R+I        +    C A N LG A+S  AS  +A L  +F+ NP ++     G    L C PP G P PT+ W K+G  +    + R  I       +   L I N  K D+GKY C A N      S T+ L +     + K    +      S E  C +  + V  V W R    + +  +  FE    + L    +  SD G Y C + +  G+ SEA  +L V  P +F   P ++ V  G  V+F C  +G P P ++W+  G  +L   +     +SR  VS+ GSL I++ Q SDAG Y+C   +   +  + A L V     +Y P +I   P NQT++  S     C+       T+ W + G    P  A  R  +   G+L+I   +   DS +YTC AS      +  WTA L+V   + G+       +   +   P     T  +  SVTL+W S+        +Y IE   +     WV   +        + NL P + Y F++R+ N  GLS  S  ++ V+T   ++S   +K  + +  +Q+    + I +     +    V+L+W +     +    I+GFK+ Y      R   +  Q  ++                        W++      Q               ED+ I+  +  G    S YEF V  +++       DS+ +     E++P + PQ +    S  N   +++ +  PP    +GF+    +    N+SR  +     + TF  + I +L     YS+ ++  N  G G
Sbjct:   70 PRIVEHPSDLIVSKGEPATLNCKAEGRPPPTVEWYKDGERVETDR----DNPRSHRMLLPSGSLFFLRIIHGRRSKPDDGSYVCVARNYLGQAISHNASLEVAILRDDFRQNP-VDVMVAVGEPAVLECQPPRGHPEPTISWRKDGANLDD-RDERITI-------RSGKLMITNTLKTDAGKYICVATNMLGERESETAELTVLERPTFVKRPSSVVVLTDESVEFHCVVHGDPVPIVRWRRD---DSDLPKGRFEVLVDHTLIIRQVTSSDEGSYTCVVENMVGK-SEASASLTVHVPPAFATHPRNQVVSVGRTVTFQCEATGNPQPAIFWQREGSESLLFSYQPPQPFSRLSVSQMGSLTITDVQRSDAGFYSCQALNIAGSVITKALLEVSDAGSDYLPPIIKQGPSNQTVLVDSIVELGCQTAGTPPPTVHWKKDGVVLSP--ADSRTSLTETGSLKIYHTELG-DSGMYTCTASNPGG--EASWTAFLQV--QEFGVGKSDHPVENNMIPTAPSKPEVTNISQTSVTLSWKSSPDKEKLPTSYLIEAFSYTLGNRWVTLAEHVRAETFVLRNLKPGAVYLFMIRAVNTYGLSDPSPISDSVRT---QDSTAIIKG-VDHRHIQNELGDVVIHLHMPTVLSGSAVRLQWMV----EQQSPYIQGFKVLY------RLSAEHGQPEVQ------------------------WSVLEIHGSQ---------------EDSMIISHLKKG----SIYEFKVRPFFDE--FQGADSEVKVVRTLEDVPRRAPQGVTVTKSDANATAILVSWKPPPEAGEDGFIQEYRIWCLGNESRYHVNQSVDSSTF-SVLISSLAPGIRYSVEVAASNSAGLG 863          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Medaka
Match: robo2 (roundabout guidance receptor 2 [Source:NCBI gene;Acc:101159523])

HSP 1 Score: 205.682 bits (522), Expect = 3.343e-53
Identity = 176/603 (29.19%), Postives = 263/603 (43.62%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASF---EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEY-YPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSS--TGQ---VTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKT 1925
            P I E P       G    L+C+A+G P P + WY    ++   +     +   ++  G L   R++        E    C A N LG AVS  AS  +A L  +F+ NP I+    +     L C PP G P PT+ W K+  +I    + R  I           L I N  K D+G Y C   N      S T+ L +F    + +             E +C +  +    V W +    +++  R  F   + Y LR     +SD G + C   ++ G+  EA  +L V+AP  F+  P D+ V +  + +F C   G P P V+W+  G   L   +   SRF VS  G L I++ Q SDAG Y C   +   +  + A L V     +   P+I   P NQTL     A  +C+       +I+W +   +  L    R+ +   G+LQI  I  + DS +YTC A+  S   +T W+A L V  P S   V+    DE +L  PP      + T +SV+L+W S   G+    +Y IE         W         T+ TV++L PN+ Y F+VR+ N  GLS  S  ++ V+T
Sbjct:   32 PRIVEHPSDLIVSKGEPATLNCKAEGRPPPTVEWYK-DGERVETDKDDPRSHRMLLPTGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNP-IDVVVAAAEPAILECVPPRGHPEPTIYWKKDKVRIDD-KDDRITIRG-------GKLMISNTKKTDAGMYICVGTNMVGERESETAQLTVFERPTFIRRPINQVVLEDEMVEFRCQVQGDPQPNVRWRKD---DVDVPRGRFYDKDDYVLRVKKASVSDEGTFTCVAENRVGK-LEAAASLTVRAPPQFVIRPRDQIVAQDRNATFPCEAKGNPQPAVFWQKEGSQNLLFPNQPNSRFSVSPSGELTITSVQRSDAGYYICQALTVAGSILAKAQLEVTDVLADRPPPIIRQGPSNQTLGVDRVALLKCQASGEPIPSISWLKDGFSL-LGKDPRMSLQAPGSLQIKNIKLS-DSGVYTCVATSSSG--ETSWSAFLEVKDPGS---VIINEKDENKLPGPPSKPQVIDVTRNSVSLSWQSGMAGESPVTSYVIEAFSQSVSNSWQTVADHLKTTQFTVKSLRPNTIYLFMVRAVNSHGLSDPSPISDPVRT 613          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Medaka
Match: robo1 (roundabout guidance receptor 1 [Source:NCBI gene;Acc:101157073])

HSP 1 Score: 200.675 bits (509), Expect = 2.232e-51
Identity = 228/883 (25.82%), Postives = 350/883 (39.64%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQ---IMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALF----PEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEY-YPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYR-----GPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNT-LIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRS 2735
            P I E P       G    L+C+A+G P P + WY    + +       +NP     ++ +G L   R++        E    C A N LG AVS  AS  +A L  +F+ NPA +    +G    L C PP G P PT+ W K+G  I    + R  I           L I N  K D+GKY C   N      S  + L +     + +        +  S E +C    + V TV W +  G   +      E + L+   L  +D G Y C   +  G+ +EA   L V  P +F+  P ++ V  G  V+F C  +G P P ++W+  G   L     P   S SRF VS+ G L I++ + SD G Y+C   +   +  + A L V     +   PVI   P NQT+    T    C    +   TI W +       H+       R+K    GALQI +     D+  YTC AS  S   +  W + + V    S IQ   P  D   +   P     TE T  SVTL+W     +     +Y IE     S   W    +        ++ L P++ Y FLVR+ N  GLS  S  T+ VKT       P     + + ++Q    ++ I + +   +    V+++W +     +     +G+++ Y   P      +G Q    +  +  F+ R+  +                S V + L  GV  ++F+                        V  ++     T  D +   TL  EE PS PP+ +    S +  T +I+ +  PP    NG +    +    N+SR  +       TF  + IP+L     YS+ ++     G GV+S
Sbjct:   57 PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTVEWYKDGERVETDR----DNPRSQRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSHNASLEVAILRDDFRQNPA-DVMVAAGEPAVLECQPPRGHPEPTISWKKDGVNIDD-RDERITIRG-------GKLMITNARKSDAGKYVCVGTNMVGERDSEVAELTVLERPSFVRRPGSQVVLVDQSVEFRCEARGDPVPTVRWRKDDGELPKGRYEIREDHTLKIRRLTSADVGSYTCVAENMMGK-AEASATLTVHVPPAFVVRPRNQVVGVGRTVTFQCEATGNPQPAIFWQREGSQNLLFSYQPPQPS-SRFSVSQTGDLTITDAERSDMGYYSCQALNIAGSVITKALLEVTDVVSDRPPPVIRQGPTNQTVPVDGTVDLNCMAAGNPTPTILWRKDGVLVSTHDS------RVKQLDTGALQI-RYAKLGDTGTYTCIASTPSG--EASWKSFVEVQEFGSPIQPHRP-TDPNLIPSAPSKPEVTEVTRTSVTLSWKPNLNAGATPTSYIIEAFSHASGSSWQTLAEHVKTESFVLKGLKPSAVYLFLVRAANAYGLSDPSPITDAVKT----QDIPPTSQGVDHRQIQRELGEVVIHLHNPTILSSSSVRVQWTV----EQQSQYTQGYRVMYRPSP------EGPQ----KSEWSVFEVRAPTE---------------DSAVVTQLRKGVT-YQFK------------------------VRPFFNEFQGTDSDVKIGKTL--EEAPSAPPRKVTVTESGDNGTAIIVSWQPPPEEDQNGVVQEYKIWCLGNESRYHINRTVDGSTF-SVLIPSLAPGIRYSVEVAASTGAGPGVKS 853          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Medaka
Match: robo1 (roundabout guidance receptor 1 [Source:NCBI gene;Acc:101157073])

HSP 1 Score: 200.29 bits (508), Expect = 2.409e-51
Identity = 228/883 (25.82%), Postives = 350/883 (39.64%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGT-LELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQ---IMKAGPL--SRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPL--NEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALF----PEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEY-YPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYR-----GPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTW-----SSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNT-LIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRS 2735
            P I E P       G    L+C+A+G P P + WY    + +       +NP     ++ +G L   R++        E    C A N LG AVS  AS  +A L  +F+ NPA +    +G    L C PP G P PT+ W K+G  I    + R  I           L I N  K D+GKY C   N      S  + L +     + +        +  S E +C    + V TV W +  G   +      E + L+   L  +D G Y C   +  G+ +EA   L V  P +F+  P ++ V  G  V+F C  +G P P ++W+  G   L     P   S SRF VS+ G L I++ + SD G Y+C   +   +  + A L V     +   PVI   P NQT+    T    C    +   TI W +       H+       R+K    GALQI +     D+  YTC AS  S   +  W + + V    S IQ   P  D   +   P     TE T  SVTL+W     +     +Y IE     S   W    +        ++ L P++ Y FLVR+ N  GLS  S  T+ VKT       P     + + ++Q    ++ I + +   +    V+++W +     +     +G+++ Y   P      +G Q    +  +  F+ R+  +                S V + L  GV  ++F+                        V  ++     T  D +   TL  EE PS PP+ +    S +  T +I+ +  PP    NG +    +    N+SR  +       TF  + IP+L     YS+ ++     G GV+S
Sbjct:   31 PRIVEHPSDLIVSKGEPATLNCKAEGRPTPTVEWYKDGERVETDR----DNPRSQRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSHNASLEVAILRDDFRQNPA-DVMVAAGEPAVLECQPPRGHPEPTISWKKDGVNIDD-RDERITIRG-------GKLMITNARKSDAGKYVCVGTNMVGERDSEVAELTVLERPSFVRRPGSQVVLVDQSVEFRCEARGDPVPTVRWRKDDGELPKGRYEIREDHTLKIRRLTSADVGSYTCVAENMMGK-AEASATLTVHVPPAFVVRPRNQVVGVGRTVTFQCEATGNPQPAIFWQREGSQNLLFSYQPPQPS-SRFSVSQTGDLTITDAERSDMGYYSCQALNIAGSVITKALLEVTDVVSDRPPPVIRQGPTNQTVPVDGTVDLNCMAAGNPTPTILWRKDGVLVSTHDS------RVKQLDTGALQI-RYAKLGDTGTYTCIASTPSG--EASWKSFVEVQEFGSPIQPHRP-TDPNLIPSAPSKPEVTEVTRTSVTLSWKPNLNAGATPTSYIIEAFSHASGSSWQTLAEHVKTESFVLKGLKPSAVYLFLVRAANAYGLSDPSPITDAVKT----QDIPPTSQGVDHRQIQRELGEVVIHLHNPTILSSSSVRVQWTV----EQQSQYTQGYRVMYRPSP------EGPQ----KSEWSVFEVRAPTE---------------DSAVVTQLRKGVT-YQFK------------------------VRPFFNEFQGTDSDVKIGKTL--EEAPSAPPRKVTVTESGDNGTAIIVSWQPPPEEDQNGVVQEYKIWCLGNESRYHINRTVDGSTF-SVLIPSLAPGIRYSVEVAASTGAGPGVKS 827          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Planmine SMEST
Match: SMESG000066973.1 (SMESG000066973.1)

HSP 1 Score: 2506.48 bits (6495), Expect = 0.000e+0
Identity = 1314/1322 (99.39%), Postives = 1317/1322 (99.62%), Query Frame = 3
Query:   90 MFSYLIQIVIFLNYITDTLTINAPVITEMPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRSQRIYVPARTEPPPYEQQAWFIPVIVVGTLIFWIXXXXXXXXXXXIRFQLITKSPKFKSKDCEINLEPLMKDLPNRINKSCVKSQEANNYYKSGSEALYSATSIINPNHMNTGSVTSGTCTPYAXXXXXXXXXXXXXXGTFTKFYTGSIIDELGPAPNSMLPPYLTFAPHYTPYXXXXXXXPFSMTTVPGDSXXXXXXXXXXXXXXXXXXXKEDNFGLGTSKYFNQSASGPNNWPTSMKMGISQLPXXXXXXXXXXXXNQKKYVDHKTGSMNAISCSAISPATLGSATPSPSAIVTDSGGSGPYQGNNKESKPAEESPKSTVHYDVIPNQETCDEFCEYSTPSTDSNNYEYDSGNELQKQSQTPLAVDTNTMPGNQTQGQHSPGYSTDSVTYSAVPHRPYPKSSRKKQMRQYXXXXXXX----XXXXXXXXXPVFTHKSKL 4043
            MFSYLIQIVIFLNYITDTLTINAPVITEMPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMQSIFSQIQITITSLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWN+SPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRSQRIYVPARTEPPPYEQQAWFIPVIVVGTLIFWILLCCLVVYLCCIRFQLITKSPKFKSKDCEINLEPLMKDLPNRINKSCVKSQEANNYYKSGSEALYSATSIINPNHMNTGSVTSGTCTPYASASIVDSIDNSSDIGTFTKFYTGSIIDELGPAPNSMLPPYLTFAPHYTPYSISSSIIPFSMTTVPGDSNILNASNNTNT NTQAYNNKEDNFGLGTSKYFNQSASGPNNWPTSMKMGISQLPGSSSGTSSSGTTNQKKY+DHKTGSMNAISCSAISPATLGSATPSPSAIVTDSGGSGPYQGNNKESKPAEESPKSTVHYDVIPNQETCDEFCEYSTPSTDSNNYEYDSGNELQKQSQTPLAVDTNTMPGNQTQGQHSPGYSTDSVTYSAVPHRPYPKSSRKKQMRQYNTHASTA    N+NNNNNNNPVFTHKSKL
Sbjct:    1 MFSYLIQIVIFLNYITDTLTINAPVITEMPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMQSIFSQIQITITSLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNVSPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRSQRIYVPARTEPPPYEQQAWFIPVIVVGTLIFWILLCCLVVYLCCIRFQLITKSPKFKSKDCEINLEPLMKDLPNRINKSCVKSQEANNYYKSGSEALYSATSIINPNHMNTGSVTSGTCTPYASASIVDSIDNSSDIGTFTKFYTGSIIDELGPAPNSMLPPYLTFAPHYTPYSISSSIIPFSMTTVPGDSNILNASNNTNTTNTQAYNNKEDNFGLGTSKYFNQSASGPNNWPTSMKMGISQLPGSSSGTSSSGTTNQKKYIDHKTGSMNAISCSAISPATLGSATPSPSAIVTDSGGSGPYQGNNKESKPAEESPKSTVHYDVIPNQETCDEFCEYSTPSTDSNNYEYDSGNELQKQSQTPLAVDTNTMPGNQTQGQHSPGYSTDSVTYSAVPHRPYPKSSRKKQMRQYNTHASTANSNNNNNNNNNNNPVFTHKSKL 1322          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Planmine SMEST
Match: SMESG000066973.1 (SMESG000066973.1)

HSP 1 Score: 2450.24 bits (6349), Expect = 0.000e+0
Identity = 1286/1294 (99.38%), Postives = 1289/1294 (99.61%), Query Frame = 3
Query:  174 MPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRSQRIYVPARTEPPPYEQQAWFIPVIVVGTLIFWIXXXXXXXXXXXIRFQLITKSPKFKSKDCEINLEPLMKDLPNRINKSCVKSQEANNYYKSGSEALYSATSIINPNHMNTGSVTSGTCTPYAXXXXXXXXXXXXXXGTFTKFYTGSIIDELGPAPNSMLPPYLTFAPHYTPYXXXXXXXPFSMTTVPGDSXXXXXXXXXXXXXXXXXXXKEDNFGLGTSKYFNQSASGPNNWPTSMKMGISQLPXXXXXXXXXXXXNQKKYVDHKTGSMNAISCSAISPATLGSATPSPSAIVTDSGGSGPYQGNNKESKPAEESPKSTVHYDVIPNQETCDEFCEYSTPSTDSNNYEYDSGNELQKQSQTPLAVDTNTMPGNQTQGQHSPGYSTDSVTYSAVPHRPYPKSSRKKQMRQYXXXXXXX----XXXXXXXXXPVFTHKSKL 4043
            MPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMQSIFSQIQITITSLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWN+SPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRSQRIYVPARTEPPPYEQQAWFIPVIVVGTLIFWILLCCLVVYLCCIRFQLITKSPKFKSKDCEINLEPLMKDLPNRINKSCVKSQEANNYYKSGSEALYSATSIINPNHMNTGSVTSGTCTPYASASIVDSIDNSSDIGTFTKFYTGSIIDELGPAPNSMLPPYLTFAPHYTPYSISSSIIPFSMTTVPGDSNILNASNNTNT NTQAYNNKEDNFGLGTSKYFNQSASGPNNWPTSMKMGISQLPGSSSGTSSSGTTNQKKY+DHKTGSMNAISCSAISPATLGSATPSPSAIVTDSGGSGPYQGNNKESKPAEESPKSTVHYDVIPNQETCDEFCEYSTPSTDSNNYEYDSGNELQKQSQTPLAVDTNTMPGNQTQGQHSPGYSTDSVTYSAVPHRPYPKSSRKKQMRQYNTHASTA    N+NNNNNNNPVFTHKSKL
Sbjct:    1 MPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMQSIFSQIQITITSLAPIYFGKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNVSPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRSQRIYVPARTEPPPYEQQAWFIPVIVVGTLIFWILLCCLVVYLCCIRFQLITKSPKFKSKDCEINLEPLMKDLPNRINKSCVKSQEANNYYKSGSEALYSATSIINPNHMNTGSVTSGTCTPYASASIVDSIDNSSDIGTFTKFYTGSIIDELGPAPNSMLPPYLTFAPHYTPYSISSSIIPFSMTTVPGDSNILNASNNTNTTNTQAYNNKEDNFGLGTSKYFNQSASGPNNWPTSMKMGISQLPGSSSGTSSSGTTNQKKYIDHKTGSMNAISCSAISPATLGSATPSPSAIVTDSGGSGPYQGNNKESKPAEESPKSTVHYDVIPNQETCDEFCEYSTPSTDSNNYEYDSGNELQKQSQTPLAVDTNTMPGNQTQGQHSPGYSTDSVTYSAVPHRPYPKSSRKKQMRQYNTHASTANSNNNNNNNNNNNPVFTHKSKL 1294          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Planmine SMEST
Match: SMESG000001429.1 (SMESG000001429.1)

HSP 1 Score: 410.994 bits (1055), Expect = 1.193e-121
Identity = 305/991 (30.78%), Postives = 487/991 (49.14%), Query Frame = 3
Query:   90 MFSYLIQIVI----FLNYITDTLTINAPVITEMPKSYFPRYGTLELSCRADGEPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNS----RYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKI---FSNSKYYKMQKELKYRISNSAEIQCP-------LNEVGTVHWSRLGGLNIETSRASFEGYYLRFN-----NLQMSDSGKYVCRITSKSGQPSEALINLVV------QAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPH-NEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTG----QVTYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAP--IYFGKVKLEWQIVRGDSKG--GIIIEGFKIRYTMVPLSRCLDDGNQGH-------MKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPED---ATIVKS-------------IVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRS-----QRI----------YVPARTEPPPYEQQAWFIPVIVVGTLIFWI 2834
            M+ ++I ++     FL   T+    +   IT +   YFPR G+L+L C A+G P P I+W+D  SK K L  +  ++ + +        LII+ P+ +  Y+ YCNASN   + VS    TGL+YL+  ++  P   +       V LSC  P+G P P  KWFK+ R++   S      R++ +N    N    ++I++    DSG+Y+C A N +  ++S+ S + +   FS+  +    K++  +  +  E+ C         N     + +    +   +S    E  YL  N     N++ +D G Y C +T+ S     ++ NL V      +     ++    K V+EG +V   C +        YWE P    +FP D ++ RFRV+KDG L+I N Q+SD GKYTCN H SLD +H S  L V K +L+ YPVISLP QN T+++GS    RCEV+    V I WY G +  + +    ++  PTK  L I+ +    ++N YTCEA +  + +K  WTA ++V+   S +Q      +  +L LPPV++ P    + S+ L WSS      +V YWIEYV FGS+ GW IY+K+WP   IT+ENL P++WYQFLVRS+ + G+ RASVPTEYVKT          K+ + +E            I  + P      K++L W + + +  G   I+   F + Y  V + +C+ +   G+            YCS +    + ++  I+  DF N SP            +D  F++P D     I KS             ++  +  F+CY  ++ +   + SV S    S+  L+ E  PSQPP+N++  W  +  ++ I + LP    WNG ++G  V++ +N S  +L   KFND+ +   I  ++ + S+ + +S+ NC GE  +S      RI           V   ++     ++ W I  +VV +++ W+
Sbjct:    1 MWYFVILVIFYQQGFLKTWTNASFFHTIRITRLSDDYFPRSGSLKLICVAEGNPMPTITWHD--SKTKSL--MQYDDAMDLKTDSEQGLLIISNPQPKITYEFYCNASNDKTWIVSKSVKTGLSYLSPTYKIQPESIQILKEFQSVILSCQLPDGNPPPKTKWFKDQRELLKYSIQDDPKRFIFSNNEHGN--CSMQIKHLKLSDSGEYHCLANNEYFHLKSSASWVLVMNSFSDLIFDISIKQISQKTGDDVEMLCDPNNNNNNNNNNNNNNNNNNDNIKWISSIGHIENKYLYSNKLYKQNIKFNDRGIYAC-VTNHSNPKLVSIFNLTVSYSDVNEEKVKILK----KVVIEGVNVMLECDLENTK-AGYYWETPQSLPIFPNDFNHPRFRVTKDGFLNILNAQSSDTGKYTCNVHDSLDVKHKSVWLEVSKTQLDTYPVISLPAQNLTVLQGSDINLRCEVIGDDIVKIIWYSGLNIKDRIVKDWQVSFPTKENLLIVTVQSKKNTNFYTCEA-INEHGLKATWTAYVKVVTSLSDVQSF----NFNELPLPPVVEIPKNIKSTSLDLIWSSNNNPDLKVLYWIEYVHFGSKNGWEIYRKNWPHNFITIENLKPDTWYQFLVRSKTNIGIGRASVPTEYVKT----------KNFMSDEPYSGNVGFQFTKIKLIEPEITKDHKIQLRWYLNKEEETGFKSILYTQFYLNYRSVSILKCIVEKFNGNPYDSTVVPALNNYCSLKSMDTETLK--II--DF-NFSPN-----------IDKDFQVPIDFQKINITKSSHFPGNSYAQVSWLIPNVTFFNCYNISIFSKSVHNSVVSN---SKMILVPETRPSQPPENVQVSW-LSEESMNIKWDLPDRQFWNGIITGSNVYLKSNKSEIVL---KFNDSTQNKVISQVNSKLSWLIRISIKNCVGESGKSTPVVLHRISEDLQLNSDSLVIENSQKINLFKKTWMIATLVVTSILVWL 941          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Planmine SMEST
Match: SMESG000064665.1 (SMESG000064665.1)

HSP 1 Score: 231.106 bits (588), Expect = 1.304e-61
Identity = 242/889 (27.22%), Postives = 406/889 (45.67%), Query Frame = 3
Query:  159 PVITEMPKSYFPRYGTL--ELSCRADG-EPAPDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNEVGT----VHWSRLG-GLN-IETSRASFEG-YYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHN--EPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADS-VTLTWS-STGQVTYWIEYVRFGSREGWVIYKKDWPDTKIT------VENLSPNSWYQFLVRSRNHKGLSRASVPTEYVKTLSRENSRPTLKSDIKNEEMXXXXXXXXXXXXXLAPIYFGKVKLEWQIVRGDSKGGII---IEGFKIRYTMVPLSRCLDDGNQGHMKRKRYCSFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIVKSIVTGLNPFSCYEFTVEAYYENPS---VTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSL----LGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRS 2735
            P IT+ P      YG L  ++S R D  +P+  +SW    S   I+N              PL  +I   P+ +  Y+  CN SNS G+ +S  ++  +AYL+   +SN +  K       V L C  P+G P P ++W  N     S +N R+       L+  + L+I N  + D+G Y+C+A+N   T  S+   L +F    ++ + K L+  +S  + I  P   +G     + W +LG G N I  SR +      +  NN+++ DSG YVCR    SG  +E +  L V +  SFI+TP++     G+ V+  C  SG P P+V+W       L   D + +R  V ++G+L IS+ ++ D+GKY C   S +    S A LFV   +  + P+IS  PQN T IEGS     C+V      +I WY+        + +  R+++   G L+I  +    DS  YTC  + +S  + T  +A L ++   S I     +  +  + + P  +   E   D+ + + W  S    T W    R    E +V    +W +  +T      + NL P++ Y  +VRS  +K +    V  + + T+      PT+ +DI   E      +I++    L  I   +V+L W++     KG  I   I GF I+   V + RCL    + +  +  +   +     +I   +   D    +  S +Q ++       K  +  D     +I+ GL PF CYE  +E + ++ +   ++ RDS+++  L ++++P+ PP+     W+ N  T  I +    +   NG ++G  + I     +++    + +   + TF KIE P       Y L+LS  +CRG+G RS
Sbjct:   13 PKITQSPSDI---YGLLNQQVSLRCDSNDPSDKVSWIKDNS---IINS----------NTNPL--IIQLNPDIEGFYQ--CNISNSYGFTLSEKSAVRIAYLHNFLESNNS-RKFVSPSTTVLLQCLEPDGLPKPKIEWKSN----LSINNPRF------KLDSNNNLRIDNIQRSDAGLYWCEAKNLAFTRTSSYIELIVFQKPIFHILPKHLQVMVS--SHILFPCLVIGDSPMFIQWYKLGSGKNDISLSRTALSNNCSMIINNVKLEDSGAYVCR-ARNSGGITEIIYKLSVISFPSFIETPENIRTTVGEKVALRCSASGVPAPKVFWWHTNQYFLSDIDNN-NRIIVFENGTLSISSVRSKDSGKYYCYASSFVGVSRSEATLFVDAPKGMFPPIISKVPQNITTIEGSNVILTCQVFGSF-TSINWYKLSLKIVGNIPSSNRLELLKNGDLKITNVKIK-DSAAYTCRITNRS--LYTEKSADL-IVKSYSEINTEYSIGKKDDIPMAP-RNISVEFIGDTYILIKWEYSIEDPTVWF---RVEIAEQYV---SNWTEIAMTKHRNYLINNLKPDTGYMVIVRSIRNKVIGDLFVYPDIIYTI----DTPTVAADIPFGEFHKALQEIEVFSVKLNTISARQVQLSWKV-----KGNSILPSISGFIIKAEPVSIKRCLLMTEKPN--QPMFTCLESEDSYNIDELVSGYDDILATDQSKIQKSI------IKRSINRDRPRSSAIIGGLKPFRCYEIEIETFIDHINAGRISGRDSKTKTVLTYDDLPNNPPKIKSYRWTDN-TTFYISWEKMDSRYSNGPITGYIIQIINTKKKTIQTFKIPTNVLHYTF-KIESPEF----RYMLYLSADSCRGQGPRS 831          
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Planmine SMEST
Match: SMESG000018028.1 (SMESG000018028.1)

HSP 1 Score: 214.542 bits (545), Expect = 2.363e-59
Identity = 169/537 (31.47%), Postives = 261/537 (48.60%), Query Frame = 3
Query:   93 FSYLIQIVIFLNYITDTLTINAPVITEMPKS-YFPRYGTLELSCRADGEPAPDISWY-DLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVYCNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPEGRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGKYYCQAENAFSTVRSATSNLKIFSNSKYYKMQ-KELKYRISNSAEIQCPLN--EVGTVHWSRLGGLNIETSRASF-EGYYLRFNNLQMSDSGKYVCRITSKSGQPSEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPGISALFPEDTSY--SRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSANLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGPHNEPLQAGGRIKIPTKGALQI--LKIDPNLDSNIYTCEASLKSNLMKTRWTALLRVIYP-DSGIQVMTPLNDETQLSLPP 1670
            F   + ++  LNY         P+I+E P S +      + L C A G+P P+I WY D Q  +   +    +N  +++K    + L+    + Q E   YCNASN  G+ +S  AS  +A+LN++     +  K A  G  V + C PP+G P PTV W  NG  I    N R  I +  +L      +I    ++DSG+Y C A+N F+  R +TS L        +K+    ++ +++ +A   C  +     T+ W R     I +SRA+  +   ++ + +Q++D G Y+C  ++ +G   EA   L V +   FI+TPD++ V  GD   F C V+G P P + W   G   +  E+ S    R +V K GSL I+  + SD+GKY C   S +    SSA+L V   +    PVI + PQNQTL  G TATF C+     DVT+ W +  H   L +  RI   T G L+I  L++    D+  YTC+  +  N   T W+  L+++   D    +M  ++D   L   P
Sbjct:    8 FILCVIVLANLNYCES----QKPIISEHPASTHGLSLQRVSLRCSAKGDPMPNIIWYKDGQVVESYRDKPATSN--RLVKD---NELLFMHLDTQDEGVYYCNASNIHGWTISNNASVLIAFLNKDIIGPES--KTASVGETVLMECKPPKGVPKPTVIWKFNGNAI--EVNKRIKILDNGNL------RIDKATRKDSGRYNCLAKN-FADERDSTSALLTVRQKPQFKIAPSNIEVKVNEAAVFPCVADGDPKPTIVWRRDNQKKIPSSRATLIDNKGMQISKVQLTDMGNYICHASNSAGH-LEAYAKLSVVSTPGFIETPDNQKVRVGDTAIFNCRVTGSPQPTIIWSHNGDHFIADEENSRRSERIQVDKLGSLTINPVKISDSGKYECKASSYIGKIQSSASLHVIDAQKYVPPVIEVGPQNQTLRIGLTATFNCQPKQQDDVTVHWLKNGHQLNLVSDPRIITLTTGKLKINLLRMS---DAGNYTCK--IVQNEAFTLWSVTLKILDKNDYETAIMQTIDDARMLPSAP 518          
The following BLAST results are available for this feature:
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ROBO28.141e-4929.58roundabout guidance receptor 2 [Source:HGNC Symbol... [more]
ROBO28.226e-4929.58roundabout guidance receptor 2 [Source:HGNC Symbol... [more]
ROBO28.349e-4929.58roundabout guidance receptor 2 [Source:HGNC Symbol... [more]
ROBO14.537e-4829.42roundabout guidance receptor 1 [Source:HGNC Symbol... [more]
ROBO21.714e-4729.38roundabout guidance receptor 2 [Source:HGNC Symbol... [more]
back to top
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sax-36.988e-4427.73pep chromosome:WBcel235:X:3451945:3465925:-1 gene:... [more]
sax-31.104e-4327.73pep chromosome:WBcel235:X:3451945:3465925:-1 gene:... [more]
him-41.146e-2025.00High Incidence of Males (Increased X chromosome lo... [more]
him-41.206e-2025.00High Incidence of Males (Increased X chromosome lo... [more]
him-41.392e-2025.00High Incidence of Males (Increased X chromosome lo... [more]
back to top
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
robo13.712e-7026.19gene:FBgn0005631 transcript:FBtr0071922[more]
robo13.712e-7026.19gene:FBgn0005631 transcript:FBtr0343013[more]
robo32.303e-5228.50gene:FBgn0041097 transcript:FBtr0077921[more]
robo32.303e-5228.50gene:FBgn0041097 transcript:FBtr0335384[more]
robo24.873e-5125.06gene:FBgn0002543 transcript:FBtr0077941[more]
back to top
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
robo31.175e-5226.59roundabout, axon guidance receptor, homolog 3 (Dro... [more]
robo31.184e-5226.59roundabout, axon guidance receptor, homolog 3 (Dro... [more]
robo31.564e-5226.58roundabout, axon guidance receptor, homolog 3 (Dro... [more]
robo17.475e-4824.38roundabout, axon guidance receptor, homolog 1 (Dro... [more]
robo25.224e-4225.91roundabout, axon guidance receptor, homolog 2 (Dro... [more]
back to top
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc8c3.031e-5130.31leucine rich repeat containing 8 VRAC subunit C [S... [more]
lrrc8c7.015e-5130.31leucine rich repeat containing 8 VRAC subunit C [S... [more]
lrrc8c8.070e-5130.31leucine rich repeat containing 8 VRAC subunit C [S... [more]
lrrc8c9.294e-5130.31leucine rich repeat containing 8 VRAC subunit C [S... [more]
lrrc8c9.550e-5130.31leucine rich repeat containing 8 VRAC subunit C [S... [more]
back to top
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Robo13.949e-4929.42roundabout guidance receptor 1 [Source:MGI Symbol;... [more]
Robo14.798e-4929.49roundabout guidance receptor 1 [Source:MGI Symbol;... [more]
Robo21.507e-4829.61roundabout guidance receptor 2 [Source:MGI Symbol;... [more]
Robo22.443e-4829.61roundabout guidance receptor 2 [Source:MGI Symbol;... [more]
Robo22.550e-4729.41roundabout guidance receptor 2 [Source:MGI Symbol;... [more]
back to top
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O89026|ROBO1_MOUSE2.624e-4829.49Roundabout homolog 1 OS=Mus musculus OX=10090 GN=R... [more]
sp|Q9HCK4|ROBO2_HUMAN3.910e-4829.58Roundabout homolog 2 OS=Homo sapiens OX=9606 GN=RO... [more]
sp|O55005|ROBO1_RAT1.659e-4729.09Roundabout homolog 1 OS=Rattus norvegicus OX=10116... [more]
sp|Q9Y6N7|ROBO1_HUMAN2.179e-4729.42Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=RO... [more]
sp|Q7TPD3|ROBO2_MOUSE8.921e-4629.41Roundabout homolog 2 OS=Mus musculus OX=10090 GN=R... [more]
back to top
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4P2K69.505e-10528.72Roundabout, axon guidance receptor 2 OS=Paragonimu... [more]
A0A2H1CX773.146e-9728.88Immunoglobulin I-set domain protein OS=Fasciola he... [more]
A0A504YZE71.107e-9628.54Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A4S2LAA11.002e-9328.51Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A3R7GRP41.139e-9328.01Roundabout-like protein 1 OS=Clonorchis sinensis O... [more]
back to top
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000001796.27.164e-5224.94pep primary_assembly:Astyanax_mexicanus-2.0:20:237... [more]
robo11.286e-5124.92roundabout, axon guidance receptor, homolog 1 (Dro... [more]
robo11.464e-5124.92roundabout, axon guidance receptor, homolog 1 (Dro... [more]
robo11.843e-5124.94roundabout, axon guidance receptor, homolog 1 (Dro... [more]
robo22.449e-5125.84roundabout, axon guidance receptor, homolog 2 (Dro... [more]
back to top
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010567.12.364e-5629.67pep scaffold:Pmarinus_7.0:GL479154:561817:685780:1... [more]
neo1b5.374e-2427.27neogenin 1b [Source:ZFIN;Acc:ZDB-GENE-131121-320][more]
ENSPMAT00000002502.12.424e-2326.01pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-... [more]
cntn3b1.825e-2125.60contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645][more]
ENSPMAT00000008186.11.410e-2025.33pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 ... [more]
back to top
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO453831.179e-2223.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495534.001e-2125.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495582.007e-2028.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495544.044e-2024.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409962.305e-1627.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
robo14.429e-5526.02roundabout guidance receptor 1 [Source:NCBI gene;A... [more]
ENSORLT00000012598.22.901e-5325.17roundabout homolog 1 [Source:NCBI gene;Acc:1011566... [more]
robo23.343e-5329.19roundabout guidance receptor 2 [Source:NCBI gene;A... [more]
robo12.232e-5125.82roundabout guidance receptor 1 [Source:NCBI gene;A... [more]
robo12.409e-5125.82roundabout guidance receptor 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Roundabout, axon guidance receptor, homolog 1 (Drosophila) vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066973.10.000e+099.39SMESG000066973.1[more]
SMESG000066973.10.000e+099.38SMESG000066973.1[more]
SMESG000001429.11.193e-12130.78SMESG000001429.1[more]
SMESG000064665.11.304e-6127.22SMESG000064665.1[more]
SMESG000018028.12.363e-5931.47SMESG000018028.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025239 ID=SMED30025239|Name=Roundabout, axon guidance receptor, homolog 1 (Drosophila)|organism=Schmidtea mediterranea sexual|type=transcript|length=4177bp
GAAATATTTTTAGTAATTTATGAACTCCTAACTATTTTCTTTTTCTTAAT
GAACATTATTTTCTAACAAATAATTTCAGATCTCAATCAATGTTTTCGTA
TCTCATTCAGATTGTAATATTTTTAAATTATATTACTGACACGTTGACAA
TCAACGCGCCTGTGATTACTGAAATGCCGAAAAGTTATTTTCCCAGATAT
GGAACTCTGGAATTATCTTGCCGAGCTGATGGAGAACCAGCTCCCGACAT
ATCCTGGTATGATTTGCAATCAAAACAGAAAATTCTTAACGGAATCGGAA
TAAATAACCCGGTGCAAATAATGAAAGCAGGTCCACTCAGTAGATTAATT
ATTACCGAACCTGAAGCTCAACATGAATACAAAGTCTATTGTAACGCATC
TAATAGTCTTGGTTACGCAGTGAGTCCGCCAGCTTCCACAGGTCTTGCCT
ATCTGAATCGAAATTTCCAATCAAATCCCGCAATAGAAAAGGAAGCCTAT
TCCGGAAACGATGTCGAATTGTCATGTTCGCCTCCGGAAGGCCGACCGTA
TCCGACAGTAAAGTGGTTTAAAAACGGCCGACAAATCACATCGGCATCGA
ATTCTCGATATTTAATCACAAATCAACCCGATCTCAATCAGTATTCTATT
TTGAAAATTCGCAACCCCAATAAAGAGGATTCCGGAAAATATTACTGTCA
AGCTGAAAATGCATTTTCAACTGTTCGTTCAGCTACCTCAAATTTGAAAA
TCTTTTCCAATTCAAAATACTACAAAATGCAAAAGGAGTTAAAATACCGA
ATCTCCAACAGTGCCGAAATCCAATGTCCACTAAATGAAGTTGGTACCGT
TCATTGGAGTCGACTTGGTGGACTAAATATTGAGACCAGTAGAGCAAGCT
TTGAAGGTTATTATTTACGATTTAATAACTTACAAATGAGCGATTCCGGG
AAATATGTCTGTCGGATCACCTCAAAATCTGGTCAACCATCAGAAGCTCT
TATAAATTTAGTTGTCCAAGCTCCAGCGTCATTTATTCAGACTCCTGATG
ATAAAACGGTTTTGGAAGGCGATGATGTTAGTTTCACGTGCATCGTTTCT
GGCTTTCCTCTTCCTCAAGTATATTGGGAATTACCCGGCATCAGTGCATT
GTTTCCAGAAGACACGAGCTATTCCCGGTTCAGAGTCAGCAAGGACGGAA
GTCTCCACATAAGTAATACTCAAACCAGTGATGCTGGTAAATACACTTGC
AACTGTCATTCTTCTCTTGACGCCAGACATTCATCCGCTAACCTCTTTGT
AAAGAAACGGGAACTTGAATACTATCCGGTTATTTCTTTACCGCCACAAA
ATCAAACTCTTATCGAAGGCTCAACAGCGACATTTCGTTGTGAAGTGGTT
TCCCATATGGATGTAACTATAACATGGTATCGGGGGCCTCACAATGAACC
CTTGCAAGCTGGCGGTAGAATCAAAATACCTACAAAAGGAGCACTTCAGA
TTTTGAAAATCGACCCGAATCTCGATTCAAATATTTACACTTGTGAAGCG
TCTTTAAAATCCAATTTAATGAAGACTCGATGGACGGCCTTGTTGAGGGT
GATTTATCCTGACTCTGGTATTCAGGTCATGACACCACTTAACGATGAAA
CCCAGCTTTCTCTTCCGCCAGTATTAGATCCTCCGACTGAGAAAACTGCT
GATTCGGTAACTCTCACTTGGTCCAGTACAGGCCAAGTGACTTATTGGAT
TGAATATGTTCGTTTTGGTTCTCGTGAGGGATGGGTTATTTACAAGAAAG
ATTGGCCCGATACGAAAATAACTGTGGAAAACCTCTCTCCGAATTCATGG
TATCAATTTCTGGTCCGTTCACGAAATCATAAAGGTCTCAGTAGAGCTAG
CGTTCCGACAGAATACGTCAAAACGCTCAGCAGAGAAAACAGCCGGCCAA
CATTGAAATCTGACATTAAGAACGAAGAAATGCAGTCCATTTTCTCTCAG
ATTCAAATAACAATTACAAGTTTGGCGCCGATTTATTTCGGTAAAGTGAA
ATTGGAATGGCAAATAGTAAGGGGTGACTCGAAAGGTGGTATTATAATTG
AAGGGTTTAAAATACGATACACAATGGTGCCATTGTCCCGGTGCTTGGAT
GACGGAAATCAAGGTCATATGAAACGGAAACGGTATTGTAGTTTCCAAGG
TCGCAGTCTAGATGATATTCGCAATTGGATTTTGCAAAGTGATTTCTGGA
ACATCTCTCCGGCGTCAAATGTCCAATCAAATCTCACATCTGGAGTTGTG
GATTTCAAATTCCGACTGCCGGAAGATGCGACTATTGTCAAAAGTATTGT
AACTGGACTGAACCCGTTTTCTTGTTATGAATTTACCGTTGAAGCCTATT
ACGAAAATCCGTCTGTCACAAGTCGGGACAGTCAATCACAAAACACTTTG
CTGTTTGAAGAAATACCTTCTCAACCTCCACAGAATATTCGACCGTTCTG
GTCAAAGAATAGAAATACTCTCATCATTCACTATATTCTACCACCTAATC
ACACTTGGAATGGTTTCCTAAGTGGAATTTATGTACATATCTTTGCCAAT
GATTCTAGGAGTCTTTTAGGTAGCATGAAATTCAATGATACATTCAAAAA
AATCGAGATTCCAAACTTGGATGACAGAAAAAGCTATTCTTTGCACTTAT
CTGTGTTTAATTGTCGAGGTGAAGGAGTAAGAAGTCAAAGAATCTATGTT
CCTGCTCGAACCGAACCTCCGCCTTATGAACAGCAAGCTTGGTTTATCCC
AGTCATTGTTGTCGGTACACTGATATTTTGGATTCTTTTATGCTGTCTTG
TCGTTTACCTGTGTTGTATTCGATTTCAGCTAATAACTAAAAGCCCCAAA
TTCAAATCAAAGGACTGTGAAATCAATCTAGAACCTCTGATGAAAGACTT
ACCAAACCGCATAAATAAATCGTGTGTGAAATCTCAAGAAGCCAATAATT
ACTATAAATCCGGATCTGAAGCTTTATATAGCGCGACTTCAATCATCAAC
CCAAATCATATGAACACCGGCAGTGTGACATCGGGCACTTGCACTCCATA
CGCATCGGCATCGATAGTCGACTCGATTGACAATTCAAGTGACATTGGCA
CTTTCACCAAATTCTATACCGGTTCGATTATCGATGAGCTCGGTCCGGCA
CCTAATTCTATGCTACCTCCGTATTTAACATTTGCTCCACACTATACTCC
ATATTCAATTTCATCATCAATCATACCTTTCTCAATGACAACTGTCCCTG
GTGACAGCAATATCCTGAATGCATCAAACAATACCAATACTGCCAATACT
CAGGCCTACAATAACAAGGAGGACAATTTCGGATTGGGCACAAGCAAGTA
TTTCAACCAGTCGGCGAGTGGTCCCAACAATTGGCCAACCTCAATGAAAA
TGGGAATCAGTCAACTGCCCGGCTCCTCTAGTGGAACATCTTCTTCTGGT
ACAACGAATCAAAAGAAATATGTCGATCACAAAACCGGCTCAATGAATGC
AATCAGCTGTTCTGCCATTTCACCGGCAACTCTCGGTTCAGCCACTCCGT
CCCCATCGGCGATTGTAACAGATTCTGGAGGATCTGGACCATATCAAGGC
AACAATAAAGAATCAAAACCCGCTGAAGAATCTCCGAAATCTACTGTCCA
CTATGATGTAATACCGAATCAAGAGACTTGTGATGAGTTCTGTGAGTATT
CAACACCGAGCACTGACAGCAATAATTACGAATATGATTCTGGAAATGAA
TTACAAAAGCAATCTCAAACTCCCCTCGCTGTCGACACAAACACAATGCC
CGGAAACCAAACCCAAGGCCAACACAGCCCTGGATACAGTACGGACAGTG
TGACGTATTCTGCAGTGCCCCATAGACCATATCCTAAATCTAGCCGGAAA
AAACAAATGCGCCAATATAACACACACGCATCAACGGCAAATAGCAATAA
TAATAATAATAATAATCCTGTATTTACACATAAATCAAAATTGTGATGTA
ATCTGTCATTTCTAGAACAATTAACGCATCTGTAACGCGCAACACATGTT
AAAATGCATTTGACTTTATCAATTTGTACATAGATATCAGAGAATGGACC
GTTCTCAACTAGACATCCTGTAGTCTT
back to top

protein sequence of SMED30025239-orf-1

>SMED30025239-orf-1 ID=SMED30025239-orf-1|Name=SMED30025239-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1319bp
MFSYLIQIVIFLNYITDTLTINAPVITEMPKSYFPRYGTLELSCRADGEP
APDISWYDLQSKQKILNGIGINNPVQIMKAGPLSRLIITEPEAQHEYKVY
CNASNSLGYAVSPPASTGLAYLNRNFQSNPAIEKEAYSGNDVELSCSPPE
GRPYPTVKWFKNGRQITSASNSRYLITNQPDLNQYSILKIRNPNKEDSGK
YYCQAENAFSTVRSATSNLKIFSNSKYYKMQKELKYRISNSAEIQCPLNE
VGTVHWSRLGGLNIETSRASFEGYYLRFNNLQMSDSGKYVCRITSKSGQP
SEALINLVVQAPASFIQTPDDKTVLEGDDVSFTCIVSGFPLPQVYWELPG
ISALFPEDTSYSRFRVSKDGSLHISNTQTSDAGKYTCNCHSSLDARHSSA
NLFVKKRELEYYPVISLPPQNQTLIEGSTATFRCEVVSHMDVTITWYRGP
HNEPLQAGGRIKIPTKGALQILKIDPNLDSNIYTCEASLKSNLMKTRWTA
LLRVIYPDSGIQVMTPLNDETQLSLPPVLDPPTEKTADSVTLTWSSTGQV
TYWIEYVRFGSREGWVIYKKDWPDTKITVENLSPNSWYQFLVRSRNHKGL
SRASVPTEYVKTLSRENSRPTLKSDIKNEEMQSIFSQIQITITSLAPIYF
GKVKLEWQIVRGDSKGGIIIEGFKIRYTMVPLSRCLDDGNQGHMKRKRYC
SFQGRSLDDIRNWILQSDFWNISPASNVQSNLTSGVVDFKFRLPEDATIV
KSIVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNI
RPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFND
TFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRSQRIYVPARTEPPPYEQQA
WFIPVIVVGTLIFWILLCCLVVYLCCIRFQLITKSPKFKSKDCEINLEPL
MKDLPNRINKSCVKSQEANNYYKSGSEALYSATSIINPNHMNTGSVTSGT
CTPYASASIVDSIDNSSDIGTFTKFYTGSIIDELGPAPNSMLPPYLTFAP
HYTPYSISSSIIPFSMTTVPGDSNILNASNNTNTANTQAYNNKEDNFGLG
TSKYFNQSASGPNNWPTSMKMGISQLPGSSSGTSSSGTTNQKKYVDHKTG
SMNAISCSAISPATLGSATPSPSAIVTDSGGSGPYQGNNKESKPAEESPK
STVHYDVIPNQETCDEFCEYSTPSTDSNNYEYDSGNELQKQSQTPLAVDT
NTMPGNQTQGQHSPGYSTDSVTYSAVPHRPYPKSSRKKQMRQYNTHASTA
NSNNNNNNNPVFTHKSKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008046axon guidance receptor activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0016199axon midline choice point recognition
GO:0007411axon guidance
GO:0035385Roundabout signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR036116FN3_sf
IPR003598Ig_sub2
IPR013106Ig_V-set
IPR003599Ig_sub
IPR003961FN3_dom
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR007110Ig-like_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030424axon
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1325..1325
NoneNo IPR availablePFAMPF13927Ig_3coord: 416..491
e-value: 3.6E-9
score: 37.1
coord: 136..210
e-value: 1.4E-13
score: 51.2
coord: 27..108
e-value: 2.5E-8
score: 34.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1185..1206
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1259..1277
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1259..1325
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1294..1325
NoneNo IPR availablePANTHERPTHR12231:SF246ROUNDABOUT 1, ISOFORM Acoord: 41..261
coord: 104..804
NoneNo IPR availablePANTHERPTHR12231CTX-RELATED TYPE I TRANSMEMBRANE PROTEINcoord: 41..261
coord: 104..804
NoneNo IPR availableCDDcd00096Igcoord: 245..302
e-value: 4.78213E-4
score: 37.9921
NoneNo IPR availableCDDcd00096Igcoord: 333..404
e-value: 7.01302E-13
score: 63.03
NoneNo IPR availableCDDcd00096Igcoord: 433..491
e-value: 2.20899E-5
score: 41.8441
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.523
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 905..927
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 725..781
e-value: 33.0
score: 6.9
coord: 527..604
e-value: 1.2E-6
score: 38.1
coord: 796..882
e-value: 93.0
score: 3.1
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 529..618
score: 15.953
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 799..897
score: 11.874
IPR003961Fibronectin type IIICDDcd00063FN3coord: 536..613
e-value: 3.11691E-10
score: 55.9655
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 38..111
e-value: 0.97
score: 7.3
coord: 428..495
e-value: 2.0E-4
score: 30.7
coord: 140..213
e-value: 1.3E-10
score: 51.3
coord: 240..301
e-value: 3.2E-7
score: 40.0
coord: 328..397
e-value: 2.8E-9
score: 46.8
IPR013106Immunoglobulin V-set domainSMARTSM00406igv1_8coord: 42..208
e-value: 0.1
score: 14.5
coord: 332..392
e-value: 0.23
score: 11.1
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 32..123
e-value: 12.0
score: 10.6
coord: 234..313
e-value: 3.4E-8
score: 43.2
coord: 422..508
e-value: 2.2E-6
score: 37.2
coord: 134..225
e-value: 4.3E-9
score: 46.2
coord: 322..408
e-value: 1.0E-12
score: 58.2
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 317..407
e-value: 1.9E-14
score: 53.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 16..115
e-value: 3.5E-9
score: 38.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 793..904
e-value: 1.8E-7
score: 33.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 230..316
e-value: 5.5E-9
score: 37.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 524..621
e-value: 5.2E-12
score: 47.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 317..413
e-value: 2.5E-21
score: 77.6
coord: 414..509
e-value: 6.4E-13
score: 50.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 124..229
e-value: 9.2E-19
score: 69.4
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 416..491
score: 10.626
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 256..309
score: 6.869
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 315..406
score: 12.84
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 27..115
score: 8.393
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 117..223
score: 12.786
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 27..116
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 307..408
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 234..315
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 418..510
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 138..218
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 529..617
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 672..892