Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30025235
Length (bp)959
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30025235) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30025235) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30025235) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30025235) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025235

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025235SMESG000017403.1 SmedASXL_004589SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30025235SMESG000017403.1 dd_Smed_v4_31445_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025235SMESG000017403.1 dd_Smed_v6_31445_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: CD22 (CD22 molecule [Source:HGNC Symbol;Acc:HGNC:1643])

HSP 1 Score: 49.2914 bits (116), Expect = 6.218e-6
Identity = 41/176 (23.30%), Postives = 73/176 (41.48%), Query Frame = 3
Query:  228 VKEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYVTNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINS--GVLLEKFFYLEVIKNQLKNHIQNDHNSPHYLSGMDNTSADIILTGNTNAMEGLEIKLKCSAVMKSPIPVTSSIAWYFNGQLQQTQITNMPHIFITMQW 749
            V+EG  + M CEV + N E   +SW ++ T  +                 K N +TLN+ +V    +GKY CQ+++  G    +  +L+V      + +Q  H+                      A+EG +++  C ++     P+ ++  WY NG+  Q +     HI   + W
Sbjct:   83 VREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLK-----------------KQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSP---------------------AVEGSQVEFLCMSLAN---PLPTNYTWYHNGKEMQGRTEEKVHIPKILPW 217          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: CD22 (CD22 molecule [Source:HGNC Symbol;Acc:HGNC:1643])

HSP 1 Score: 49.2914 bits (116), Expect = 7.423e-6
Identity = 41/176 (23.30%), Postives = 73/176 (41.48%), Query Frame = 3
Query:  228 VKEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYVTNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINS--GVLLEKFFYLEVIKNQLKNHIQNDHNSPHYLSGMDNTSADIILTGNTNAMEGLEIKLKCSAVMKSPIPVTSSIAWYFNGQLQQTQITNMPHIFITMQW 749
            V+EG  + M CEV + N E   +SW ++ T  +                 K N +TLN+ +V    +GKY CQ+++  G    +  +L+V      + +Q  H+                      A+EG +++  C ++     P+ ++  WY NG+  Q +     HI   + W
Sbjct:  255 VREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLK-----------------KQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSP---------------------AVEGSQVEFLCMSLAN---PLPTNYTWYHNGKEMQGRTEEKVHIPKILPW 389          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: CD22 (CD22 molecule [Source:HGNC Symbol;Acc:HGNC:1643])

HSP 1 Score: 48.9062 bits (115), Expect = 7.937e-6
Identity = 43/176 (24.43%), Postives = 74/176 (42.05%), Query Frame = 3
Query:  228 VKEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYVTNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINS--GVLLEKFFYLEVIKNQLKNHIQNDHNSPHYLSGMDNTSADIILTGNTNAMEGLEIKLKCSAVMKSPIPVTSSIAWYFNGQLQQTQITNMPHIFITMQW 749
            V+EG  + M CEV + N E   +SW ++ T  +                 K N +TLN+ +V    +GKY CQ+++  G    +  +L+V      + +Q  H SP                    A+EG +++  C ++     P+ ++  WY NG+  Q +     HI   + W
Sbjct:  255 VREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLK-----------------KQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILH-SP--------------------AVEGSQVEFLCMSLAN---PLPTNYTWYHNGKEMQGRTEEKVHIPKILPW 389          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: DIP-beta (gene:FBgn0259245 transcript:FBtr0343091)

HSP 1 Score: 56.225 bits (134), Expect = 1.718e-8
Identity = 31/91 (34.07%), Postives = 51/91 (56.04%), Query Frame = 3
Query:  228 VKEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYV--TNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINSGVLLEKFFYLEVI 494
            + +G D    C V+N+   R+  +W + +  A +++  +V   NDR  V  +  N WTLNI  V+  DAGKY+CQ+N+  +  +   LEV+
Sbjct:   99 IAQGRDATFTCVVNNLGGHRV--AWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVV 187          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: dpr5 (gene:FBgn0037908 transcript:FBtr0082395)

HSP 1 Score: 53.5286 bits (127), Expect = 7.503e-8
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  144 GKEFSNLTDCNSTTLKPCFDAHTKTYFKVKEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYV-TNDRYKVMK--SKSNIWTLNIPKVQTFDAGKYICQINSGVLLEKFFYLEVIKNQLK 509
             +E SNL   N   + P FD  T        GT   + C V ++      +SW R+  L  +++G+   TND+  + +    S+ W L I  VQ  DAG Y CQ+++   +   + L V+ ++ +
Sbjct:   36 AEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDR--AVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQ 158          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: DIP-beta (gene:FBgn0259245 transcript:FBtr0299901)

HSP 1 Score: 54.299 bits (129), Expect = 7.618e-8
Identity = 31/100 (31.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  228 VKEGTDLNMDCEVHNINIERIP---------ISWWRENTLAEISLGVYV--TNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINSGVLLEKFFYLEVI 494
            + +G D    C V+N+   R+          ++W + +  A +++  +V   NDR  V  +  N WTLNI  V+  DAGKY+CQ+N+  +  +   LEV+
Sbjct:  109 IAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVV 208          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: DIP-beta (gene:FBgn0259245 transcript:FBtr0299898)

HSP 1 Score: 54.299 bits (129), Expect = 7.618e-8
Identity = 31/100 (31.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  228 VKEGTDLNMDCEVHNINIERIP---------ISWWRENTLAEISLGVYV--TNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINSGVLLEKFFYLEVI 494
            + +G D    C V+N+   R+          ++W + +  A +++  +V   NDR  V  +  N WTLNI  V+  DAGKY+CQ+N+  +  +   LEV+
Sbjct:  109 IAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVV 208          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: dpr5 (gene:FBgn0037908 transcript:FBtr0082394)

HSP 1 Score: 53.5286 bits (127), Expect = 8.118e-8
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  144 GKEFSNLTDCNSTTLKPCFDAHTKTYFKVKEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYV-TNDRYKVMK--SKSNIWTLNIPKVQTFDAGKYICQINSGVLLEKFFYLEVIKNQLK 509
             +E SNL   N   + P FD  T        GT   + C V ++      +SW R+  L  +++G+   TND+  + +    S+ W L I  VQ  DAG Y CQ+++   +   + L V+ ++ +
Sbjct:   74 AEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDR--AVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQ 196          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A3P6NT65 (Ig-like domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS78 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.765e-21
Identity = 47/109 (43.12%), Postives = 65/109 (59.63%), Query Frame = 3
Query:  189 KPCFDAHTKTYFKVKEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYVTNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINSGVLLEKFFYLEVIKNQLKNH 515
            +PCF+A   T F ++E   + + C +HN++ + + ISWW+E  + EIS+G    N RY + +S  N W L I  V   D G YICQIN  VL EKFF L VI  +L N+
Sbjct:   46 EPCFNASYPTEFSIEEQESVTLPCYIHNVDFDSVVISWWKEGEIREISVGESTINSRYSIYRSSPNAWALRITNVTMNDTGVYICQINLKVLREKFFKLMVI-GKLSNY 153          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A4S2LAC7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009099 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 9.859e-20
Identity = 59/193 (30.57%), Postives = 90/193 (46.63%), Query Frame = 3
Query:  189 KPCFDAHTKTYFKVKEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYVTNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINSGVLLEKFFYLEVI--------KNQLKNHIQNDHNSPHYLSGMDNTSADIILTGNTNAMEGLEIKLKCSAVMKSPIPVTSSIAWYFNGQLQQTQITNMPHIFITM 743
            +PCF+         K   D ++ C V NI+     +SWWRE +L E+++G  V + RY + KS    WTL I  V   DAG YICQIN   L EKF+ L V+          +L +    D  +P+     + +  D+++ G  N +     +L C A    P P +S++ W+     Q T     P   +T+
Sbjct:  145 EPCFEPLEGINITAKVNADAHIPCTVRNIDFSSTVMSWWREGSLRELTVGHQVASQRYSIDKSDPRSWTLVIRNVTQSDAGNYICQINLSKLKEKFYRLSVLPLETTKQDSTKLNDEYVKDEATPY----KNMSHQDVLIEGKPNGVTNRPHQLTCIARFYQPDP-SSTVLWFHKNPYQGTAERRYPRSPVTL 332          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A158QI02 (Ig-like domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS8419 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.371e-19
Identity = 43/102 (42.16%), Postives = 61/102 (59.80%), Query Frame = 3
Query:  186 LKPCFDAHTKTYFKVKEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYVTNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINSGVLLEKFFYLEV 491
              PCF+A   T   V+EG ++ + C VHN++     +SWW+E  L EI++G  +++ R+ + KS    W+L I  V   D+G YICQINS  L EKF YL V
Sbjct:    7 FAPCFNASFPTSLTVEEGKNVILPCVVHNVDFNNTVMSWWKERALREIAVGDNISDRRFSIDKSIRGGWSLRITNVSLLDSGVYICQINSKQLREKFIYLSV 108          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A0R3U3G6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1108 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.375e-18
Identity = 43/118 (36.44%), Postives = 73/118 (61.86%), Query Frame = 3
Query:  156 SNLTDCNSTTL----KPCFDAHTKTYFKVKEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYVTNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINSGVLLEKFFYLEVIK 497
            +++ DC++  L     PCF  + K    V+EG  + + C ++N++  +  +SWW+E  L EISLG+   + R+++ +  +  W+L I  VQ  DAG Y CQIN+ V+LEK F+L+V++
Sbjct:   40 ASMHDCDAGHLMLERTPCFAGNVKKTIVVQEGDTVEIMCLIYNVDFSKTLVSWWKERELQEISLGLSTRSKRFQLPRRFNEDWSLIIQNVQPSDAGGYSCQINADVVLEKIFFLKVLE 157          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A5K3EJQ5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.679e-18
Identity = 47/124 (37.90%), Postives = 72/124 (58.06%), Query Frame = 3
Query:  132 LYLEGKEFSNLTDCNSTTLKPCFDAHTKTYFKVKEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYVTNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINSGVLLEKFFYLEVIKNQ 503
            + LE +E  N+T  +     PCF+A   T   V+EG+ + + C VHN++   I +SWW+E  + EI++G  +++ RY + KS    W+L I  V   D+G YICQINS +L E+F  L V   +
Sbjct:   53 IVLEDEESVNVT--HRELKAPCFNASFPTNLVVEEGSTVTLPCVVHNVDFNSIVMSWWKERAVREITVGDNISDKRYSIDKSIRGAWSLRIFNVSIRDSGVYICQINSKLLRERFISLTVTARR 174          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000067734.1 (SMESG000067734.1)

HSP 1 Score: 119.783 bits (299), Expect = 2.540e-31
Identity = 73/226 (32.30%), Postives = 118/226 (52.21%), Query Frame = 3
Query:  111 IMWLFSLLYLEGKEFSNLTDCNSTTLKPCFDAHTKTYFKVKEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYVTNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINSGVLLEKFFYLEVIKNQLKNHIQNDHNSPHYLSGMDNT--SADIILTGNTNAMEGLEIKLKCSAVMKSPIPVTS----SIAWYFNGQLQQTQITNMPHIFITMQWIGNNTLV 770
            I+ + S +++ GK +S    C+++  +PCFD    T F  + G  + ++C +++++  +I ISWW+E  L E++LG  V N+RYK+ +   N W+L I  + + D+G YICQIN   +LE  F+L +    +  +  +D   P     M ++     ++L G +         L C     SPIP T     SI W  N +L Q   +   +I ITMQW  N+TLV
Sbjct:    9 IVIIASFIFIMGKSYSYHYSCSTSERRPCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQN--DDFPRPKQYIAMPSSLPLTSVVLRGPSMVTIDEPFHLICQI---SPIPKTRYGDVSIEWKQNKKLIQPSNSRKNNIQITMQWKPNSTLV 229          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000067734.1 (SMESG000067734.1)

HSP 1 Score: 118.627 bits (296), Expect = 7.916e-31
Identity = 74/224 (33.04%), Postives = 115/224 (51.34%), Query Frame = 3
Query:  111 IMWLFSLLYLEGKEFSNLTDCNSTTLKPCFDAHTKTYFKVKEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYVTNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINSGVLLEKFFYLEVIKNQLKNHIQNDHNSPHYLSGMDNTSADIILTGNTNAMEGLEIKLKCSAVMKSPIPVTS----SIAWYFNGQLQQTQITNMPHIFITMQWIGNNTLV 770
            I+ + S +++ GK +S    C+++  +PCFD    T F  + G  + ++C +++++  +I ISWW+E  L E++LG  V N+RYK+ +   N W+L I  + + D+G YICQIN   +LE  F+L +    +  +  +D   P     M       IL G +         L C     SPIP T     SI W  N +L Q   +   +I ITMQW  N+TLV
Sbjct:    9 IVIIASFIFIMGKSYSYHYSCSTSERRPCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQN--DDFPRPKQYIAMP------ILRGPSMVTIDEPFHLICQI---SPIPKTRYGDVSIEWKQNKKLIQPSNSRKNNIQITMQWKPNSTLV 221          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000057236.1 (SMESG000057236.1)

HSP 1 Score: 88.5817 bits (218), Expect = 7.778e-20
Identity = 66/225 (29.33%), Postives = 108/225 (48.00%), Query Frame = 3
Query:   96 MICFYIMWLFSLLYLEGKEFSNLTDCNST-TLKPCFDAHTKTYFKVKEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYVTNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINSGVLLEKFFYLEVIKNQLKNHIQNDHNSPHYLSGMDNTSADIILTGNTNAMEGLEIKLKCSAVMKSPIPVTSSIAWYFNGQLQQTQITNMPHIFITMQWIGNNTL 767
            +I F+I+ + S +  + K F    DC +     PCF         VK G    + C V N++  +  ISWW+EN + EISLG  + N RYK+ +   + W+L I + +  DAG YICQIN   L+E    L V+K++  + ++ D N+   +      +  + L G++ A    ++ L C  V      + + I W    Q      +      I+++W+GN TL
Sbjct:   11 LIYFFIIKINSQISNQSKSF----DCKTAEPFTPCFMWTGTNLVSVKNGEPATLPCLVKNVDTTKTAISWWKENEMTEISLGKVILNARYKLSEMTEHDWSLIIKQSRMSDAGHYICQINLSTLMEWHVTLVVLKSKNAD-VRMDSNTEEDIQPPQPKNKYVFLYGHSKAFIYSKLILTCE-VRYVYDNINAGIIWSHRNQFLND--SEKWKDTISIRWMGNLTL 227          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000046049.1 (SMESG000046049.1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.331e-18
Identity = 57/181 (31.49%), Postives = 91/181 (50.28%), Query Frame = 3
Query:  231 KEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYVTNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINSGVLLEKFFYLEVIKNQLKNHIQNDHNSPHYLSGMDNTSADII-LTGNTNAMEGLEIKLKCSAVMKSPIPVTSSIAWYFNGQLQQTQITNMPHIFITMQWIGNNTLV 770
            + G    + C + N N  +I I+WW+E  + E++LG  V+N RY + +  +  WTL I      DAG YICQIN   L EKFF +E IKN++K+  +    S  Y+         ++ +    + +   E  L+C +   S +   SS+ W  N   + +  +    + I MQW+ NNTL+
Sbjct:   31 QSGPCFKLQCFIFNANFSKILITWWKEGFMRELTLGSTVSNSRYLLPRLFNEDWTLIIRNATPSDAGTYICQINLLTLKEKFFKVE-IKNRIKSS-KPFIASYQYVKDEGMKLIQVVKIEAKKSPILNQEFSLRCVSTF-SSVTSDSSVLWMHNDSEKFS--SQKDDVEIKMQWLSNNTLL 206          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000046049.1 (SMESG000046049.1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.019e-18
Identity = 57/181 (31.49%), Postives = 91/181 (50.28%), Query Frame = 3
Query:  231 KEGTDLNMDCEVHNINIERIPISWWRENTLAEISLGVYVTNDRYKVMKSKSNIWTLNIPKVQTFDAGKYICQINSGVLLEKFFYLEVIKNQLKNHIQNDHNSPHYLSGMDNTSADII-LTGNTNAMEGLEIKLKCSAVMKSPIPVTSSIAWYFNGQLQQTQITNMPHIFITMQWIGNNTLV 770
            + G    + C + N N  +I I+WW+E  + E++LG  V+N RY + +  +  WTL I      DAG YICQIN   L EKFF +E IKN++K+  +    S  Y+         ++ +    + +   E  L+C +   S +   SS+ W  N   + +  +    + I MQW+ NNTL+
Sbjct:   37 QSGPCFKLQCFIFNANFSKILITWWKEGFMRELTLGSTVSNSRYLLPRLFNEDWTLIIRNATPSDAGTYICQINLLTLKEKFFKVE-IKNRIKSS-KPFIASYQYVKDEGMKLIQVVKIEAKKSPILNQEFSLRCVSTF-SSVTSDSSVLWMHNDSEKFS--SQKDDVEIKMQWLSNNTLL 212          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CD226.218e-623.30CD22 molecule [Source:HGNC Symbol;Acc:HGNC:1643][more]
CD227.423e-623.30CD22 molecule [Source:HGNC Symbol;Acc:HGNC:1643][more]
CD227.937e-624.43CD22 molecule [Source:HGNC Symbol;Acc:HGNC:1643][more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DIP-beta1.718e-834.07gene:FBgn0259245 transcript:FBtr0343091[more]
dpr57.503e-828.00gene:FBgn0037908 transcript:FBtr0082395[more]
DIP-beta7.618e-831.00gene:FBgn0259245 transcript:FBtr0299901[more]
DIP-beta7.618e-831.00gene:FBgn0259245 transcript:FBtr0299898[more]
dpr58.118e-828.00gene:FBgn0037908 transcript:FBtr0082394[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P6NT652.765e-2143.12Ig-like domain-containing protein OS=Dibothrioceph... [more]
A0A4S2LAC79.859e-2030.57Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A158QI021.371e-1942.16Ig-like domain-containing protein OS=Rodentolepis ... [more]
A0A0R3U3G61.375e-1836.44Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3EJQ51.679e-1837.90Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067734.12.540e-3132.30SMESG000067734.1[more]
SMESG000067734.17.916e-3133.04SMESG000067734.1[more]
SMESG000057236.17.778e-2029.33SMESG000057236.1[more]
SMESG000046049.12.331e-1831.49SMESG000046049.1[more]
SMESG000046049.13.019e-1831.49SMESG000046049.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025235 ID=SMED30025235|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=959bp
GCAATTATCATTTTTGATTCCAAAAGAACTGCTTCATCTTGCATGTCTGT
AAAGCGAAAAAGGCTTATTACCAACAGTTATTAATGAATTAATAAATGAT
TTGTTTTTACATTATGTGGCTCTTCTCTCTTCTATATTTAGAAGGTAAAG
AATTTTCAAATCTAACTGATTGCAACAGCACGACTTTGAAGCCTTGTTTT
GATGCTCATACAAAGACTTATTTCAAAGTCAAAGAAGGAACCGATTTAAA
CATGGATTGCGAAGTTCATAACATCAATATTGAACGAATTCCGATTTCTT
GGTGGCGAGAAAATACACTGGCGGAAATTTCGCTTGGAGTTTATGTAACA
AATGATAGATATAAAGTAATGAAATCAAAATCAAACATTTGGACCTTGAA
CATTCCAAAGGTTCAGACATTTGACGCTGGCAAATATATTTGTCAGATCA
ACTCTGGAGTTCTTTTAGAAAAGTTCTTTTACCTTGAAGTAATCAAAAAT
CAATTAAAAAACCATATCCAGAATGACCATAATTCACCTCATTATCTTTC
AGGGATGGATAATACATCAGCTGATATCATTCTGACAGGGAATACGAATG
CCATGGAAGGTCTTGAAATAAAGCTGAAATGTTCAGCAGTAATGAAGTCT
CCCATTCCTGTGACAAGTTCAATTGCTTGGTATTTCAATGGGCAATTACA
ACAGACACAAATAACAAACATGCCACATATTTTTATTACAATGCAATGGA
TTGGAAACAATACATTGGTACTTGGAGTTGCCACAAGGTAGATATGTCTT
CTCCAACTGGGAAACTCAGAGTCAAAGCGGGGTCGTCACTCCGTATAAAT
ATGGTACCCTCAGAATCCCCAAAATGGAATAATTTAATCAAAAATTTTAC
CAATGAAAATTTCAAAAATTCTGCAATTTCCAGTAAACATTTTTCCCACA
ATTATGAGA
back to top

protein sequence of SMED30025235-orf-1

>SMED30025235-orf-1 ID=SMED30025235-orf-1|Name=SMED30025235-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
MFSSNEVSHSCDKFNCLVFQWAITTDTNNKHATYFYYNAMDWKQYIGTWS
CHKVDMSSPTGKLRVKAGSSLRINMVPSESPKWNNLIKNFTNENFKNSAI
SSKHFSHNYE
back to top

protein sequence of SMED30025235-orf-2

>SMED30025235-orf-2 ID=SMED30025235-orf-2|Name=SMED30025235-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=232bp
MICFYIMWLFSLLYLEGKEFSNLTDCNSTTLKPCFDAHTKTYFKVKEGTD
LNMDCEVHNINIERIPISWWRENTLAEISLGVYVTNDRYKVMKSKSNIWT
LNIPKVQTFDAGKYICQINSGVLLEKFFYLEVIKNQLKNHIQNDHNSPHY
LSGMDNTSADIILTGNTNAMEGLEIKLKCSAVMKSPIPVTSSIAWYFNGQ
LQQTQITNMPHIFITMQWIGNNTLVLGVATR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR037448Zig-8
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR013151Immunoglobulin
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 40..133
e-value: 7.7E-5
score: 32.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 29..136
e-value: 2.6E-16
score: 61.5
IPR013151ImmunoglobulinPFAMPF00047igcoord: 40..119
e-value: 1.7E-8
score: 34.5
NoneNo IPR availablePANTHERPTHR23279:SF6DEFECTIVE PROBOSCIS EXTENSION RESPONSE 7, ISOFORM Fcoord: 29..198
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.755
IPR037448Zwei Ig domain protein zig-8PANTHERPTHR23279DEFECTIVE PROBOSCIS EXTENSION RESPONSE DPR -RELATEDcoord: 29..198
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 33..121
score: 10.172
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 33..132