Dynamin-1

Overview
NameDynamin-1
Smed IDSMED30025232
Length (bp)2719
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynamin-1 (SMED30025232) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynamin-1 (SMED30025232) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynamin-1 (SMED30025232) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynamin-1 (SMED30025232) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025232

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025232SMESG000067156.1 SmedASXL_017268SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30025232SMESG000067156.1 dd_Smed_v4_6863_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025232SMESG000067156.1 dd_Smed_v4_6863_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30025232SMESG000067156.1 dd_Smed_v4_6863_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30025232SMESG000067156.1 dd_Smed_v4_6863_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025232SMESG000067156.1 dd_Smed_v4_6863_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025232SMESG000067156.1 dd_Smed_v6_6863_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30025232SMESG000067156.1 OX_Smed_1.0.06961ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30025232SMESG000067156.1 dd_Smed_v4_6863_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
central nervous systemSMED30025232SMESG000067156.1 SMED30025232smed_20140614PMID:24950970
Talbot et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30025232SMESG000067156.1 SMED30025232smed_20140614PMID:24950970
Talbot et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
synapseSMED30025232SMESG000067156.1 SMED30025232smed_20140614PMID:24950970
Talbot et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynamin-1 vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 1111.29 bits (2873), Expect = 0.000e+0
Identity = 561/857 (65.46%), Postives = 681/857 (79.46%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSRS 2567
            GN GME LIP+VN+LQDAFS+IG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  + +EYAEF+HCK KKFTDF+EVR EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQPPDIE QIR M+M+F+T ENCLILAVSPANSD+ANSDALK+AKEVDPQG RTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI  ALA+ERKFF+SHPSYRH+ADRMGT YLQKVLNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV+KQ+ K++ P +KC+D+VISELI  V  CT K++ +PRLREE+ERIVT  ++E+E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+S+   K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SE+    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II +++T T+STP+PPPV + WL  ++         SS   Q   P+    R     P     P       AP VP  P  +      PP +P RP+   ++ P +PSRS
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDE--------ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPN---RAPPGVPSRS 847          
BLAST of Dynamin-1 vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 1110.52 bits (2871), Expect = 0.000e+0
Identity = 561/856 (65.54%), Postives = 679/856 (79.32%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSR 2564
            GN GME LIP+VN+LQDAFS+IG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  + +EYAEF+HCK KKFTDF+EVR EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQPPDIE QIR M+M+F+T ENCLILAVSPANSD+ANSDALK+AKEVDPQG RTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI  ALA+ERKFF+SHPSYRH+ADRMGT YLQKVLNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV+KQ+ K++ P +KC+D+VISELI  V  CT K++ +PRLREE+ERIVT  ++E+E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+S+   K K  GNQV            IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SE+    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II +++T T+STP+PPPV + WL  ++         SS   Q   P+    R     P     P       AP VP  P  +      PP +P RP+   ++ P +PSR
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQV------------IRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPN---RAPPGVPSR 842          
BLAST of Dynamin-1 vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 1109.75 bits (2869), Expect = 0.000e+0
Identity = 562/863 (65.12%), Postives = 680/863 (78.79%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLT-----------SASNLIPPLIPQRPSGGGKSTPN 2552
            GN GME LIP+VN+LQDAFS+IG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  + +EYAEF+HCK KKFTDF+EVR EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQPPDIE QIR M+M+F+T ENCLILAVSPANSD+ANSDALK+AKEVDPQG RTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI  ALA+ERKFF+SHPSYRH+ADRMGT YLQKVLNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV+KQ+ K++ P +KC+D+VISELI  V  CT K++ +PRLREE+ERIVT  ++E+E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+S+   K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SE+    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II +++T T+STP+PPPV + WL  ++         SS   Q   P+    R     P     P       AP VP  P  +           S  N  PP +P +P G GKS P+
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDE--------ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAPPGVPSQPIGSGKSIPS 856          
BLAST of Dynamin-1 vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 1106.66 bits (2861), Expect = 0.000e+0
Identity = 557/857 (64.99%), Postives = 679/857 (79.23%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSRS 2567
            GN GME LIP+VN+LQDAFS+IG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  + +EYAEF+HCK KKFTDF+EVR EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQPPDIE QIR M+M+F+T ENCLILAVSPANSD+ANSDALK+AKEVDPQG RTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI  ALA+ERKFF+SHPSYRH+ADRMGT YLQKVLNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPD+AFE  V+KQ+ KLK P+IKC+D+V+SEL   +  C+ K++ +PRLREE+ERIVT  ++E+E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+S+   K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SE+    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II +++T T+STP+PPPV + WL  ++         SS   Q   P+    R     P     P       AP VP  P  +      PP +P RP+   ++ P +PSRS
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTATIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDE--------ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPN---RAPPGVPSRS 847          
BLAST of Dynamin-1 vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 1106.28 bits (2860), Expect = 0.000e+0
Identity = 558/853 (65.42%), Postives = 675/853 (79.13%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNI 2555
            GN GME LIP+VN+LQDAFS+IG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  + +EYAEF+HCK KKFTDF+EVR EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQPPDIE QIR M+M+F+T ENCLILAVSPANSD+ANSDALK+AKEVDPQG RTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI  ALA+ERKFF+SHPSYRH+ADRMGT YLQKVLNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV+KQ+ K++ P +KC+D+VISELI  V  CT K++ +PRLREE+ERIVT  ++E+E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+S+   K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SE+    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II +++T T+STP+PPPV + WL  ++         SS   Q   P+    R     P     P       AP VP  P  +      PP +P RP+      P I
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDE--------ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAPPGVPRI 846          
BLAST of Dynamin-1 vs. Ensembl Celegans
Match: dyn-1 (Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055])

HSP 1 Score: 994.186 bits (2569), Expect = 0.000e+0
Identity = 488/761 (64.13%), Postives = 601/761 (78.98%), Query Frame = 3
Query:   57 NSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSE-IDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSS--DSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK---QESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPP 2321
            N GM+ LIP++N++QDAFS +G  ++ +LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQL    +EYAEF+H K  +F DFD VRKEIE ETDR+TG NKGIS  PINLRV+SP+VLNLTLIDLPGLTKV VGDQP DIE+QIR MI+ FI  E CLILAV+PANSD+A SDALKLAKEVDPQGLRTIGV+TKLDLMDEGTDAREILENKL  LRRGY+GVVNR QKDI G+KDI+ AL +ERKFF+SHPSYRHMADR+GT YLQ  LNQQLTNHIR+TLP LR++LQ ++ +MEK+V EY+N +P+DP  KTKALL  V +F  +  ++I+G+ ++ + T+ LSGGA IN++FHERFP+E+VK+E DEK++R EI YAI+NIHGIR GLFTPDMAFE I +KQI +LK P++KC+DLV++EL  V+  C   M  +PRLR+E+ERIV   ++E+E   K Q+ ++V+ +L+YMNTNHEDFIGF+NAE K+S   S K  LGNQV            IRKGWL++ N+  +R G +D WF+L +D+L+WYKD+EEKE K++LPL+G++++D+E GF  + + FALF PD KN+YKDYKQLEL   + + +D WKASFLRAG+YP K   QE ES     D SI  DP LERQVETIRNLV+SYMRII KT +DLVPK +MH+IVN+  +F + +LL  LYQCGD   LMEES  E QKREEMLRMY A KEAL IISEV+  T+    PP
Sbjct:    5 NQGMQALIPVINRVQDAFSQLGTSVSFELPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEGTDAREILENKLFTLRRGYVGVVNRGQKDIVGRKDIRAALDAERKFFISHPSYRHMADRLGTSYLQHTLNQQLTNHIRDTLPTLRDSLQKKMFAMEKDVAEYKNYQPNDPGRKTKALLQMVTQFNADIERSIEGSSAKLVSTNELSGGARINRLFHERFPFEIVKMEIDEKEMRKEIQYAIRNIHGIRVGLFTPDMAFEAIAKKQITRLKEPSLKCVDLVVNELANVIRQCADTMARYPRLRDELERIVVSHMREREQIAKQQIGLIVDYELAYMNTNHEDFIGFSNAEAKASQGQSAKKNLGNQV------------IRKGWLSLSNVSFVR-GSKDNWFVLMSDSLSWYKDDEEKEKKYMLPLDGVKLKDIEGGFMSRNHKFALFYPDGKNIYKDYKQLELGCTNLDEIDAWKASFLRAGVYPEKQKAQEDESQQEMEDTSI--DPQLERQVETIRNLVDSYMRIITKTIKDLVPKAVMHLIVNQTGEFMKDELLAHLYQCGDTDALMEESQIEAQKREEMLRMYHACKEALRIISEVNMSTLGDQPPP 750          
BLAST of Dynamin-1 vs. Ensembl Celegans
Match: dyn-1 (Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055])

HSP 1 Score: 992.645 bits (2565), Expect = 0.000e+0
Identity = 488/761 (64.13%), Postives = 601/761 (78.98%), Query Frame = 3
Query:   57 NSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSE-IDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSS--DSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK---QESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPP 2321
            N GM+ LIP++N++QDAFS +G  ++ +LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQL    +EYAEF+H K  +F DFD VRKEIE ETDR+TG NKGIS  PINLRV+SP+VLNLTLIDLPGLTKV VGDQP DIE+QIR MI+ FI  E CLILAV+PANSD+A SDALKLAKEVDPQGLRTIGV+TKLDLMDEGTDAREILENKL  LRRGY+GVVNR QKDI G+KDI+ AL +ERKFF+SHPSYRHMADR+GT YLQ  LNQQLTNHIR+TLP LR++LQ ++ +MEK+V EY+N +P+DP  KTKALL  V +F  +  ++I+G+ ++ + T+ LSGGA IN++FHERFP+E+VK+E DEK++R EI YAI+NIHGIR GLFTPDMAFE I +KQI +LK P++KC+DLV++EL  V+  C   M  +PRLR+E+ERIV   ++E+E   K Q+ ++V+ +L+YMNTNHEDFIGF+NAE K+S   S K  LGNQV            IRKGWL++ N+  +R G +D WF+L +D+L+WYKD+EEKE K++LPL+G++++D+E GF  + + FALF PD KN+YKDYKQLEL   + + +D WKASFLRAG+YP K   QE ES     D SI  DP LERQVETIRNLV+SYMRII KT +DLVPK +MH+IVN+  +F + +LL  LYQCGD   LMEES  E QKREEMLRMY A KEAL IISEV+  T+    PP
Sbjct:    5 NQGMQALIPVINRVQDAFSQLGTSVSFELPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEGTDAREILENKLFTLRRGYVGVVNRGQKDIVGRKDIRAALDAERKFFISHPSYRHMADRLGTSYLQHTLNQQLTNHIRDTLPTLRDSLQKKMFAMEKDVAEYKNYQPNDPGRKTKALLQMVTQFNADIERSIEGSSAKLVSTNELSGGARINRLFHERFPFEIVKMEIDEKEMRKEIQYAIRNIHGIRVGLFTPDMAFEAIAKKQITRLKEPSLKCVDLVVNELANVIRQCADTMARYPRLRDELERIVVSHMREREQIAKQQIGLIVDYELAYMNTNHEDFIGFSNAEAKASQGQSAKKNLGNQV------------IRKGWLSLSNVSFVR-GSKDNWFVLMSDSLSWYKDDEEKEKKYMLPLDGVKLKDIEGGFMSRNHKFALFYPDGKNIYKDYKQLELGCTNLDEIDAWKASFLRAGVYPEKQKAQEDESQQEMEDTSI--DPQLERQVETIRNLVDSYMRIITKTIKDLVPKAVMHLIVNQTGEFMKDELLAHLYQCGDTDALMEESQIEAQKREEMLRMYHACKEALRIISEVNMSTLGDQPPP 750          
BLAST of Dynamin-1 vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 422.935 bits (1086), Expect = 7.083e-136
Identity = 238/509 (46.76%), Postives = 331/509 (65.03%), Query Frame = 3
Query:   66 MEMLIPIVNKLQDAFSSIGIPIN-LDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNF-----------SNS-----EYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDC----TAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDF 1529
            ME LIP+VNKLQD F+++G   + + LPQI VVGSQSAGKSSVLEN VGRDFLPRG+GIVTRRPL+LQLN            SN      ++A F H  +K FTDFD VRKEIE ETDR+TG NKGIS +PI+L++YS  V++L+L+DLPG+TK+ VGDQP +IE+QIR MI+ +I+  + +ILAV+PAN D A S+ +KLA+EVD  G RT+ V+TKLDLMD+GTDA ++L  K++P++ G IGVVNRSQ++I   K I  A+  E+ F      Y  +A R GT YL K LN  L +HIR  LP L+  +       + ++  +     D    K + LL  + +F T +   I+GT   I+T  L GGA I  IFH+ F   L  +   E   + +I  AI+N  G R  LF P+++FE +V++QI +L+ P+++C++LV  E+ ++V  C      +M  FPRL ++I  +V+  LKE+   T + +  LV I+L+Y+NT H +F
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFM--QKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFGEPVED----KNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEF 503          

HSP 2 Score: 55.8398 bits (133), Expect = 1.422e-7
Identity = 31/90 (34.44%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 2019 ERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEV 2288
            +R V  I  L+ +Y  I+ K  +D VPK IM ++VN V+   + +L+  LY+  +   L+ E+ +  Q+R + L    A+++A  IISEV
Sbjct:  610 QRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQQASVIISEV 699          
BLAST of Dynamin-1 vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 422.935 bits (1086), Expect = 7.083e-136
Identity = 238/509 (46.76%), Postives = 331/509 (65.03%), Query Frame = 3
Query:   66 MEMLIPIVNKLQDAFSSIGIPIN-LDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNF-----------SNS-----EYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDC----TAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDF 1529
            ME LIP+VNKLQD F+++G   + + LPQI VVGSQSAGKSSVLEN VGRDFLPRG+GIVTRRPL+LQLN            SN      ++A F H  +K FTDFD VRKEIE ETDR+TG NKGIS +PI+L++YS  V++L+L+DLPG+TK+ VGDQP +IE+QIR MI+ +I+  + +ILAV+PAN D A S+ +KLA+EVD  G RT+ V+TKLDLMD+GTDA ++L  K++P++ G IGVVNRSQ++I   K I  A+  E+ F      Y  +A R GT YL K LN  L +HIR  LP L+  +       + ++  +     D    K + LL  + +F T +   I+GT   I+T  L GGA I  IFH+ F   L  +   E   + +I  AI+N  G R  LF P+++FE +V++QI +L+ P+++C++LV  E+ ++V  C      +M  FPRL ++I  +V+  LKE+   T + +  LV I+L+Y+NT H +F
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFM--QKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFGEPVED----KNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEF 503          

HSP 2 Score: 55.8398 bits (133), Expect = 1.422e-7
Identity = 31/90 (34.44%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 2019 ERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEV 2288
            +R V  I  L+ +Y  I+ K  +D VPK IM ++VN V+   + +L+  LY+  +   L+ E+ +  Q+R + L    A+++A  IISEV
Sbjct:  610 QRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQQASVIISEV 699          
BLAST of Dynamin-1 vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 422.935 bits (1086), Expect = 7.083e-136
Identity = 238/509 (46.76%), Postives = 331/509 (65.03%), Query Frame = 3
Query:   66 MEMLIPIVNKLQDAFSSIGIPIN-LDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNF-----------SNS-----EYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDC----TAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDF 1529
            ME LIP+VNKLQD F+++G   + + LPQI VVGSQSAGKSSVLEN VGRDFLPRG+GIVTRRPL+LQLN            SN      ++A F H  +K FTDFD VRKEIE ETDR+TG NKGIS +PI+L++YS  V++L+L+DLPG+TK+ VGDQP +IE+QIR MI+ +I+  + +ILAV+PAN D A S+ +KLA+EVD  G RT+ V+TKLDLMD+GTDA ++L  K++P++ G IGVVNRSQ++I   K I  A+  E+ F      Y  +A R GT YL K LN  L +HIR  LP L+  +       + ++  +     D    K + LL  + +F T +   I+GT   I+T  L GGA I  IFH+ F   L  +   E   + +I  AI+N  G R  LF P+++FE +V++QI +L+ P+++C++LV  E+ ++V  C      +M  FPRL ++I  +V+  LKE+   T + +  LV I+L+Y+NT H +F
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFM--QKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFGEPVED----KNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEF 503          

HSP 2 Score: 55.8398 bits (133), Expect = 1.422e-7
Identity = 31/90 (34.44%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 2019 ERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEV 2288
            +R V  I  L+ +Y  I+ K  +D VPK IM ++VN V+   + +L+  LY+  +   L+ E+ +  Q+R + L    A+++A  IISEV
Sbjct:  610 QRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQQASVIISEV 699          
BLAST of Dynamin-1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301596)

HSP 1 Score: 1031.94 bits (2667), Expect = 0.000e+0
Identity = 502/774 (64.86%), Postives = 626/774 (80.88%), Query Frame = 3
Query:   66 MEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSE-IDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDS---GKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGF--WGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTE-------ADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSA 2348
            M+ LI IVNKLQDAF+S+G+ + LDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQL    +EY EF+H K KKF+ FDE+RKEIE ETDR+TGSNKGIS++PINLRVYSPHVLNLTLIDLPGLTKVA+GDQP DIE+QI+ MI +FI  E CLILAV+PAN+D+ANSDALKLAKEVDPQG+RTIGVITKLDLMDEGTDAR+ILENKLLPLRRGYIGVVNRSQKDI+G+KDI  ALA+ERKFF+SHPSYRHMADR+GT YLQ+VLNQQLTNHIR+TLP LR+ LQ Q+L++EKEV E+++ +P D S KTKA+L  +Q+ +++F + I+G+GS  ++T+ LSGGA IN+IFHER  +E+VK+ CDEK+LR EIS+AI+NIHGIR GLFTPDMAFE IV++QI  LK P IKC+DLV+ EL  VV  CTAKM  +PRLREE ERI+T  ++++E   K+Q+++L++ +L+YMNTNHEDFIGFANA+ KS ++   G  +LGNQV            IRKG + IQN+ +++ G R +WF+L +++++WYKDE+EKE KF+LPL+GL++RD+E GF    ++  FALF+PD +NVYKDYKQLEL  E+ E ++ WKASFLRAG+YP KQE++ N  E       A      DP LERQVETIRNLV+SYM+I+ KT RD+VPK IM +I+N  K F  G+LL  LY  GD   +MEESAE   +REEMLRMY A K+AL+II +VS  T+S+P+PPPV N+WL +
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDFIGFANAQNKSENANKTGTRQLGNQV------------IRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGRNVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDEEGQEQKSASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDWLPS 762          
BLAST of Dynamin-1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301597)

HSP 1 Score: 1030.78 bits (2664), Expect = 0.000e+0
Identity = 502/774 (64.86%), Postives = 626/774 (80.88%), Query Frame = 3
Query:   66 MEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSE-IDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDS---GKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGF--WGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTE-------ADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSA 2348
            M+ LI IVNKLQDAF+S+G+ + LDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQL    +EY EF+H K KKF+ FDE+RKEIE ETDR+TGSNKGIS++PINLRVYSPHVLNLTLIDLPGLTKVA+GDQP DIE+QI+ MI +FI  E CLILAV+PAN+D+ANSDALKLAKEVDPQG+RTIGVITKLDLMDEGTDAR+ILENKLLPLRRGYIGVVNRSQKDI+G+KDI  ALA+ERKFF+SHPSYRHMADR+GT YLQ+VLNQQLTNHIR+TLP LR+ LQ Q+L++EKEV E+++ +P D S KTKA+L  +Q+ +++F + I+G+GS  ++T+ LSGGA IN+IFHER  +E+VK+ CDEK+LR EIS+AI+NIHGIR GLFTPDMAFE IV++QI  LK P IKC+DLV+ EL  VV  CTAKM  +PRLREE ERI+T  ++++E   K+Q+++L++ +L+YMNTNHEDFIGFANA+ KS ++   G  +LGNQV            IRKG + IQN+ +++ G R +WF+L +++++WYKDE+EKE KF+LPL+GL++RD+E GF    ++  FALF+PD +NVYKDYKQLEL  E+ E ++ WKASFLRAG+YP KQE++ N  E       A      DP LERQVETIRNLV+SYM+I+ KT RD+VPK IM +I+N  K F  G+LL  LY  GD   +MEESAE   +REEMLRMY A K+AL+II +VS  T+S+P+PPPV N+WL +
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDFIGFANAQNKSENANKTGTRQLGNQV------------IRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGRNVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDEEGQEQKSASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDWLPS 762          
BLAST of Dynamin-1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301595)

HSP 1 Score: 1028.85 bits (2659), Expect = 0.000e+0
Identity = 501/768 (65.23%), Postives = 626/768 (81.51%), Query Frame = 3
Query:   66 MEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSE-IDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDS---GKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGF--WGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESN-NTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSA 2348
            M+ LI IVNKLQDAF+S+G+ + LDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQL    +EY EF+H K KKF+ FDE+RKEIE ETDR+TGSNKGIS++PINLRVYSPHVLNLTLIDLPGLTKVA+GDQP DIE+QI+ MI +FI  E CLILAV+PAN+D+ANSDALKLAKEVDPQG+RTIGVITKLDLMDEGTDAR+ILENKLLPLRRGYIGVVNRSQKDI+G+KDI  ALA+ERKFF+SHPSYRHMADR+GT YLQ+VLNQQLTNHIR+TLP LR+ LQ Q+L++EKEV E+++ +P D S KTKA+L  +Q+ +++F + I+G+GS  ++T+ LSGGA IN+IFHER  +E+VK+ CDEK+LR EIS+AI+NIHGIR GLFTPDMAFE IV++QI  LK P IKC+DLV+ EL  VV  CTAKM  +PRLREE ERI+T  ++++E   K+Q+++L++ +L+YMNTNHEDFIGFANA+ KS ++   G  +LGNQV            IRKG + IQN+ +++ G R +WF+L +++++WYKDE+EKE KF+LPL+GL++RD+E GF    ++  FALF+PD +NVYKDYKQLEL  E+ E ++ WKASFLRAG+YP KQE++ N +  A      DP LERQVETIRNLV+SYM+I+ KT RD+VPK IM +I+N  K F  G+LL  LY  GD   +MEESAE   +REEMLRMY A K+AL+II +VS  T+S+P+PPPV N+WL +
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDFIGFANAQNKSENANKTGTRQLGNQV------------IRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGRNVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDESASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDWLPS 756          
BLAST of Dynamin-1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301594)

HSP 1 Score: 1028.85 bits (2659), Expect = 0.000e+0
Identity = 501/768 (65.23%), Postives = 626/768 (81.51%), Query Frame = 3
Query:   66 MEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSE-IDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDS---GKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGF--WGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESN-NTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSA 2348
            M+ LI IVNKLQDAF+S+G+ + LDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQL    +EY EF+H K KKF+ FDE+RKEIE ETDR+TGSNKGIS++PINLRVYSPHVLNLTLIDLPGLTKVA+GDQP DIE+QI+ MI +FI  E CLILAV+PAN+D+ANSDALKLAKEVDPQG+RTIGVITKLDLMDEGTDAR+ILENKLLPLRRGYIGVVNRSQKDI+G+KDI  ALA+ERKFF+SHPSYRHMADR+GT YLQ+VLNQQLTNHIR+TLP LR+ LQ Q+L++EKEV E+++ +P D S KTKA+L  +Q+ +++F + I+G+GS  ++T+ LSGGA IN+IFHER  +E+VK+ CDEK+LR EIS+AI+NIHGIR GLFTPDMAFE IV++QI  LK P IKC+DLV+ EL  VV  CTAKM  +PRLREE ERI+T  ++++E   K+Q+++L++ +L+YMNTNHEDFIGFANA+ KS ++   G  +LGNQV            IRKG + IQN+ +++ G R +WF+L +++++WYKDE+EKE KF+LPL+GL++RD+E GF    ++  FALF+PD +NVYKDYKQLEL  E+ E ++ WKASFLRAG+YP KQE++ N +  A      DP LERQVETIRNLV+SYM+I+ KT RD+VPK IM +I+N  K F  G+LL  LY  GD   +MEESAE   +REEMLRMY A K+AL+II +VS  T+S+P+PPPV N+WL +
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDFIGFANAQNKSENANKTGTRQLGNQV------------IRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGRNVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDESASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDWLPS 756          
BLAST of Dynamin-1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074123)

HSP 1 Score: 1028.85 bits (2659), Expect = 0.000e+0
Identity = 501/768 (65.23%), Postives = 626/768 (81.51%), Query Frame = 3
Query:   66 MEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSE-IDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDS---GKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGF--WGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESN-NTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSA 2348
            M+ LI IVNKLQDAF+S+G+ + LDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQL    +EY EF+H K KKF+ FDE+RKEIE ETDR+TGSNKGIS++PINLRVYSPHVLNLTLIDLPGLTKVA+GDQP DIE+QI+ MI +FI  E CLILAV+PAN+D+ANSDALKLAKEVDPQG+RTIGVITKLDLMDEGTDAR+ILENKLLPLRRGYIGVVNRSQKDI+G+KDI  ALA+ERKFF+SHPSYRHMADR+GT YLQ+VLNQQLTNHIR+TLP LR+ LQ Q+L++EKEV E+++ +P D S KTKA+L  +Q+ +++F + I+G+GS  ++T+ LSGGA IN+IFHER  +E+VK+ CDEK+LR EIS+AI+NIHGIR GLFTPDMAFE IV++QI  LK P IKC+DLV+ EL  VV  CTAKM  +PRLREE ERI+T  ++++E   K+Q+++L++ +L+YMNTNHEDFIGFANA+ KS ++   G  +LGNQV            IRKG + IQN+ +++ G R +WF+L +++++WYKDE+EKE KF+LPL+GL++RD+E GF    ++  FALF+PD +NVYKDYKQLEL  E+ E ++ WKASFLRAG+YP KQE++ N +  A      DP LERQVETIRNLV+SYM+I+ KT RD+VPK IM +I+N  K F  G+LL  LY  GD   +MEESAE   +REEMLRMY A K+AL+II +VS  T+S+P+PPPV N+WL +
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDFIGFANAQNKSENANKTGTRQLGNQV------------IRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGRNVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDESASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDWLPS 756          
BLAST of Dynamin-1 vs. Ensembl Zebrafish
Match: dnm1a (dynamin 1a [Source:NCBI gene;Acc:100307098])

HSP 1 Score: 1105.12 bits (2857), Expect = 0.000e+0
Identity = 538/776 (69.33%), Postives = 645/776 (83.12%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-QESESNNTEADNSIQG-----DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSS 2363
            GN GME LIP+VN++QDAFS+IG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL    +EYAEF+HCK KKFTDFDEVR+EIEAETDR+TG NKGIS VPINLRVYSP+VLNLTL+DLPG+TKV VGDQP DIE QI+ M+M+F+T ENCL+LAVSPANSD+ANSDALK+AKEVDPQGLRTIGVITKLDLMDEGTDAR+ILENKLLPLRRGYIGVVNRSQKDIDGKKDI  A+A+ERKFF+SHPSYRH+ADRMGT YLQK LNQQLTNHIR+TLP LR  LQSQLLS+EKEV EY+N RPDDPS KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV++QI K+K P  KC+D+VISEL+  V  CT K+  +P LREE+ERIVTQ ++++E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+SS   K   GNQ          + +IRKGWLTI NI +++ G +++WF+L  ++L+WYKD+EEKE K++L ++ L+ RDVE GF   K+IFALFN + +NVYKDY+QLEL  ESQE +D WKASFLRAG+YP +  E E N+   +N   G     DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K++   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II ++ST TIST +PPPV + WL  + + S
Sbjct:    2 GNRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAMAAERKFFLSHPSYRHLADRMGTPYLQKTLNQQLTNHIRDTLPGLRAKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFSVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGKIKEPCQKCVDMVISELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKNQVLLLIDIELAYMNTNHEDFIGFANAQQRSSQIKKKAAGNQDE--------IMVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKFRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACESQEEVDGWKASFLRAGVYPERVVEKEKNDAGEENGSDGFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLIPKTIMHLMINNTKEYINAELLASLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALNIIGDISTTTISTSLPPPVDDSWLQVQRTGS 769          
BLAST of Dynamin-1 vs. Ensembl Zebrafish
Match: dnm1a (dynamin 1a [Source:NCBI gene;Acc:100307098])

HSP 1 Score: 1103.58 bits (2853), Expect = 0.000e+0
Identity = 536/776 (69.07%), Postives = 644/776 (82.99%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-QESESNNTEADNSIQG-----DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSS 2363
            GN GME LIP+VN++QDAFS+IG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL    +EYAEF+HCK KKFTDFDEVR+EIEAETDR+TG NKGIS VPINLRVYSP+VLNLTL+DLPG+TKV VGDQP DIE QI+ M+M+F+T ENCL+LAVSPANSD+ANSDALK+AKEVDPQGLRTIGVITKLDLMDEGTDAR+ILENKLLPLRRGYIGVVNRSQKDIDGKKDI  A+A+ERKFF+SHPSYRH+ADRMGT YLQK LNQQLTNHIR+TLP LR  LQSQLLS+EKEV EY+N RPDDPS KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPD+AFE IV+KQI KL GP +KCID+V+SEL   +  C+ K+  +P LREE+ERIVTQ ++++E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+SS   K   GNQ          + +IRKGWLTI NI +++ G +++WF+L  ++L+WYKD+EEKE K++L ++ L+ RDVE GF   K+IFALFN + +NVYKDY+QLEL  ESQE +D WKASFLRAG+YP +  E E N+   +N   G     DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K++   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II ++ST TIST +PPPV + WL  + + S
Sbjct:    2 GNRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAMAAERKFFLSHPSYRHLADRMGTPYLQKTLNQQLTNHIRDTLPGLRAKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFSVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDLAFEAIVKKQIQKLNGPCLKCIDMVVSELTSTIRKCSEKLAQYPMLREEMERIVTQHIRDRESRTKNQVLLLIDIELAYMNTNHEDFIGFANAQQRSSQIKKKAAGNQDE--------IMVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKFRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACESQEEVDGWKASFLRAGVYPERVVEKEKNDAGEENGSDGFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLIPKTIMHLMINNTKEYINAELLASLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALNIIGDISTTTISTSLPPPVDDSWLQVQRTGS 769          
BLAST of Dynamin-1 vs. Ensembl Zebrafish
Match: dnm1b (dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3])

HSP 1 Score: 1095.11 bits (2831), Expect = 0.000e+0
Identity = 558/850 (65.65%), Postives = 679/850 (79.88%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNK-LGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-QESESNNTEADNSIQG-----DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXLAPTV--PKSPNLTSAS----NLIPPLIPQRPSGGGKSTPNIPSR 2564
            GN GME LIP+VN++QDAFS+IG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL    +EYAEF+HCK KKFTDFDEVR+EIEAETDR+TG NKGIS VPINLRVYSP+VLNLTL+DLPG+TKV VGDQP DIE QIR M+M+F+T ENCL+LAVSPANSD+ANSDALK+AKEVDPQG+RTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDI  A+++ERKFF++HPSYRH+ADRMGT YLQK LNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY++ RPDDPS KTKALL  VQ+F  +F + I+G+G ++DT  LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV++QI K+K P  KC+DLVI+EL+  V  CT K+  +P LREE+ERIVTQ ++++E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+SS   K K  GNQ          + +IRKGWLTI NI +++ G +++WF++  + L+WYKD+EEKE K++LPL+ L++RD+E  F   K++FALFN + +NVYKDY+QLEL +++QE +D WKASFLRAG+YP +  + E ++T  ++S  G     DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K F   +LL  LY CGD  TLMEESAE+ Q REEMLRMY A+KEAL II ++ST T+ST +PPPV + WL  +   S  + P  SP   RRAPP PP          PT+  P  P+   AS       PP +P RP+   ++ P +PSR
Sbjct:    2 GNRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGMRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDITAAMSAERKFFLTHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKHFRPDDPSRKTKALLQMVQQFAVDFEKCIEGSGDQVDTVELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAKIKEPCQKCVDLVITELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKNQVMLLIDIELAYMNTNHEDFIGFANAQQRSSQMNKKKAAGNQDE--------IMVIRKGWLTINNIGIMKGGAKEYWFVMTAENLSWYKDDEEKEKKYMLPLDNLKLRDIEKSFMSSKHVFALFNTEQRNVYKDYRQLELASDTQEEVDSWKASFLRAGVYPERITDKEKSDTSDESSSDGFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKDFIHAELLANLYSCGDQNTLMEESAEQAQHREEMLRMYHALKEALNIIGDISTSTVSTAMPPPVDDSWLQVQGGPSGRRSPMSSPTPQRRAPPGPPRPGGRTAPGPPTIGAPPVPSRPGASPDPFGAPPPQVPSRPN---RAPPGVPSR 840          
BLAST of Dynamin-1 vs. Ensembl Zebrafish
Match: dnm1b (dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3])

HSP 1 Score: 1089.72 bits (2817), Expect = 0.000e+0
Identity = 555/848 (65.45%), Postives = 674/848 (79.48%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNK-LGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYP--VKQESESNNTEADNSIQG-----DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXLAPTV--PKSPNLTSAS----NLIPPLIPQRPSGGGKSTPNI 2555
            GN GME LIP+VN++QDAFS+IG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL    +EYAEF+HCK KKFTDFDEVR+EIEAETDR+TG NKGIS VPINLRVYSP+VLNLTL+DLPG+TKV VGDQP DIE QIR M+M+F+T ENCL+LAVSPANSD+ANSDALK+AKEVDPQG+RTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDI  A+++ERKFF++HPSYRH+ADRMGT YLQK LNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY++ RPDDPS KTKALL  VQ+F  +F + I+G+G ++DT  LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV++QI K+K P  KC+DLVI+EL+  V  CT K+  +P LREE+ERIVTQ ++++E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+SS   K K  GNQ          + +IRKGWLTI NI +++ G +++WF++  + L+WYKD+EEKE K++LPL+ L++RD+E  F   K++FALFN + +NVYKDY+QLEL +++QE +D WKASFLRAG+YP  +  + + ++T  ++S  G     DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K F   +LL  LY CGD  TLMEESAE+ Q REEMLRMY A+KEAL II ++ST T+ST +PPPV + WL  +   S  + P  SP   RRAPP PP          PT+  P  P+   AS       PP +P RP+      P I
Sbjct:    2 GNRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGMRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDITAAMSAERKFFLTHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKHFRPDDPSRKTKALLQMVQQFAVDFEKCIEGSGDQVDTVELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAKIKEPCQKCVDLVITELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKNQVMLLIDIELAYMNTNHEDFIGFANAQQRSSQMNKKKAAGNQDE--------IMVIRKGWLTINNIGIMKGGAKEYWFVMTAENLSWYKDDEEKEKKYMLPLDNLKLRDIEKSFMSSKHVFALFNTEQRNVYKDYRQLELASDTQEEVDSWKASFLRAGVYPERITDKEKQSDTSDESSSDGFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKDFIHAELLANLYSCGDQNTLMEESAEQAQHREEMLRMYHALKEALNIIGDISTSTVSTAMPPPVDDSWLQVQGGPSGRRSPMSSPTPQRRAPPGPPRPGGRTAPGPPTIGAPPVPSRPGASPDPFGAPPPQVPSRPNRAPPGVPRI 841          
BLAST of Dynamin-1 vs. Ensembl Zebrafish
Match: dnm2a (dynamin 2a [Source:ZFIN;Acc:ZDB-GENE-050913-84])

HSP 1 Score: 1072.77 bits (2773), Expect = 0.000e+0
Identity = 530/763 (69.46%), Postives = 638/763 (83.62%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWL 2342
            GN GME LIP++NKLQDAFSSIG   NLDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPL+LQL  + +EYAEF+HCK +KF DFDEVR+EIEAETDR+TGSNKGIS +PINLRVYSP+VLNLTLIDLPG+TKVAVGDQPPDIE QIR MIM+FIT E+CLILAV+PAN D+ANSDALK+AKEVDPQGLRTIGVITKLDLMDEGTDAR+ILENKLLPLRRGYIGVVNRSQKDIDG+KDI+ ALA+ERKFF+SHPSYRHMA+RMGT +LQK LNQQLTNHIR+TLP LR+ LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G ++DT  LSGGA IN+IFHERFP+ELVKI  DEK+LR EIS+AIKN+HG+RTGLFTPD+AFE IV+KQI KLK P +KCIDLVI ELI     CT K+ ++PRLREE ERIVT  ++E+E +TKDQ+++L++ +LSY+NTNHEDFIGFANA+Q++  + K  + NQV            IRKGWLT+ NI +++ G +++WF+L  ++L+WYKDEEEKE K++LPL+ L++RDVE GF   K+IFA+FN + +NVYKD +Q+EL  +SQE MD WKASFLRAG+YP K + ES      +S   DP LERQVETIRNLV+SY+ I+NKT RDL+PKTIMH+++N  K F   +LL  LY  GD  +LMEESA++ Q+R+EMLRMY A+KEAL II ++ST TISTPVPPPV + W+
Sbjct:    2 GNRGMEELIPLINKLQDAFSSIGQSCNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLVNNKAEYAEFLHCKGRKFVDFDEVRQEIEAETDRITGSNKGISPIPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPPDIEHQIRDMIMQFITRESCLILAVTPANMDLANSDALKVAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDIRAALAAERKFFLSHPSYRHMAERMGTPHLQKALNQQLTNHIRDTLPGLRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKCIEGSGDQVDTAELSGGARINRIFHERFPFELVKIVFDEKELRREISHAIKNVHGVRTGLFTPDLAFEAIVKKQIIKLKEPCLKCIDLVIQELINTFRQCTNKLSSYPRLREETERIVTTYVREREGKTKDQVLLLIDTELSYINTNHEDFIGFANAQQRNIVNKKRAIPNQV------------IRKGWLTL-NISIMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKLRDVEKGFMSTKHIFAIFNTEQRNVYKDLRQIELACDSQEDMDSWKASFLRAGVYPEKDQVESEEAAPADSFSMDPQLERQVETIRNLVDSYIGIVNKTIRDLMPKTIMHLMINSAKDFIHSELLAYLYSSGDQNSLMEESADQAQRRDEMLRMYHAIKEALSIIGDISTSTISTPVPPPVNDSWI 751          
BLAST of Dynamin-1 vs. Ensembl Xenopus
Match: ei24 (etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-990260])

HSP 1 Score: 1099.73 bits (2843), Expect = 0.000e+0
Identity = 569/852 (66.78%), Postives = 677/852 (79.46%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSRS 2567
            GN GME LIP+VN+LQDAFSSIG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL  S++EY EF+HCK KKFTDFDE+R EIEAETDR TG+NKGIS VPINLRVYSP+VLNLTL+DLPG+TKV VGDQP DIE QIR M+M+F+T ENCL+LAVSPANSD+ANSDALK+AKEVDP+GLRTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI+ ALA+ERKFF+SHPSYRH+ADRMGT YLQK LNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALLL VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV+KQI K+K P +KC+D+VISELI  V  CT K+  +P LREE+ERIVT  ++E+E RTKDQ+++L++I+LSYMNTNHEDFIGFANA+Q+SS + K K  GNQV            IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++LPL+ L++RD+E GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP ++ SES    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++   K F   DLL  LY CGD  TLMEESAE+ Q R+EML+MY A+KEAL II ++ST TISTP+PPPV + WL  +N         SS   Q   P+    R     P     PP      AP VP  P  +      PP IP RP+   ++ P +PS S
Sbjct:    2 GNRGMEELIPLVNRLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLVNSSTEYGEFLHCKGKKFTDFDEIRLEIEAETDRATGTNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPVDIEFQIRDMLMQFVTKENCLVLAVSPANSDLANSDALKIAKEVDPKGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDIQAALAAERKFFLSHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLLMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQIKKIKEPCLKCVDMVISELIGTVRQCTKKLSQYPHLREEMERIVTTHIREREGRTKDQVMLLIDIELSYMNTNHEDFIGFANAQQRSSQTNKKKASGNQV------------IRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLPLDNLKLRDIEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYP-ERASESEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTIRDLMPKTIMHLMIINTKDFIHSDLLANLYSCGDQNTLMEESAEQAQHRDEMLKMYRALKEALCIIGDISTTTISTPMPPPVDDSWLQVQNMPTGRRSPTSSPTPQRRAPAVPPTRPGSRGPAPGPPPPGSTLGSAPPVPSRPGASPDPFGPPPQIPSRPN---RAPPGVPSES 837          
BLAST of Dynamin-1 vs. Ensembl Xenopus
Match: ei24 (etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-990260])

HSP 1 Score: 1099.73 bits (2843), Expect = 0.000e+0
Identity = 568/844 (67.30%), Postives = 679/844 (80.45%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXLAPTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSR 2564
            GN GME LIP+VN+LQDAFSSIG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL  S++EY EF+HCK KKFTDFDE+R EIEAETDR TG+NKGIS VPINLRVYSP+VLNLTL+DLPG+TKV VGDQP DIE QIR M+M+F+T ENCL+LAVSPANSD+ANSDALK+AKEVDP+GLRTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI+ ALA+ERKFF+SHPSYRH+ADRMGT YLQK LNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALLL VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV+KQI K+K P +KC+D+VISELI  V  CT K+  +P LREE+ERIVT  ++E+E RTKDQ+++L++I+LSYMNTNHEDFIGFANA+Q+SS + K K  GNQV            IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++LPL+ L++RD+E GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SES    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++   K F   DLL  LY CGD  TLMEESAE+ Q R+EML+MY A+KEAL II ++ST TISTP+PPPV + WL  +N  +  + P  SP       PPPPG  +     AP VP  P  +      PP IP RP+   ++ P +PS+
Sbjct:    2 GNRGMEELIPLVNRLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLVNSSTEYGEFLHCKGKKFTDFDEIRLEIEAETDRATGTNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPVDIEFQIRDMLMQFVTKENCLVLAVSPANSDLANSDALKIAKEVDPKGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDIQAALAAERKFFLSHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLLMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQIKKIKEPCLKCVDMVISELIGTVRQCTKKLSQYPHLREEMERIVTTHIREREGRTKDQVMLLIDIELSYMNTNHEDFIGFANAQQRSSQTNKKKASGNQV------------IRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLPLDNLKLRDIEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERAGDKDKASESEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTIRDLMPKTIMHLMIINTKDFIHSDLLANLYSCGDQNTLMEESAEQAQHRDEMLKMYRALKEALCIIGDISTTTISTPMPPPVDDSWLQVQNMPTGRRSPTSSPTPGPAPGPPPPGSTLGS---APPVPSRPGASPDPFGPPPQIPSRPN---RAPPGVPSK 827          
BLAST of Dynamin-1 vs. Ensembl Xenopus
Match: ei24 (etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-990260])

HSP 1 Score: 1083.55 bits (2801), Expect = 0.000e+0
Identity = 568/876 (64.84%), Postives = 676/876 (77.17%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEE-------------------EKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNI-PSR 2564
            GN GME LIP+VN+LQDAFSSIG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL  S++EY EF+HCK KKFTDFDE+R EIEAETDR TG+NKGIS VPINLRVYSP+VLNLTL+DLPG+TKV VGDQP DIE QIR M+M+F+T ENCL+LAVSPANSD+ANSDALK+AKEVDP+GLRTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI+ ALA+ERKFF+SHPSYRH+ADRMGT YLQK LNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALLL VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV+KQI K+K P +KC+D+VISELI  V  CT K+  +P LREE+ERIVT  ++E+E RTKDQ+++L++I+LSYMNTNHEDFIGFANA+Q+SS + K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  + L+WYKD+E                   EKE K++LPL+ L++RD+E GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SES    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++   K F   DLL  LY CGD  TLMEESAE+ Q R+EML+MY A+KEAL II ++ST TISTP+PPPV + WL  +N         SS   Q   P+    R     P     PP      AP VP  P  +      PP IP RP+      P + PSR
Sbjct:    2 GNRGMEELIPLVNRLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLVNSSTEYGEFLHCKGKKFTDFDEIRLEIEAETDRATGTNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPVDIEFQIRDMLMQFVTKENCLVLAVSPANSDLANSDALKIAKEVDPKGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDIQAALAAERKFFLSHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLLMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQIKKIKEPCLKCVDMVISELIGTVRQCTKKLSQYPHLREEMERIVTTHIREREGRTKDQVMLLIDIELSYMNTNHEDFIGFANAQQRSSQTNKKKASGNQDE--------ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEMEKKYMLPVDNLKLRDIKEKEKKYMLPLDNLKLRDIEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERAGDKDKASESEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTIRDLMPKTIMHLMIINTKDFIHSDLLANLYSCGDQNTLMEESAEQAQHRDEMLKMYRALKEALCIIGDISTTTISTPMPPPVDDSWLQVQNMPTGRRSPTSSPTPQRRAPAVPPTRPGSRGPAPGPPPPGSTLGSAPPVPSRPGASPDPFGPPPQIPSRPNRAPPGVPRVSPSR 869          
BLAST of Dynamin-1 vs. Ensembl Xenopus
Match: ei24 (etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-990260])

HSP 1 Score: 1083.55 bits (2801), Expect = 0.000e+0
Identity = 567/876 (64.73%), Postives = 678/876 (77.40%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEE-------------------EKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSRS 2567
            GN GME LIP+VN+LQDAFSSIG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL  S++EY EF+HCK KKFTDFDE+R EIEAETDR TG+NKGIS VPINLRVYSP+VLNLTL+DLPG+TKV VGDQP DIE QIR M+M+F+T ENCL+LAVSPANSD+ANSDALK+AKEVDP+GLRTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI+ ALA+ERKFF+SHPSYRH+ADRMGT YLQK LNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALLL VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV+KQI K+K P +KC+D+VISELI  V  CT K+  +P LREE+ERIVT  ++E+E RTKDQ+++L++I+LSYMNTNHEDFIGFANA+Q+SS + K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  + L+WYKD+E                   EKE K++LPL+ L++RD+E GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SES    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++   K F   DLL  LY CGD  TLMEESAE+ Q R+EML+MY A+KEAL II ++ST TISTP+PPPV + WL  +N         SS   Q   P+    R     P     PP      AP VP  P  +      PP IP RP+   ++ P +P R+
Sbjct:    2 GNRGMEELIPLVNRLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLVNSSTEYGEFLHCKGKKFTDFDEIRLEIEAETDRATGTNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPVDIEFQIRDMLMQFVTKENCLVLAVSPANSDLANSDALKIAKEVDPKGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDIQAALAAERKFFLSHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLLMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQIKKIKEPCLKCVDMVISELIGTVRQCTKKLSQYPHLREEMERIVTTHIREREGRTKDQVMLLIDIELSYMNTNHEDFIGFANAQQRSSQTNKKKASGNQDE--------ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEMEKKYMLPVDNLKLRDIKEKEKKYMLPLDNLKLRDIEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERAGDKDKASESEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTIRDLMPKTIMHLMIINTKDFIHSDLLANLYSCGDQNTLMEESAEQAQHRDEMLKMYRALKEALCIIGDISTTTISTPMPPPVDDSWLQVQNMPTGRRSPTSSPTPQRRAPAVPPTRPGSRGPAPGPPPPGSTLGSAPPVPSRPGASPDPFGPPPQIPSRPN---RAPPGVPRRT 866          
BLAST of Dynamin-1 vs. Ensembl Xenopus
Match: ei24 (etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-990260])

HSP 1 Score: 1080.86 bits (2794), Expect = 0.000e+0
Identity = 566/872 (64.91%), Postives = 673/872 (77.18%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEE-------------------EKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNI 2555
            GN GME LIP+VN+LQDAFSSIG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL  S++EY EF+HCK KKFTDFDE+R EIEAETDR TG+NKGIS VPINLRVYSP+VLNLTL+DLPG+TKV VGDQP DIE QIR M+M+F+T ENCL+LAVSPANSD+ANSDALK+AKEVDP+GLRTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI+ ALA+ERKFF+SHPSYRH+ADRMGT YLQK LNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALLL VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV+KQI K+K P +KC+D+VISELI  V  CT K+  +P LREE+ERIVT  ++E+E RTKDQ+++L++I+LSYMNTNHEDFIGFANA+Q+SS + K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  + L+WYKD+E                   EKE K++LPL+ L++RD+E GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SES    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++   K F   DLL  LY CGD  TLMEESAE+ Q R+EML+MY A+KEAL II ++ST TISTP+PPPV + WL  +N         SS   Q   P+    R     P     PP      AP VP  P  +      PP IP RP+      P I
Sbjct:    2 GNRGMEELIPLVNRLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLVNSSTEYGEFLHCKGKKFTDFDEIRLEIEAETDRATGTNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPVDIEFQIRDMLMQFVTKENCLVLAVSPANSDLANSDALKIAKEVDPKGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDIQAALAAERKFFLSHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLLMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQIKKIKEPCLKCVDMVISELIGTVRQCTKKLSQYPHLREEMERIVTTHIREREGRTKDQVMLLIDIELSYMNTNHEDFIGFANAQQRSSQTNKKKASGNQDE--------ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEMEKKYMLPVDNLKLRDIKEKEKKYMLPLDNLKLRDIEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERAGDKDKASESEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTIRDLMPKTIMHLMIINTKDFIHSDLLANLYSCGDQNTLMEESAEQAQHRDEMLKMYRALKEALCIIGDISTTTISTPMPPPVDDSWLQVQNMPTGRRSPTSSPTPQRRAPAVPPTRPGSRGPAPGPPPPGSTLGSAPPVPSRPGASPDPFGPPPQIPSRPNRAPPGVPRI 865          
BLAST of Dynamin-1 vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 1112.44 bits (2876), Expect = 0.000e+0
Identity = 562/857 (65.58%), Postives = 681/857 (79.46%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSRS 2567
            GN GME LIP+VN+LQDAFS+IG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  S +EYAEF+HCK KKFTDF+EVR EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQPPDIE QIR M+M+F+T ENCLILAVSPANSD+ANSDALK+AKEVDPQG RTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI  ALA+ERKFF+SHPSYRH+ADRMGT YLQKVLNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV+KQ+ K++ P +KC+D+VISELI  V  CT K++ +PRLREE+ERIVT  ++E+E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+S+   K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SE+    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II +++T T+STP+PPPV + WL  ++         SS   Q   P+    R     P     P       AP VP  P  +      PP +P RP+   ++ P +PSRS
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDE--------ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPN---RAPPGVPSRS 847          
BLAST of Dynamin-1 vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 1111.67 bits (2874), Expect = 0.000e+0
Identity = 562/856 (65.65%), Postives = 679/856 (79.32%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSR 2564
            GN GME LIP+VN+LQDAFS+IG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  S +EYAEF+HCK KKFTDF+EVR EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQPPDIE QIR M+M+F+T ENCLILAVSPANSD+ANSDALK+AKEVDPQG RTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI  ALA+ERKFF+SHPSYRH+ADRMGT YLQKVLNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV+KQ+ K++ P +KC+D+VISELI  V  CT K++ +PRLREE+ERIVT  ++E+E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+S+   K K  GNQV            IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SE+    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II +++T T+STP+PPPV + WL  ++         SS   Q   P+    R     P     P       AP VP  P  +      PP +P RP+   ++ P +PSR
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQV------------IRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPN---RAPPGVPSR 842          
BLAST of Dynamin-1 vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 1108.59 bits (2866), Expect = 0.000e+0
Identity = 560/855 (65.50%), Postives = 679/855 (79.42%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPS 2561
            GN GME LIP+VN+LQDAFS+IG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  S +EYAEF+HCK KKFTDF+EVR EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQPPDIE QIR M+M+F+T ENCLILAVSPANSD+ANSDALK+AKEVDPQG RTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI  ALA+ERKFF+SHPSYRH+ADRMGT YLQKVLNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV+KQ+ K++ P +KC+D+VISELI  V  CT K++ +PRLREE+ERIVT  ++E+E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+S+   K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SE+    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II +++T T+STP+PPPV + WL  ++         SS   Q   P+    R     P     P       AP VP  P  +      PP +P RP+   ++ P +PS
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDE--------ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPN---RAPPGVPS 845          
BLAST of Dynamin-1 vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 1108.21 bits (2865), Expect = 0.000e+0
Identity = 558/857 (65.11%), Postives = 679/857 (79.23%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSRS 2567
            GN GME LIP+VN+LQDAFS+IG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  S +EYAEF+HCK KKFTDF+EVR EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQPPDIE QIR M+M+F+T ENCLILAVSPANSD+ANSDALK+AKEVDPQG RTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI  ALA+ERKFF+SHPSYRH+ADRMGT YLQKVLNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPD+AFE  V+KQ+ KLK P+IKC+D+V+SEL   +  C+ K++ +PRLREE+ERIVT  ++E+E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+S+   K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SE+    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II +++T T+STP+PPPV + WL  ++         SS   Q   P+    R     P     P       AP VP  P  +      PP +P RP+   ++ P +PSRS
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTSTIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDE--------ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPN---RAPPGVPSRS 847          
BLAST of Dynamin-1 vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 1107.43 bits (2863), Expect = 0.000e+0
Identity = 559/853 (65.53%), Postives = 675/853 (79.13%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNI 2555
            GN GME LIP+VN+LQDAFS+IG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  S +EYAEF+HCK KKFTDF+EVR EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQPPDIE QIR M+M+F+T ENCLILAVSPANSD+ANSDALK+AKEVDPQG RTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI  ALA+ERKFF+SHPSYRH+ADRMGT YLQKVLNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV+KQ+ K++ P +KC+D+VISELI  V  CT K++ +PRLREE+ERIVT  ++E+E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+S+   K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SE+    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II +++T T+STP+PPPV + WL  ++         SS   Q   P+    R     P     P       AP VP  P  +      PP +P RP+      P I
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDE--------ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAPPGVPRI 846          
BLAST of Dynamin-1 vs. UniProt/SwissProt
Match: sp|Q05193|DYN1_HUMAN (Dynamin-1 OS=Homo sapiens OX=9606 GN=DNM1 PE=1 SV=2)

HSP 1 Score: 1111.29 bits (2873), Expect = 0.000e+0
Identity = 561/857 (65.46%), Postives = 681/857 (79.46%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSRS 2567
            GN GME LIP+VN+LQDAFS+IG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  + +EYAEF+HCK KKFTDF+EVR EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQPPDIE QIR M+M+F+T ENCLILAVSPANSD+ANSDALK+AKEVDPQG RTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI  ALA+ERKFF+SHPSYRH+ADRMGT YLQKVLNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV+KQ+ K++ P +KC+D+VISELI  V  CT K++ +PRLREE+ERIVT  ++E+E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+S+   K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SE+    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II +++T T+STP+PPPV + WL  ++         SS   Q   P+    R     P     P       AP VP  P  +      PP +P RP+   ++ P +PSRS
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDE--------ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPN---RAPPGVPSRS 847          
BLAST of Dynamin-1 vs. UniProt/SwissProt
Match: sp|P39053|DYN1_MOUSE (Dynamin-1 OS=Mus musculus OX=10090 GN=Dnm1 PE=1 SV=2)

HSP 1 Score: 1108.59 bits (2866), Expect = 0.000e+0
Identity = 560/855 (65.50%), Postives = 679/855 (79.42%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPS 2561
            GN GME LIP+VN+LQDAFS+IG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  S +EYAEF+HCK KKFTDF+EVR EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQPPDIE QIR M+M+F+T ENCLILAVSPANSD+ANSDALK+AKEVDPQG RTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI  ALA+ERKFF+SHPSYRH+ADRMGT YLQKVLNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV+KQ+ K++ P +KC+D+VISELI  V  CT K++ +PRLREE+ERIVT  ++E+E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+S+   K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SE+    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II +++T T+STP+PPPV + WL  ++         SS   Q   P+    R     P     P       AP VP  P  +      PP +P RP+   ++ P +PS
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDE--------ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPN---RAPPGVPS 845          
BLAST of Dynamin-1 vs. UniProt/SwissProt
Match: sp|P21575|DYN1_RAT (Dynamin-1 OS=Rattus norvegicus OX=10116 GN=Dnm1 PE=1 SV=2)

HSP 1 Score: 1108.21 bits (2865), Expect = 0.000e+0
Identity = 558/857 (65.11%), Postives = 679/857 (79.23%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSRS 2567
            GN GME LIP+VN+LQDAFS+IG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  S +EYAEF+HCK KKFTDF+EVR EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQPPDIE QIR M+M+F+T ENCLILAVSPANSD+ANSDALK+AKEVDPQG RTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI  ALA+ERKFF+SHPSYRH+ADRMGT YLQKVLNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPD+AFE  V+KQ+ KLK P+IKC+D+V+SEL   +  C+ K++ +PRLREE+ERIVT  ++E+E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+S+   K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SE+    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II +++T T+STP+PPPV + WL  ++         SS   Q   P+    R     P     P       AP VP  P  +      PP +P RP+   ++ P +PSRS
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTSTIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDE--------ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPN---RAPPGVPSRS 847          
BLAST of Dynamin-1 vs. UniProt/SwissProt
Match: sp|Q08DF4|DYN1_BOVIN (Dynamin-1 OS=Bos taurus OX=9913 GN=DNM1 PE=2 SV=1)

HSP 1 Score: 1104.74 bits (2856), Expect = 0.000e+0
Identity = 558/863 (64.66%), Postives = 678/863 (78.56%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-----QESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN---------SSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXL---APTVPKSPNLT-----------SASNLIPPLIPQRPSGGGKSTPN 2552
            GN GME LIP+VN+LQDAFS+IG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  + +EYAEF+HCK KKFTDF+EVR EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQPPDIE QIR M+M+F+T ENCLILAVSPANSD+ANSDALK+AKEVDPQG RTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDIDGKKDI  ALA+ERKFF+SHPSYRH+ADRMGT YLQKVLNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPD+AFE  V+KQ+ KLK P+IKC+D+V+SEL   +  C+ K++ +PRLREE+ERIVT  ++E+E RTK+Q+++L++I+L+YMNTNHEDFIGFANA+Q+S+   K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  + L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP +     + SE+    +D+ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q+R+EMLRMY A+KEAL II +++T T+STP+PPPV + WL  ++         SS   Q   P+    R     P     P       AP VP  P  +           S  N  PP +P +P G GKS P+
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTATIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKASGNQDE--------ILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPTGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAPPGVPSQPIGSGKSIPS 856          
BLAST of Dynamin-1 vs. UniProt/SwissProt
Match: sp|P39052|DYN2_RAT (Dynamin-2 OS=Rattus norvegicus OX=10116 GN=Dnm2 PE=1 SV=1)

HSP 1 Score: 1081.63 bits (2796), Expect = 0.000e+0
Identity = 547/839 (65.20%), Postives = 668/839 (79.62%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXLAPTVPKSPNLTSASNLIPPLIPQRPSGGGK--STPNIPSR 2564
            GN GME LIP+VNKLQDAFSSIG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPL+LQL FS +EYAEF+HCK+KKFTDFDEVR+EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTLIDLPG+TKV VGDQPPDIE QI+ MI++FI+ E+ LILAV+PAN D+ANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAR++LENKLLPLRRGYIGVVNRSQKDI+G+KDI+ ALA+ERKFF+SHP+YRHMADRMGT +LQK LNQQLTNHIRE+LP LR+ LQSQLLS+EKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G ++DT  LSGGA IN+IFHERFP+ELVK+E DEK LR EISYAIKNIHG+RTGLFTPD+AFE IV+KQ+ KLK P +KC+DLVI ELI  V  CT+K+ ++PRLREE ERIVT  ++E+E RTKDQ+++L++I+ SY+NTNHEDFIGFANA+Q+S+   K        R +     + +IR+GWLTI NI +++ G +++WF+L  ++L+WYKDEEEKE K++LPL+ L+IRDVE GF   K++FA+FN + +NVYKD +Q+EL  +SQE +D WKASFLRAG+YP K ++E+ +   +N+   DP LERQVETIRNLV+SY+ IINK+ RDL+PKTIMH+++N  K F   +LL  LY   D ++LMEESAE+ Q+R++MLRMY A+KEAL II ++ST T+STPVPPPV + WL  +N+SS +  P   P  +                     P  P         PPLIP  P G     S P IPSR
Sbjct:    2 GNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIEGRKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPTLRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKLKEPCLKCVDLVIQELISTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNHEDFIGFANAQQRSTQLNKK-------RAIPNQGEILVIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESAEQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWL--QNTSSHSPTPQRRPVSSVHP------------------PGRPPAVRGPTPGPPLIPM-PVGATSSFSAPPIPSR 812          
BLAST of Dynamin-1 vs. TrEMBL
Match: A0A094ZKG0 (Dynamin-1 OS=Schistosoma haematobium OX=6185 GN=MS3_03369 PE=3 SV=1)

HSP 1 Score: 1182.55 bits (3058), Expect = 0.000e+0
Identity = 570/769 (74.12%), Postives = 673/769 (87.52%), Query Frame = 3
Query:   48 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQ-GDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAE 2351
            M GN GME LIP+VN+LQDAFSS+G+P+NLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  S +EYAEF+HCKNK+FTDFDEVRKEIEAETDRLTGSNKGIS+ PINLRVYSP+VLNLTLIDLPG+TKV VGDQP DIE QIRSMI+EFIT ENCLILAVSPANSD+ANSDALKL+KEVDPQGLRTIGV+TKLDLMD+GTDAREILEN+LLPLRRGYIGVVNRSQ+DI+G+KDIK ALA+ERKFF+SHPSYRHMADRMGT +LQ  LNQQLTNHIR+TLP LRN LQSQ+L+MEKEV EY++ +P DPS+KTKALLLTVQ FE +F  AIDG GSEIDT TLSGGALIN+IFHER PYE+ KIE DE++LR EISYAI+NIHGIRTGLFTPD+AFETI RKQIDK+K P++KC DLV+++L ++VH CTA+MENFPRLREE ERIV Q ++E+E+R +DQ+++LV+IQLSYMNTNHEDFIGF +AEQ+SS+  KNK GN+VS          +IRKGWL++QN+ +LR G +DFWF+LNT++LTWYKD+EEKE ++VL L+GL+IRD+E+GF+GKK+ FALF PD+ NVYKDYKQLEL AES EL+D WKASFLRAG+YP K +SE       +S++  +P LERQVE IRNLV+SYM+I+ KTQ DLVPK +MHM+VNE+K F +G+LLP LYQ GD  +LM ES    QKR+EM+R+YDAMKEAL IISEVS  T+STP+PPPV ++WL ++
Sbjct:    1 MSGNVGMEQLIPLVNRLQDAFSSLGVPLNLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLINSRNEYAEFLHCKNKQFTDFDEVRKEIEAETDRLTGSNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVPVGDQPLDIEVQIRSMILEFITQENCLILAVSPANSDLANSDALKLSKEVDPQGLRTIGVVTKLDLMDQGTDAREILENRLLPLRRGYIGVVNRSQRDIEGRKDIKAALAAERKFFLSHPSYRHMADRMGTPFLQSTLNQQLTNHIRDTLPGLRNKLQSQMLAMEKEVEEYKHYKPSDPSFKTKALLLTVQSFEKDFHHAIDGGGSEIDTKTLSGGALINRIFHERLPYEMNKIETDEEELRKEISYAIRNIHGIRTGLFTPDLAFETITRKQIDKMKIPSLKCADLVVAQLTEIVHACTARMENFPRLREETERIVNQWIREREIRARDQIVLLVDIQLSYMNTNHEDFIGFESAEQQSSEVAKNKPGNKVSS---------VIRKGWLSLQNVTLLRGGNKDFWFVLNTESLTWYKDDEEKEKRYVLLLDGLKIRDIETGFFGKKHAFALFYPDNHNVYKDYKQLELCAESAELVDSWKASFLRAGVYPAKTKSEKTEQSDTSSLESSEPQLERQVEIIRNLVDSYMKIVIKTQLDLVPKLLMHMLVNEIKSFLKGELLPNLYQAGDLNSLMSESLGVQQKRDEMVRVYDAMKEALNIISEVSMSTVSTPIPPPVNDDWLQSD 760          
BLAST of Dynamin-1 vs. TrEMBL
Match: A0A5K4EDF9 (Dynamin, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1181.78 bits (3056), Expect = 0.000e+0
Identity = 570/766 (74.41%), Postives = 671/766 (87.60%), Query Frame = 3
Query:   48 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWL 2342
            M GN GME LIP+VN+LQDAFSS+G+P+NLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  S +EYAEF+HCKNK+FTDFDEVRKEIEAETDRLTGSNKGIS+ PINLRVYSP+VLNLTLIDLPG+TKV VGDQPPDIE QIRSMI+EFIT ENCLILAVSPANSD+ANSDALKL+KEVDPQGLRTIGV+TKLDLMD+GTDAREILEN+LLPLRRGYIGVVNRSQ+DI+G+KDIK ALA+ERKFF+SH SYRHMADRMGT +LQ  LNQQLTNHIR+TLP LRN LQSQ+L+MEKEV EY++ +P DPS+KTKALLLTVQ FE +F  AIDG GSEIDT TLSGGALIN+IFHER PYE+ KIE DE++LR EISYAI+NIHGIRTGLFTPD+AFETI RKQIDK+K P++KC DLV+++L ++VH CTA+MENFPRLREE ERIV Q ++E+E+R +DQ+++LV+IQLSYMNTNHEDFIGF +AEQ+SS+  KNK GN+VS          +IRKGWL++QN+ +LR G +DFWF+LNT++LTWYKD+EEKE ++VL L+GL+IRD+E+GF+GKK+ FALF PD+ NVYKDYKQLEL AES EL+D WKASFLRAG+YP K +SE       +S++  +P LERQVE IRNLV+SYM+I+ KTQ DLVPK +MHM+VNE+K F +G+LLP LYQ GD  +LM ES    QKR+EM+R+YDAMKEAL IISEVS  T+STP+PPPV ++WL
Sbjct:    1 MSGNIGMEQLIPLVNRLQDAFSSLGVPLNLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLINSRNEYAEFLHCKNKQFTDFDEVRKEIEAETDRLTGSNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVPVGDQPPDIEVQIRSMILEFITQENCLILAVSPANSDLANSDALKLSKEVDPQGLRTIGVVTKLDLMDQGTDAREILENRLLPLRRGYIGVVNRSQRDIEGRKDIKAALAAERKFFLSHSSYRHMADRMGTPFLQSTLNQQLTNHIRDTLPGLRNKLQSQMLAMEKEVEEYKHYKPSDPSFKTKALLLTVQSFEKDFHHAIDGGGSEIDTKTLSGGALINRIFHERLPYEMNKIETDEEELRKEISYAIRNIHGIRTGLFTPDLAFETITRKQIDKMKIPSLKCADLVVAQLTEIVHACTARMENFPRLREETERIVNQWIREREIRARDQIVLLVDIQLSYMNTNHEDFIGFESAEQQSSEVAKNKPGNKVSS---------VIRKGWLSLQNVTLLRGGNKDFWFVLNTESLTWYKDDEEKEKRYVLLLDGLKIRDIETGFFGKKHAFALFYPDNHNVYKDYKQLELCAESAELVDSWKASFLRAGVYPAKTKSEKTEQSDSSSLEASEPQLERQVEIIRNLVDSYMKIVIKTQLDLVPKLLMHMLVNEIKSFLKGELLPNLYQAGDLNSLMSESLGVQQKRDEMVRVYDAMKEALNIISEVSMSTVSTPIPPPVNDDWL 757          
BLAST of Dynamin-1 vs. TrEMBL
Match: A0A5K4ED86 (Dynamin, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1178.31 bits (3047), Expect = 0.000e+0
Identity = 569/766 (74.28%), Postives = 669/766 (87.34%), Query Frame = 3
Query:   48 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWL 2342
            M GN GME LIP+VN+LQDAFSS+G+P+NLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  S +EYAEF+HCKNK+FTDFDEVRKEIEAETDRLTGSNKGIS+ PINLRVYSP+VLNLTLIDLPG+TKV VGDQPPDIE QIRSMI+EFIT ENCLILAVSPANSD+ANSDALKL+KEVDPQGLRTIGV+TKLDLMD+GTDAREILEN+LLPLRRGYIGVVNRSQ+DI+G+KDIK ALA+ERKFF+SH SYRHMADRMGT +LQ  LNQQLTNHIR+TLP LRN LQSQ+L+MEKEV EY++ +P DPS+KTKALLLTVQ FE +F  AIDG GSEIDT TLSGGALIN+IFHER PYE+ KIE DE++LR EISYAI+NIHGIRTGLFTPD+AFETI RKQIDK+K P++KC DLV+++L ++VH CTA+MENFPRLREE ERIV Q ++E+E+R +DQ+++LV+IQLSYMNTNHEDFIGF +AEQ+SS+  KNK GN+V            IRKGWL++QN+ +LR G +DFWF+LNT++LTWYKD+EEKE ++VL L+GL+IRD+E+GF+GKK+ FALF PD+ NVYKDYKQLEL AES EL+D WKASFLRAG+YP K +SE       +S++  +P LERQVE IRNLV+SYM+I+ KTQ DLVPK +MHM+VNE+K F +G+LLP LYQ GD  +LM ES    QKR+EM+R+YDAMKEAL IISEVS  T+STP+PPPV ++WL
Sbjct:    1 MSGNIGMEQLIPLVNRLQDAFSSLGVPLNLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLINSRNEYAEFLHCKNKQFTDFDEVRKEIEAETDRLTGSNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVPVGDQPPDIEVQIRSMILEFITQENCLILAVSPANSDLANSDALKLSKEVDPQGLRTIGVVTKLDLMDQGTDAREILENRLLPLRRGYIGVVNRSQRDIEGRKDIKAALAAERKFFLSHSSYRHMADRMGTPFLQSTLNQQLTNHIRDTLPGLRNKLQSQMLAMEKEVEEYKHYKPSDPSFKTKALLLTVQSFEKDFHHAIDGGGSEIDTKTLSGGALINRIFHERLPYEMNKIETDEEELRKEISYAIRNIHGIRTGLFTPDLAFETITRKQIDKMKIPSLKCADLVVAQLTEIVHACTARMENFPRLREETERIVNQWIREREIRARDQIVLLVDIQLSYMNTNHEDFIGFESAEQQSSEVAKNKPGNKV------------IRKGWLSLQNVTLLRGGNKDFWFVLNTESLTWYKDDEEKEKRYVLLLDGLKIRDIETGFFGKKHAFALFYPDNHNVYKDYKQLELCAESAELVDSWKASFLRAGVYPAKTKSEKTEQSDSSSLEASEPQLERQVEIIRNLVDSYMKIVIKTQLDLVPKLLMHMLVNEIKSFLKGELLPNLYQAGDLNSLMSESLGVQQKRDEMVRVYDAMKEALNIISEVSMSTVSTPIPPPVNDDWL 754          
BLAST of Dynamin-1 vs. TrEMBL
Match: A0A5K4EE90 (Dynamin, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1177.93 bits (3046), Expect = 0.000e+0
Identity = 569/766 (74.28%), Postives = 669/766 (87.34%), Query Frame = 3
Query:   48 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWL 2342
            M GN GME LIP+VN+LQDAFSS+G+P+NLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  S +EYAEF+HCKNK+FTDFDEVRKEIEAETDRLTGSNKGIS+ PINLRVYSP+VLNLTLIDLPG+TKV VGDQPPDIE QIRSMI+EFIT ENCLILAVSPANSD+ANSDALKL+KEVDPQGLRTIGV+TKLDLMD+GTDAREILEN+LLPLRRGYIGVVNRSQ+DI+G+KDIK ALA+ERKFF+SH SYRHMADRMGT +LQ  LNQQLTNHIR+TLP LRN LQSQ+L+MEKEV EY++ +P DPS+KTKALLLTVQ FE +F  AIDG GSEIDT TLSGGALIN+IFHER PYE+ KIE DE++LR EISYAI+NIHGIRTGLFTPD+AFETI RKQIDK+K P++KC DLV+++L ++VH CTA+MENFPRLREE ERIV Q ++E+E+R +DQ+++LV+IQLSYMNTNHEDFIGF +AEQ+SS+  KNK GN+V            IRKGWL++QN+ +LR G +DFWF+LNT++LTWYKD+EEKE ++VL L+GL+IRD+E+GF+GKK+ FALF PD+ NVYKDYKQLEL AES EL+D WKASFLRAG+YP K +SE       +S++  +P LERQVE IRNLV+SYM+I+ KTQ DLVPK +MHM+VNE+K F +G+LLP LYQ GD  +LM ES    QKR+EM+R+YDAMKEAL IISEVS  T+STP+PPPV ++WL
Sbjct:    1 MSGNIGMEQLIPLVNRLQDAFSSLGVPLNLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLINSRNEYAEFLHCKNKQFTDFDEVRKEIEAETDRLTGSNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVPVGDQPPDIEVQIRSMILEFITQENCLILAVSPANSDLANSDALKLSKEVDPQGLRTIGVVTKLDLMDQGTDAREILENRLLPLRRGYIGVVNRSQRDIEGRKDIKAALAAERKFFLSHSSYRHMADRMGTPFLQSTLNQQLTNHIRDTLPGLRNKLQSQMLAMEKEVEEYKHYKPSDPSFKTKALLLTVQSFEKDFHHAIDGGGSEIDTKTLSGGALINRIFHERLPYEMNKIETDEEELRKEISYAIRNIHGIRTGLFTPDLAFETITRKQIDKMKIPSLKCADLVVAQLTEIVHACTARMENFPRLREETERIVNQWIREREIRARDQIVLLVDIQLSYMNTNHEDFIGFESAEQQSSEVAKNKPGNKV------------IRKGWLSLQNVTLLRGGNKDFWFVLNTESLTWYKDDEEKEKRYVLLLDGLKIRDIETGFFGKKHAFALFYPDNHNVYKDYKQLELCAESAELVDSWKASFLRAGVYPAKTKSEKTEQSDSSSLEASEPQLERQVEIIRNLVDSYMKIVIKTQLDLVPKLLMHMLVNEIKSFLKGELLPNLYQAGDLNSLMSESLGVQQKRDEMVRVYDAMKEALNIISEVSMSTVSTPIPPPVNDDWL 754          
BLAST of Dynamin-1 vs. TrEMBL
Match: C4Q9B4 (Dynamin, putative OS=Schistosoma mansoni OX=6183 GN=Smp_044920 PE=3 SV=2)

HSP 1 Score: 1177.93 bits (3046), Expect = 0.000e+0
Identity = 569/766 (74.28%), Postives = 669/766 (87.34%), Query Frame = 3
Query:   48 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWL 2342
            M GN GME LIP+VN+LQDAFSS+G+P+NLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  S +EYAEF+HCKNK+FTDFDEVRKEIEAETDRLTGSNKGIS+ PINLRVYSP+VLNLTLIDLPG+TKV VGDQPPDIE QIRSMI+EFIT ENCLILAVSPANSD+ANSDALKL+KEVDPQGLRTIGV+TKLDLMD+GTDAREILEN+LLPLRRGYIGVVNRSQ+DI+G+KDIK ALA+ERKFF+SH SYRHMADRMGT +LQ  LNQQLTNHIR+TLP LRN LQSQ+L+MEKEV EY++ +P DPS+KTKALLLTVQ FE +F  AIDG GSEIDT TLSGGALIN+IFHER PYE+ KIE DE++LR EISYAI+NIHGIRTGLFTPD+AFETI RKQIDK+K P++KC DLV+++L ++VH CTA+MENFPRLREE ERIV Q ++E+E+R +DQ+++LV+IQLSYMNTNHEDFIGF +AEQ+SS+  KNK GN+V            IRKGWL++QN+ +LR G +DFWF+LNT++LTWYKD+EEKE ++VL L+GL+IRD+E+GF+GKK+ FALF PD+ NVYKDYKQLEL AES EL+D WKASFLRAG+YP K +SE       +S++  +P LERQVE IRNLV+SYM+I+ KTQ DLVPK +MHM+VNE+K F +G+LLP LYQ GD  +LM ES    QKR+EM+R+YDAMKEAL IISEVS  T+STP+PPPV ++WL
Sbjct:    1 MSGNIGMEQLIPLVNRLQDAFSSLGVPLNLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLINSRNEYAEFLHCKNKQFTDFDEVRKEIEAETDRLTGSNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVPVGDQPPDIEVQIRSMILEFITQENCLILAVSPANSDLANSDALKLSKEVDPQGLRTIGVVTKLDLMDQGTDAREILENRLLPLRRGYIGVVNRSQRDIEGRKDIKAALAAERKFFLSHSSYRHMADRMGTPFLQSTLNQQLTNHIRDTLPGLRNKLQSQMLAMEKEVEEYKHYKPSDPSFKTKALLLTVQSFEKDFHHAIDGGGSEIDTKTLSGGALINRIFHERLPYEMNKIETDEEELRKEISYAIRNIHGIRTGLFTPDLAFETITRKQIDKMKIPSLKCADLVVAQLTEIVHACTARMENFPRLREETERIVNQWIREREIRARDQIVLLVDIQLSYMNTNHEDFIGFESAEQQSSEVAKNKPGNKV------------IRKGWLSLQNVTLLRGGNKDFWFVLNTESLTWYKDDEEKEKRYVLLLDGLKIRDIETGFFGKKHAFALFYPDNHNVYKDYKQLELCAESAELVDSWKASFLRAGVYPAKTKSEKTEQSDSSSLEASEPQLERQVEIIRNLVDSYMKIVIKTQLDLVPKLLMHMLVNEIKSFLKGELLPNLYQAGDLNSLMSESLGVQQKRDEMVRVYDAMKEALNIISEVSMSTVSTPIPPPVNDDWL 754          
BLAST of Dynamin-1 vs. Ensembl Cavefish
Match: dnm1b (dynamin-1 [Source:NCBI gene;Acc:103047879])

HSP 1 Score: 1096.65 bits (2835), Expect = 0.000e+0
Identity = 556/850 (65.41%), Postives = 674/850 (79.29%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNK-LGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYP--VKQESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENS--------SSFNQMXXXXXXXXXXXXXXXXXXXXXXXXLAPTVP-KSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSR 2564
            GN GME LIP+VNKLQDAFS+IG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL    +EYAEF+HCK KKFTDFDEVR+EIEAETDR+TG NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQP DIE QI+ M+M+F+T ENCL+LAVSPANSD+ANSDALK+AKEVDPQGLRTIGVITKLDLMDEGTDAR+ILENKLLPLRRGYIGVVNRSQKDIDGKKDI  A+A+ERKFF++HPSYRH+A+RMGT YLQK+LNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDPS KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV++QI K+K P  KC+DLVISEL+  V  CT K+  +P LREE+ERIVTQ ++++E RTK Q+++L++++L+YMNTNHEDFIGFANA+Q+SS   K K  GN+          + +IRKGWLTI NI +++ G +++WF+L  +TL+WYKD+EEKE K++LP++ L++RD+E  F   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP  + Q   S  + +++ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q R+EMLRMY A+KEAL II ++ST T+ST +PPPV + WL  +          SS        PG  R      PG         P+ P  SP+  S +   PP +P RP+   ++ P +PSR
Sbjct:    2 GNRGMEDLIPLVNKLQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGQNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPSDIEFQIKDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDITAAMAAERKFFLTHPSYRHLAERMGTPYLQKILNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKCIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAKIKEPCQKCVDLVISELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKGQVMLLIDVELAYMNTNHEDFIGFANAQQRSSQMSKKKDAGNKDE--------IMVIRKGWLTINNIGIMKGGAKEYWFVLTAETLSWYKDDEEKEKKYMLPVDNLKLRDIEKSFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERIMQSEASEESSSESFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIHAELLAQLYSCGDQNTLMEESAEQAQHRDEMLRMYYALKEALNIIGDISTTTVSTSLPPPVDDSWLQVQGGPSGRRSPMSSPTPQRRAPPGPPRPGGRTAPGPPAAGAPPVPSRPGASPDPFSGA---PPQVPSRPN---RAPPGVPSR 837          
BLAST of Dynamin-1 vs. Ensembl Cavefish
Match: dnm1b (dynamin-1 [Source:NCBI gene;Acc:103047879])

HSP 1 Score: 1095.49 bits (2832), Expect = 0.000e+0
Identity = 557/854 (65.22%), Postives = 674/854 (78.92%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNK-LGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYP------VKQESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENS--------SSFNQMXXXXXXXXXXXXXXXXXXXXXXXXLAPTVP-KSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSR 2564
            GN GME LIP+VNKLQDAFS+IG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL    +EYAEF+HCK KKFTDFDEVR+EIEAETDR+TG NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQP DIE QI+ M+M+F+T ENCL+LAVSPANSD+ANSDALK+AKEVDPQGLRTIGVITKLDLMDEGTDAR+ILENKLLPLRRGYIGVVNRSQKDIDGKKDI  A+A+ERKFF++HPSYRH+A+RMGT YLQK+LNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDPS KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV++QI K+K P  KC+DLVISEL+  V  CT K+  +P LREE+ERIVTQ ++++E RTK Q+++L++++L+YMNTNHEDFIGFANA+Q+SS   K K  GN+          + +IRKGWLTI NI +++ G +++WF+L  +TL+WYKD+EEKE K++LP++ L++RD+E  F   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP       KQ   S  + +++ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q R+EMLRMY A+KEAL II ++ST T+ST +PPPV + WL  +          SS        PG  R      PG         P+ P  SP+  S +   PP +P RP+   ++ P +PSR
Sbjct:    2 GNRGMEDLIPLVNKLQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGQNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPSDIEFQIKDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDITAAMAAERKFFLTHPSYRHLAERMGTPYLQKILNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKCIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAKIKEPCQKCVDLVISELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKGQVMLLIDVELAYMNTNHEDFIGFANAQQRSSQMSKKKDAGNKDE--------IMVIRKGWLTINNIGIMKGGAKEYWFVLTAETLSWYKDDEEKEKKYMLPVDNLKLRDIEKSFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERIMDKEKQSEASEESSSESFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIHAELLAQLYSCGDQNTLMEESAEQAQHRDEMLRMYYALKEALNIIGDISTTTVSTSLPPPVDDSWLQVQGGPSGRRSPMSSPTPQRRAPPGPPRPGGRTAPGPPAAGAPPVPSRPGASPDPFSGA---PPQVPSRPN---RAPPGVPSR 841          
BLAST of Dynamin-1 vs. Ensembl Cavefish
Match: dnm1b (dynamin-1 [Source:NCBI gene;Acc:103047879])

HSP 1 Score: 1094.72 bits (2830), Expect = 0.000e+0
Identity = 558/854 (65.34%), Postives = 673/854 (78.81%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNK-LGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYP------VKQESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENS--------SSFNQMXXXXXXXXXXXXXXXXXXXXXXXXLAPTVP-KSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSR 2564
            GN GME LIP+VNKLQDAFS+IG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL    +EYAEF+HCK KKFTDFDEVR+EIEAETDR+TG NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQP DIE QI+ M+M+F+T ENCL+LAVSPANSD+ANSDALK+AKEVDPQGLRTIGVITKLDLMDEGTDAR+ILENKLLPLRRGYIGVVNRSQKDIDGKKDI  A+A+ERKFF++HPSYRH+A+RMGT YLQK+LNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDPS KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV++QI K+K P  KC+DLVISEL+  V  CT K+  +P LREE+ERIVTQ ++++E RTK Q+++L++++L+YMNTNHEDFIGFANA+Q+SS   K K  GN+V            IRKGWLTI NI +++ G +++WF+L  +TL+WYKD+EEKE K++LP++ L++RD+E  F   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP       KQ   S  + +++ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q R+EMLRMY A+KEAL II ++ST T+ST +PPPV + WL  +          SS        PG  R      PG         P+ P  SP+  S +   PP +P RP+   ++ P +PSR
Sbjct:    2 GNRGMEDLIPLVNKLQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGQNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPSDIEFQIKDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDITAAMAAERKFFLTHPSYRHLAERMGTPYLQKILNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKCIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAKIKEPCQKCVDLVISELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKGQVMLLIDVELAYMNTNHEDFIGFANAQQRSSQMSKKKDAGNKV------------IRKGWLTINNIGIMKGGAKEYWFVLTAETLSWYKDDEEKEKKYMLPVDNLKLRDIEKSFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERIMDKEKQSEASEESSSESFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIHAELLAQLYSCGDQNTLMEESAEQAQHRDEMLRMYYALKEALNIIGDISTTTVSTSLPPPVDDSWLQVQGGPSGRRSPMSSPTPQRRAPPGPPRPGGRTAPGPPAAGAPPVPSRPGASPDPFSGA---PPQVPSRPN---RAPPGVPSR 837          
BLAST of Dynamin-1 vs. Ensembl Cavefish
Match: dnm1b (dynamin-1 [Source:NCBI gene;Acc:103047879])

HSP 1 Score: 1093.18 bits (2826), Expect = 0.000e+0
Identity = 537/778 (69.02%), Postives = 646/778 (83.03%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNK-LGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYP------VKQESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSS 2363
            GN GME LIP+VNKLQDAFS+IG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL    +EYAEF+HCK KKFTDFDEVR+EIEAETDR+TG NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQP DIE QI+ M+M+F+T ENCL+LAVSPANSD+ANSDALK+AKEVDPQGLRTIGVITKLDLMDEGTDAR+ILENKLLPLRRGYIGVVNRSQKDIDGKKDI  A+A+ERKFF++HPSYRH+A+RMGT YLQK+LNQQLTNHIR+TLP LRN LQSQLLS+EKEV EY+N RPDDPS KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPDMAFETIV++QI K+K P  KC+DLVISEL+  V  CT K+  +P LREE+ERIVTQ ++++E RTK Q+++L++++L+YMNTNHEDFIGFANA+Q+SS   K K  GN+          + +IRKGWLTI NI +++ G +++WF+L  +TL+WYKD+EEKE K++LP++ L++RD+E  F   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+YP       KQ   S  + +++ +   DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q R+EMLRMY A+KEAL II ++ST T+ST +PPPV + WL  +   S
Sbjct:    2 GNRGMEDLIPLVNKLQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGQNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPSDIEFQIKDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDITAAMAAERKFFLTHPSYRHLAERMGTPYLQKILNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKCIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAKIKEPCQKCVDLVISELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKGQVMLLIDVELAYMNTNHEDFIGFANAQQRSSQMSKKKDAGNKDE--------IMVIRKGWLTINNIGIMKGGAKEYWFVLTAETLSWYKDDEEKEKKYMLPVDNLKLRDIEKSFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERIMDKEKQSEASEESSSESFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIHAELLAQLYSCGDQNTLMEESAEQAQHRDEMLRMYYALKEALNIIGDISTTTVSTSLPPPVDDSWLQVQGGPS 771          
BLAST of Dynamin-1 vs. Ensembl Cavefish
Match: dnm1a (dynamin-1 [Source:NCBI gene;Acc:103024863])

HSP 1 Score: 1091.64 bits (2822), Expect = 0.000e+0
Identity = 529/773 (68.43%), Postives = 642/773 (83.05%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKL-GNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQG--DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSS 2363
            GN GME LIP+VN++QDAFS+IG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL    +EYAEF+HCK KKFTDFDEVR+EIEAETDR+TG NKGIS VPINLRVYSP+VLNLTL+DLPG+TKV VGDQP DIE QI+ M+M+F+T ENCL+LAVSPANSD+ANSDALK+AKEVDPQGLRTIGVITKLDLMDEGTDAR+ILENKLLPLRRGYIGVVNRSQKDIDG+KDI  A+A+ERKFF++HP YRH+ADRMGT YLQK LNQQLTNHIR+TLP LR+ LQSQLLS+EKEV EY+N RPDDPS KTKALL  VQ+F  +F + I+G+G +IDT+ LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAIKNIHGIRTGLFTPD+AFE IV+KQI KLK P +KCID+V+SEL   +  C+ K+  +P LREE+ERIVTQ ++++E RTKDQ+++L++I+L+YMNTNHEDFIGFANA+Q+SS   K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  ++L+WYKD+EEKE K++L ++ L++RDVE  F   K+IFALFN + +NVYKDY+QLEL  E+QE +D WKASFLRAG+Y  +  S+++     +S     DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  TLMEESAE+ Q R+EMLRMY A++EAL II ++ST TIST +PPPV + WL  + + S
Sbjct:    2 GNRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKEMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFFLTHPGYRHLADRMGTPYLQKTLNQQLTNHIRDTLPGLRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFSVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDLAFEAIVKKQIQKLKSPVLKCIDMVVSELTSTIRKCSEKLAQYPMLREEMERIVTQHIRDRESRTKDQVMLLIDIELAYMNTNHEDFIGFANAQQRSSQINKKKAPGNQDE--------IMVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKSFMSSKHIFALFNTEQRNVYKDYRQLELACETQEDVDGWKASFLRAGVYAERVVSDTSEENGSDSFMHSMDPQLERQVETIRNLVDSYMGIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNTLMEESAEQAQHRDEMLRMYHALREALSIIGDISTTTISTALPPPVDDSWLQVQRTGS 766          
BLAST of Dynamin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006976.1 (pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1 gene:ENSPMAG00000006300.1 transcript:ENSPMAT00000006976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 757.288 bits (1954), Expect = 0.000e+0
Identity = 369/513 (71.93%), Postives = 440/513 (85.77%), Query Frame = 3
Query:  210 RDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSD--SGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEE 1742
            RDFLPRGSGIVTRRPL+LQL F  +EYAEF+HCK KKFTDF+EVR EIEAETDRLTGSNKGIS +PINLRVYSPHVLNLTLIDLPG+TKV VGDQP DIE QIR M+M+F+T ENCLILAVSPAN+D+ANSDALK+AKEVDPQGLRTIGVITKLDLMD+GTDAR+ILENKLLPLRRGYIGVVNRSQKDIDG+KDI  A+A+ERKFF+SHPSYRHMADRMGT YLQK LNQQLTNHIR+TLP LRN LQ Q+LSMEKEV EY+N RPDDP+ KTKALL  VQ+F  +F + I+G+G +IDT  LSGGA IN+IFHERFP+ELVK+E DEK+LR EISYAI+NI+GIRTGLFTPD+AFE IV+KQI KLK P +KC+DLV+ EL  V+  C+ K+ ++PRLR++ +RIVT  ++E+E RTKDQ+++L++IQL+YMNTNHEDFIGF+NA+Q++S   + K   GNQV            IRKGWLTI NI +++ G +++WF+L  ++L+WYKDEE
Sbjct:    1 RDFLPRGSGIVTRRPLILQLMFCKAEYAEFLHCKGKKFTDFEEVRAEIEAETDRLTGSNKGISPIPINLRVYSPHVLNLTLIDLPGMTKVPVGDQPVDIEYQIREMLMQFVTKENCLILAVSPANTDLANSDALKIAKEVDPQGLRTIGVITKLDLMDDGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFFLSHPSYRHMADRMGTPYLQKTLNQQLTNHIRDTLPALRNKLQGQMLSMEKEVEEYKNFRPDDPTRKTKALLQMVQQFAFDFEKRIEGSGDQIDTVELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIRNINGIRTGLFTPDLAFEAIVKKQIQKLKEPCLKCVDLVVGELTNVIRKCSEKLGSYPRLRDDTDRIVTTYIREREGRTKDQVLLLIDIQLAYMNTNHEDFIGFSNAQQRTSQPVAKKKAPGNQV------------IRKGWLTINNIGIMKGGSKEYWFVLTAESLSWYKDEE 501          
BLAST of Dynamin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002816.1 (pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-1 gene:ENSPMAG00000002541.1 transcript:ENSPMAT00000002816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 443.736 bits (1140), Expect = 1.102e-143
Identity = 249/552 (45.11%), Postives = 350/552 (63.41%), Query Frame = 3
Query:   66 MEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL-----------------------------NFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDC----TAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAF 1622
            ME LIP++NKLQD F+++G   ++ LPQI VVG+QS+GKSSVLE+ VGRDFLPRG+GIVTRRPLVLQL                                  E+ +F+H KNK ++DF+E+R+EIE ET+R+TG+NKGISS  I+L+++SPHVLNLTL+DLPG+TKV VGDQP DIE+QIR +I++FI   N +ILAV+ AN+D+A S+ALK+A+EVD  G RT+ VITKLDLMD GTDA +IL  +++P++ G IGVVNRSQ DI+ KK I  A+  E+ F      Y  +A+R GT +L K LN+ L +HIR+ LP+L+  +       +  +  Y N   D    K   LL  V KF  E+C  I+GT   I+T  L GGA I  IFHE F   L  ++        ++  AI+N  G R  LF P+++FE +V++QI +L+ P+++C++LV  E+ +++  C    T ++  FP+L + I  +VT  L+ +   + + +  LV I+L+Y+NT H D   FA+A   S+    N L +Q  RN T P  
Sbjct:    1 MEALIPVINKLQDVFNTVGSE-SIQLPQIVVVGAQSSGKSSVLESLVGRDFLPRGTGIVTRRPLVLQLVHVIPDERIRPGGEENGTASTAARLILFAGVEAEEWGKFLHTKNKVYSDFNEIRQEIENETERITGTNKGISSEAIHLKIFSPHVLNLTLVDLPGITKVPVGDQPVDIEQQIRELIIKFIGNPNSIILAVTAANTDLATSEALKIAREVDTDGRRTLAVITKLDLMDAGTDAMDILTGRVIPVKLGIIGVVNRSQLDINTKKTILDAMQDEQSFMQK--KYPSLANRNGTKFLGKTLNRLLMHHIRDCLPELKTRVNVMAAQYQSLLGGYGNPVDD----KNATLLQLVTKFAAEYCNTIEGTAKHIETSELCGGARICYIFHETFGRTLESVDPLGGLTTLDVLTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRRRLPVSNEMVHNLVAIELAYINTKHPD---FADASMVSTQI-NNSLEDQRRRNRTFPGM 541          

HSP 2 Score: 52.7582 bits (125), Expect = 3.138e-7
Identity = 28/76 (36.84%), Postives = 43/76 (56.58%), Query Frame = 3
Query: 2019 ERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRM 2246
            +R  E I  L++SY  I+ K  +D VPK +MH +VN VK   + +L+  LY+      L+ ES +  Q+R+E   M
Sbjct:  669 QRDCEVIEKLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDNLQSELVGQLYKQQLLDELLTESEDMAQRRKEASDM 744          
BLAST of Dynamin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002195.1 (pep scaffold:Pmarinus_7.0:GL484008:1783:12172:-1 gene:ENSPMAG00000001995.1 transcript:ENSPMAT00000002195.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 241.506 bits (615), Expect = 6.503e-73
Identity = 117/208 (56.25%), Postives = 155/208 (74.52%), Query Frame = 3
Query: 1740 EEKEVKFVLPLEGLRIRDVE-SGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYP-----VKQESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWL 2342
            +EKE K++LPL+ L++RD+E  GF   K+IFA+FN + +NVYKDY+QLEL  E QE +D WKASFLRAG+YP     VKQ+SES ++  DN     DP LERQVETIRNLV+SYM I++K  RDL+PKTIMH+++N  K F   +LL  LY   D T+LMEESAE+ Q+R+E+LRMY  +K+AL II ++S  T +TP+PPPV + W+
Sbjct:    1 QEKEKKYMLPLDNLQLRDMEKGGFMSSKHIFAIFNTEQRNVYKDYRQLELACEGQEEVDSWKASFLRAGVYPERRAYVKQQSESEDSTGDNFGNSMDPQLERQVETIRNLVDSYMGIVSKNIRDLMPKTIMHLMINNTKDFIHSELLAHLYSSSDQTSLMEESAEQAQRRDEVLRMYHTLKDALSIIGDISMSTATTPLPPPVDDSWM 208          
BLAST of Dynamin-1 vs. Ensembl Sea Lamprey
Match: mxb (myxovirus (influenza) resistance B [Source:NCBI gene;Acc:360143])

HSP 1 Score: 204.912 bits (520), Expect = 1.863e-56
Identity = 156/486 (32.10%), Postives = 249/486 (51.23%), Query Frame = 3
Query:   96 LQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCK------NKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD--AREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADR---MGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDM----AFETIVRKQIDKLKGPTIKCIDLVISEL----IKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQ 1496
            L D    +G+  ++ LP +AV+G QS+GKSSVLE   G   LPRGSGIVTR PL L+L  +   +   I  +      N K    + V   +      LTG + G+S   I L V S  V +LTLIDLPG+ +VA+  Q  DIE QI+ +I + I  +  + L V P N DIA ++ALK+A+ VDP G+RT+GV+TK DLMDEGT+  A  IL+N++ PL +GY+ V  RSQ+D++  + +  A   E  FF  HP + H+ +      T  L   L ++L ++I+ TLP+LR +L  +L     E+       PDD   K + +   V ++  +    + G      +  L    ++  +  E F   L  ++  +     E+   I+     R+G   P      AFE + R  + +L+ P +  + +  S+L    +++  D    +  F RL   ++  V  Q++ +E + +  ++ L  ++
Sbjct:   33 LIDTLRYLGVDQDVGLPAVAVIGDQSSGKSSVLEALSGVQ-LPRGSGIVTRCPLALKLKRAPGPWHGRIKYRVQGRTINTKLDTPESVGDAVLQAQSELTGDDLGVSKSLIELEVTSDSVPDLTLIDLPGIARVALAGQAVDIETQIKDLIRDHIGRQETINLVVIPCNVDIATTEALKMAQAVDPTGVRTLGVLTKPDLMDEGTERNALRILQNQVFPLSKGYVLVKCRSQRDVEAHQTLAEASRVEAAFFKKHPVFCHVHNGGKLTTTTVLAAKLTEELVDNIKRTLPKLRKDLAEKLREACAELESQGESIPDDARAKQQFINARVMRYNDD----VRGLARGEPSRNLPRNMMLYTLVREHFRTWLKDLKRAQDAWLEELDNLIREYIDNRSGRELPGFVSYHAFENLARVHVQRLEKPALNVLAVTCSKLSDVFMRLADDVFKFLPEFNRL---VKAKVGAQVQGQEQKARVLIVTLFRME 510          
BLAST of Dynamin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007915.1 (pep scaffold:Pmarinus_7.0:GL487011:231:8254:1 gene:ENSPMAG00000007153.1 transcript:ENSPMAT00000007915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.126 bits (492), Expect = 8.227e-56
Identity = 114/302 (37.75%), Postives = 178/302 (58.94%), Query Frame = 3
Query:  639 GLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDC----TAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFI 1532
            G RT+ V++KLDLMD GTDA ++L  +++P++ G +GVVNRSQ DI+  K +  +L  E  F      Y  +A+R GT  L K LN+ L +HIR+ LP+L+  +   +   +  ++ Y  +  DDPS     LL  V KF +E+C  I+GT   I+T  L GGA I  IFHE F   L  +         ++  AI+N  G R  LF P+++FE +V++QI +L+ P ++C++LV  E+ ++V  C    T ++  FP+L + I  +VT  L+++   T + +  LV I+L+Y+NT H DF+
Sbjct:   10 GRRTLAVVSKLDLMDAGTDATDVLLGRVVPVKLGIVGVVNRSQLDINKNKSVSDSLRDEDVFLQR--KYPALANRSGTKNLAKTLNRLLMHHIRDCLPELKARVNMLVAQYQSLLSGYGEM-VDDPS---ATLLSIVTKFASEYCHTIEGTSKHIETSELCGGARICYIFHETFGRTLESLHPLGGLTTMDVLTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPGLRCVELVHEEMQRIVQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPFTNEMVHNLVAIELAYINTKHPDFV 305          
BLAST of Dynamin-1 vs. Ensembl Yeast
Match: DNM1 (Dynamin-related GTPase involved in mitochondrial organization; required for mitochondrial fission and inheritance; self assembles on the cytoplasmic face of mitochondrial tubules at sites where division will occur; participates in endocytosis and regulates peroxisome fission along with Vps1p; mutants in the human ortholog DNM1L, which mediates mitochondrial fission, peroxisomal division, autophagy, and mitophagy, are associated with slowly progressive infantile encephalopathy [Source:SGD;Acc:S000003924])

HSP 1 Score: 463.766 bits (1192), Expect = 1.121e-151
Identity = 246/539 (45.64%), Postives = 346/539 (64.19%), Query Frame = 3
Query:   60 SGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLN--FSNS----------------------------------------EYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDC-TAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANA 1547
            + +E LIP VNKLQD     GI   LDLP +AVVGSQS+GKSS+LE  VGRDFLPRG+GIVTRRPLVLQLN    NS                                        E+ EF+H   K+F DFD++++EIE ET R+ G +KGIS +PINL+V+SPHVLNLTL+DLPG+TKV +G+QPPDIEKQI+++I+++I   NCLILAVSPAN D+ NS++LKLA+EVDPQG RTIGVITKLDLMD GT+A +IL  K+ PL+ G++GVVNRSQ+DI   K ++ +L  E  +F  HP YR ++ + GT YL K+LNQ L +HIR+ LP ++  L + +   E+E+  Y  +       +   +L  + KF T F  +IDGT S+I+T  L GGA I  I++  F   L  I+        ++  AI+N  G R  LF P++AF+ +V+ QI  L  P+ +C++LV  EL+K+ H C +A++  +P+L+  +  ++++ L+E+   T+  +  L++I  +Y+NTNH +F+    A
Sbjct:    2 ASLEDLIPTVNKLQDVMYDSGID-TLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGATTNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPTSNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICHKCGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNFLSATEA 539          
BLAST of Dynamin-1 vs. Ensembl Yeast
Match: VPS1 (Dynamin-like GTPase required for vacuolar sorting; also involved in actin cytoskeleton organization, endocytosis, late Golgi-retention of some proteins, regulation of peroxisome biogenesis [Source:SGD;Acc:S000001709])

HSP 1 Score: 440.654 bits (1132), Expect = 2.057e-143
Identity = 242/543 (44.57%), Postives = 335/543 (61.69%), Query Frame = 3
Query:   69 EMLIPIVNKLQDAFSSIG----IPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL-----------------------NFSN---------------------SEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTA--KMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANA 1547
            E LI  +NKLQDA + +G     PI  DLPQI VVGSQS+GKSSVLEN VGRDFLPRG+GIVTRRPLVLQL                       N ++                      E+ EF+H   KKF +FDE+RKEI  ETD++TG+N GISSVPINLR+YSPHVL LTL+DLPGLTKV VGDQPPDIE+QI+ M++++I+  N +IL+V+ AN+D+ANSD LKLA+EVDP+G RTIGV+TK+DLMD+GTD  +IL  +++PLR GYI V+NR QKDI+ KK I+ AL +ERKFF +HPSY   A   GT YL K LN  L +HIR+T   L         +++K   E  N+ P+     +  +L  +  F  E+   +DG   E+ +  LSGGA I+ +FHE F   +  ++  ++   ++I   + N  G    LF    AFE +V++QI + + P+++ + LV  EL++++    +  K   +P LRE I     Q LK+  + T + ++ ++  + +Y+NT H D +  + A
Sbjct:    3 EHLISTINKLQDALAPLGGGSQSPI--DLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIVTRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKHQNEGQSEDNKEEWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTLVDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIREALENERKFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQT---LPEIKAKIEATLKKYQNELINLGPETMDSASSVVLSMITDFSNEYAGILDGEAKELSSQELSGGARISYVFHETFKNGVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTLVFDELVRMLKQIISQPKYSRYPALREAISNQFIQFLKDATIPTNEFVVDIIKAEQTYINTAHPDLLKGSQA 540          
BLAST of Dynamin-1 vs. Ensembl Yeast
Match: MGM1 (Mitochondrial GTPase, present in complex with Ugo1p and Fzo1p; required for mitochondrial morphology, fusion, and genome maintenance; promotes membrane bending; exists as long and short form with different distributions; ratio of long to short forms is regulated by Psd1p; homolog of human OPA1 involved in autosomal dominant optic atrophy [Source:SGD;Acc:S000005737])

HSP 1 Score: 184.882 bits (468), Expect = 9.508e-49
Identity = 103/221 (46.61%), Postives = 147/221 (66.52%), Query Frame = 3
Query:  132 NLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL---NFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGK 785
            +L LP I V+GSQS+GKSSVLE+ VGR+FLP+GS +VTRRP+ L L     SN+  A+F   +     DF EV++ +  E +    +++ +S  PI L + S  V +L+L+DLPG  +V   DQP +++ +IR +  +++T  N +ILA+S A+ D+ANS ALK +K  DP+GLRTIGVITKLDL+D    AR IL NK  PL  GY+GV+ ++   I+ K
Sbjct:  207 HLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPNSNNVTADFPSMRLYNIKDFKEVKRML-MELNMAVPTSEAVSEEPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKTKIRDLCEKYLTAPN-IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLVDP-EKARSILNNKKYPLSMGYVGVITKTPSSINRK 424          
BLAST of Dynamin-1 vs. Ensembl Nematostella
Match: EDO32191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT4])

HSP 1 Score: 739.184 bits (1907), Expect = 0.000e+0
Identity = 357/496 (71.98%), Postives = 425/496 (85.69%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFA 1541
            GN GME LIPIVNK+QDAF+SIG    +DLPQIAVVGSQSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQL  S SEYAEF+HC+NKKFTDF EV+KEI AETDR+TG NKGIS++PINLRVYSP VL+LTL+DLPG+TKV VGDQP DIE QIRSM++EFIT ENCLILAVSPANSD+ANSDALK+A+EVDPQG RTIGVITKLDLMDEGTDAR+ILEN++LPLRRGYIG+VNRSQ DIDG+KDI+ ALA+ERKFF+S+PSYRHMAD+MGT YLQKVLNQQLTNHI++TLP LR+ LQ  LL++EKEV  Y N  P D S +TKAL+  +Q F  +F +AI+G+G  I+T  LSGGA IN+IFHERFPYELVK+E DEKQLR EI +AIKNIHGIR GLFTPDMAFE IV++QIDKL+ P IKC+D+V++EL  V+  C  +M  +P LR+++ERIV   ++  EV TK+Q+   + ++L+Y+NTNH DF+GFA
Sbjct:    2 GNKGMEDLIPIVNKIQDAFASIGYSSMIDLPQIAVVGSQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLQPSKSEYAEFLHCRNKKFTDFGEVQKEIVAETDRVTGGNKGISNIPINLRVYSPSVLSLTLVDLPGMTKVPVGDQPADIEFQIRSMLLEFITKENCLILAVSPANSDLANSDALKIAREVDPQGARTIGVITKLDLMDEGTDARDILENRVLPLRRGYIGIVNRSQADIDGRKDIRAALAAERKFFLSNPSYRHMADKMGTQYLQKVLNQQLTNHIKDTLPALRSKLQDNLLALEKEVKGYENYNPRDLSVRTKALMQMMQTFSADFEKAIEGSGDSINTVELSGGAKINRIFHERFPYELVKMEFDEKQLRREIMFAIKNIHGIRVGLFTPDMAFEAIVKRQIDKLRSPAIKCVDMVMTELTSVIQKCATQMAKYPLLRDQVERIVIDHIRSNEVTTKEQVQTFIELELAYINTNHPDFVGFA 497          
BLAST of Dynamin-1 vs. Ensembl Nematostella
Match: EDO34895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN34])

HSP 1 Score: 445.277 bits (1144), Expect = 1.401e-144
Identity = 244/521 (46.83%), Postives = 340/521 (65.26%), Query Frame = 3
Query:   66 MEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL-------------------------NFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVH---DCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFAN 1544
            ME LIP++NKLQD F+++G   ++ LPQI VVG+QS+GKSSVLEN VGRDFLPRGSG+VTRRPL+LQL                         +   +E+ +F+H K K F DF+ +R+EIE ETDR+TGSNKGISS PINL++YSP VLNLTL+DLPG+TKV VGDQP DIE+QIR +I+++I+  N +ILAV+PAN D+A S+ALK+A+EVDP G RT+ V TKLDLMD GTDA ++L  +++P++ G IGVVNRSQ DI+ +K I+ AL  E  FF    +Y  +A R GT YL K LN+ L +HIR  LP+L++ + S        +  Y     D   Y    LL  + +F   +C  I+GT  EI+T  L GGA I  IFH+ F   L  ++  E     +I  AI+N  G R  LF P+++FE +V++QI +L+ P+++CI+LV  E+ +++    D   +++ FPRL E I  ++   L+ + +   + +  LV I+L+Y+NTNH DF   A+
Sbjct:    1 MEQLIPVINKLQDVFNTVGSE-SIQLPQIVVVGAQSSGKSSVLENLVGRDFLPRGSGVVTRRPLILQLVHVPPRAKEKKINELPDKKEAAEDHDAEPAEWGKFLHLKEKIFRDFNGIREEIERETDRVTGSNKGISSEPINLKIYSPKVLNLTLVDLPGVTKVPVGDQPLDIEQQIRHLILQYISNPNSIILAVTPANIDLATSEALKIAREVDPDGHRTLAVCTKLDLMDHGTDAMDVLYGRVIPVKLGIIGVVNRSQLDINNRKSIENALRDEADFFAR--NYPTVASRNGTPYLAKTLNKLLMHHIRNCLPELKSRVNSMTSQYHHLLQSYGEPVMDKGPY----LLQMITRFAATYCSIIEGTAHEIETSELCGGARICYIFHDIFGRTLTIMDAMEGLSTRDILTAIRNATGPRPALFVPEISFELLVKRQIRRLEEPSLRCIELVHEEMQRIIQHSFDQVMEIKRFPRLHESIVDVIINLLQRRLMPCNEMVENLVAIELAYINTNHPDFTDGAS 514          

HSP 2 Score: 61.2326 bits (147), Expect = 1.464e-9
Identity = 35/86 (40.70%), Postives = 53/86 (61.63%), Query Frame = 3
Query: 2031 ETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEV 2288
            + IR L++SY  I+ K+ +D VPK IM  +VN VK+  + +L+  LY+     TL++ES     KR+E   M  A++ A +IISEV
Sbjct:  627 DIIRKLIKSYFVIVRKSIQDSVPKAIMAFLVNYVKERIQSELVEKLYKSERFETLLQESEHMHIKRKEAAEMLKALQRAGQIISEV 712          
BLAST of Dynamin-1 vs. Ensembl Nematostella
Match: EDO43348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ55])

HSP 1 Score: 297.745 bits (761), Expect = 4.644e-94
Identity = 140/243 (57.61%), Postives = 185/243 (76.13%), Query Frame = 3
Query: 1629 IIRKGWLTIQNIPVLRS---GGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQG-----DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTN 2333
            IIRKGWLT+     ++    G +++WF+L  +TLTWYKDEEEKE K+ L L+G+R+RD+E+GF  K+  FALFNPD+KN++KD+KQLEL A++QE +D WKASFLRAG+YP ++ SE      D S+QG     DP +ERQVETIRNLV+SY+RI++KT RDLVPKTIM+MI+N +K+F   +LL  LY  G+ + LMEES EE Q+REEML+MY + KEAL+I+ ++ T TIS P PPPV N
Sbjct:   19 IIRKGWLTVSQAGFMKGVGMGSKEYWFVLTAETLTWYKDEEEKETKYQLRLDGVRLRDLEAGFMSKRVSFALFNPDTKNLFKDHKQLELSADNQETVDSWKASFLRAGVYPERESSE------DKSLQGEIGTLDPQMERQVETIRNLVDSYIRIVSKTIRDLVPKTIMYMIINNIKEFIAAELLAHLYSSGNVSDLMEESEEEAQRREEMLKMYHSTKEALQIVGDIDTHTISIPTPPPVDN 255          
BLAST of Dynamin-1 vs. Ensembl Nematostella
Match: EDO40359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7A7])

HSP 1 Score: 110.153 bits (274), Expect = 9.843e-25
Identity = 84/300 (28.00%), Postives = 143/300 (47.67%), Query Frame = 3
Query:   75 LIPIVNKLQDAFSSIGIPINL--DLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSG-IVTRRPLVLQLNFSNSEYAEFIHCKNKKF-----TDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDA----REILENKLLPLRR-GYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRH---MADRMGTGYLQKVLNQQLTNHIRET 926
            LI + + + D  +   +  N    LP++ VVG QSAGK+SVLE        PRGSG ++TR P+++ L+   +  A+F    +++F      +  ++R E+E    R     + +S   I++ V  P +  + L+DLPG+            +  I  +   ++   N +IL +     D   S+   L   +DPQG RTI V+TK+DL ++   +    ++ILE  L P++  GY  VV  +    +  + IK    SE  FF +   ++     A +M T  L   ++Q     +RE+
Sbjct:    5 LIDMYSDVLDLLAEYDVSYNTTDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGQMMTRSPVMVTLSEGPNHIAQF-KGNSRQFDLTQEKELKDLRHEVELRMKRSVKQGQTVSPEVISMTVKGPGLHRMVLVDLPGIIGTTTTGMAESTKSDILDISRRYMENPNAIILCIQDGAIDAERSNVTDLVSSMDPQGKRTIFVLTKVDLAEQNETSPSRIKQILEGNLFPMKALGYFAVVTGTGNTSESIETIK---TSEEGFFRTSKLFKSGVFKASQMTTQNLSFAVSQCFWKMVRES 300          
BLAST of Dynamin-1 vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 1082.01 bits (2797), Expect = 0.000e+0
Identity = 529/777 (68.08%), Postives = 641/777 (82.50%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNK-LGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-QESESNNTEADNSIQG------DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSS 2360
            GN GME LIP+VN++QDAF++IG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL  S +E+AEF+HCK KKFTDFDEVR+EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQP DIE QIR M+++F+T ENCL+LAVSPANSD+ANSDALK+AKEVDPQGLRTIGVITKLDLMDEGTDA++ILENKLLPLRRGYIGVVNRSQKDIDGKKDI  A+A+ERKFF+SHP+YRH+ADRMGT YLQKVLN+QLTNHIR+TLP LR+ LQSQLLS+EKEV EY+N RPDDPS KTK LL  VQ+F  +F + I+G+G +IDT  LSGGA IN+IFHERFP+ELVK+E +EK+LR EISYAIKNIHGIRTGLFTPDMAFETIV++QI K+K P  KC+D+VISEL+  V  CT K+  +P LREE+ERIVTQ ++++E  TK+Q+++L++I+LSYMNTNHEDFIGFANA+Q+ +   K K  GNQV            IRKGWLTI NI +++ G +++WF+L  ++L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  ESQE +D WKASFLRAG+YP +  E E  +   D++         DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  +LMEES E+ Q R+EMLRMY A++EAL II ++ST T+ST  PPPV + WL  +  S
Sbjct:    2 GNRGMEDLIPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEIEAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFFLSHPAYRHLADRMGTPYLQKVLNEQLTNHIRDTLPALRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKVLLQMVQQFSVDFDKCIEGSGDKIDTAELSGGAKINRIFHERFPFELVKMEFNEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGKIKEPCTKCVDMVISELVSTVRQCTKKLAQYPLLREEMERIVTQHIRDRERDTKEQVLLLIDIELSYMNTNHEDFIGFANAQQRINQINKKKAAGNQV------------IRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACESQEDVDAWKASFLRAGVYPERVTEKEGKSDGGDDNDSDNLMHSMDPQLERQVETIRNLVDSYMSIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNSLMEESQEQAQHRDEMLRMYHALREALRIIGDISTTTVSTANPPPVDDSWLQVQRGS 766          
BLAST of Dynamin-1 vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 1080.86 bits (2794), Expect = 0.000e+0
Identity = 528/777 (67.95%), Postives = 642/777 (82.63%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNK-LGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-QESESNNTEADNSIQG------DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSS 2360
            GN GME LIP+VN++QDAF++IG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL  S +E+AEF+HCK KKFTDFDEVR+EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQP DIE QIR M+++F+T ENCL+LAVSPANSD+ANSDALK+AKEVDPQGLRTIGVITKLDLMDEGTDA++ILENKLLPLRRGYIGVVNRSQKDIDGKKDI  A+A+ERKFF+SHP+YRH+ADRMGT YLQKVLN+QLTNHIR+TLP LR+ LQSQLLS+EKEV EY+N RPDDPS KTK LL  VQ+F  +F + I+G+G +IDT  LSGGA IN+IFHERFP+ELVK+E +EK+LR EISYAIKNIHGIRTGLFTPDMAFETIV++QI K+K P  KC+D+VISEL+  V  CT K+  +P LREE+ERIVTQ ++++E  TK+Q+++L++I+LSYMNTNHEDFIGFANA+Q+ +   K K  GNQ          + +IRKGWLTI NI +++ G +++WF+L  ++L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  ESQE +D WKASFLRAG+YP +  E E  +   D++         DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  +LMEES E+ Q R+EMLRMY A++EAL II ++ST T+ST  PPPV + WL  +  S
Sbjct:    2 GNRGMEDLIPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEIEAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFFLSHPAYRHLADRMGTPYLQKVLNEQLTNHIRDTLPALRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKVLLQMVQQFSVDFDKCIEGSGDKIDTAELSGGAKINRIFHERFPFELVKMEFNEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGKIKEPCTKCVDMVISELVSTVRQCTKKLAQYPLLREEMERIVTQHIRDRERDTKEQVLLLIDIELSYMNTNHEDFIGFANAQQRINQINKKKAAGNQDE--------IMVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACESQEDVDAWKASFLRAGVYPERVTEKEGKSDGGDDNDSDNLMHSMDPQLERQVETIRNLVDSYMSIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNSLMEESQEQAQHRDEMLRMYHALREALRIIGDISTTTVSTANPPPVDDSWLQVQRGS 770          
BLAST of Dynamin-1 vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 1079.32 bits (2790), Expect = 0.000e+0
Identity = 528/776 (68.04%), Postives = 643/776 (82.86%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNK-LGNQ----VSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQG--DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSS 2360
            GN GME LIP+VN++QDAF++IG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL  S +E+AEF+HCK KKFTDFDEVR+EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQP DIE QIR M+++F+T ENCL+LAVSPANSD+ANSDALK+AKEVDPQGLRTIGVITKLDLMDEGTDA++ILENKLLPLRRGYIGVVNRSQKDIDGKKDI  A+A+ERKFF+SHP+YRH+ADRMGT YLQKVLN+QLTNHIR+TLP LR+ LQSQLLS+EKEV EY+N RPDDPS KTK LL  VQ+F  +F + I+G+G +IDT  LSGGA IN+IFHERFP+ELVK+E +EK+LR EISYAIKNIHGIRTGLFTPDMAFETIV++QI K+K P  KC+D+VISEL+  V  CT K+  +P LREE+ERIVTQ ++++E  TK+Q+++L++I+LSYMNTNHEDFIGFANA+Q+ +   K K  GNQ      R V       +IRKGWLTI NI +++ G +++WF+L  ++L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  ESQE +D WKASFLRAG+YP +  S+  +    +++    DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  +LMEES E+ Q R+EMLRMY A++EAL II ++ST T+ST  PPPV + WL  +  S
Sbjct:    2 GNRGMEDLIPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEIEAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFFLSHPAYRHLADRMGTPYLQKVLNEQLTNHIRDTLPALRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKVLLQMVQQFSVDFDKCIEGSGDKIDTAELSGGAKINRIFHERFPFELVKMEFNEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGKIKEPCTKCVDMVISELVSTVRQCTKKLAQYPLLREEMERIVTQHIRDRERDTKEQVLLLIDIELSYMNTNHEDFIGFANAQQRINQINKKKAAGNQDEIMPERGVN--DRFKVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACESQEDVDAWKASFLRAGVYPERVTSDGGDDNDSDNLMHSMDPQLERQVETIRNLVDSYMSIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNSLMEESQEQAQHRDEMLRMYHALREALRIIGDISTTTVSTANPPPVDDSWLQVQRGS 775          
BLAST of Dynamin-1 vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 1078.16 bits (2787), Expect = 0.000e+0
Identity = 530/781 (67.86%), Postives = 643/781 (82.33%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNK-LGNQ----VSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVK-QESESNNTEADNSIQG------DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSS 2360
            GN GME LIP+VN++QDAF++IG   NLDLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL  S +E+AEF+HCK KKFTDFDEVR+EIEAETDR+TG+NKGIS VPINLRVYSPHVLNLTL+DLPG+TKV VGDQP DIE QIR M+++F+T ENCL+LAVSPANSD+ANSDALK+AKEVDPQGLRTIGVITKLDLMDEGTDA++ILENKLLPLRRGYIGVVNRSQKDIDGKKDI  A+A+ERKFF+SHP+YRH+ADRMGT YLQKVLN+QLTNHIR+TLP LR+ LQSQLLS+EKEV EY+N RPDDPS KTK LL  VQ+F  +F + I+G+G +IDT  LSGGA IN+IFHERFP+ELVK+E +EK+LR EISYAIKNIHGIRTGLFTPDMAFETIV++QI K+K P  KC+D+VISEL+  V  CT K+  +P LREE+ERIVTQ ++++E  TK+Q+++L++I+LSYMNTNHEDFIGFANA+Q+ +   K K  GNQ      R V       +IRKGWLTI NI +++ G +++WF+L  ++L+WYKD+EEKE K++L ++ L++RDVE GF   K+IFALFN + +NVYKDY+QLEL  ESQE +D WKASFLRAG+YP +  E E  +   D++         DP LERQVETIRNLV+SYM I+NKT RDL+PKTIMH+++N  K+F   +LL  LY CGD  +LMEES E+ Q R+EMLRMY A++EAL II ++ST T+ST  PPPV + WL  +  S
Sbjct:    2 GNRGMEDLIPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEIEAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFFLSHPAYRHLADRMGTPYLQKVLNEQLTNHIRDTLPALRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKVLLQMVQQFSVDFDKCIEGSGDKIDTAELSGGAKINRIFHERFPFELVKMEFNEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGKIKEPCTKCVDMVISELVSTVRQCTKKLAQYPLLREEMERIVTQHIRDRERDTKEQVLLLIDIELSYMNTNHEDFIGFANAQQRINQINKKKAAGNQDEIMPERGVN--DRFKVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACESQEDVDAWKASFLRAGVYPERVTEKEGKSDGGDDNDSDNLMHSMDPQLERQVETIRNLVDSYMSIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNSLMEESQEQAQHRDEMLRMYHALREALRIIGDISTTTVSTANPPPVDDSWLQVQRGS 780          
BLAST of Dynamin-1 vs. Ensembl Medaka
Match: ENSORLT00000022079.2 (dynamin-1 [Source:NCBI gene;Acc:101154874])

HSP 1 Score: 1073.54 bits (2775), Expect = 0.000e+0
Identity = 548/857 (63.94%), Postives = 673/857 (78.53%), Query Frame = 3
Query:   54 GNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSD-SGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPV----KQESESNNTEADNSIQG-DPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWL-------------SAENSSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXLAPTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSRS 2567
            GN GME LIP+VN+LQDAFS+IG   +LDLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL    +EYAEF+HCK KKFTDFDEVR+EIEAETDR+TG NKGIS VPINLRVYSP+VLNLTL+DLPG+TKV VGDQPPDIE+QI+ M+++F+T +NCL+LAVSPANSD+ANSDALK+AKEVDPQGLRTIGVITKLDLMDEGTDAR+ILENKLLPLRRGYIGVVNRSQKDIDGKKDI  AL +ERKFF+SHP+YRH+ADRMGT YLQK+LNQQLTNHIR+TLP LR+ LQSQLLS+EKEV EY+N RPDDPS KTKALL  VQ+F  +F + I+G+G ++DT+ LSGGA IN+IFHERFP+E+VK+E DEK LR EISYAIKNIHGIRTGLFTPDMAFETIV++QI ++K P  KC+D+VI EL+  V  CT K+  +P LREE+ERIVTQ ++++E RTKDQ+++L++I+L+Y+NTNHEDFIGFANA+QKSS  S K   GNQ          + +IRKGWLTI NI +++ G +++WF+L  +TL+WYKD+EEKE K++LP++ L+++D+E  F   K+IFALF+ + +NVYKDY+QLEL +ESQE +D WKASFLRAG+YP     K+++E+ ++ +D+ I   DP LERQVE +RNLV+SY+ II++T RDL+PKTIMH++VN  K+F   DLL  LY CGD  TLMEES E+ Q+R+EMLRMY A++E L II ++ST T++T  PPPV + WL             S+          PP PGG     PP      P     P+VP  PN        PP +P RPS G  +    P  S
Sbjct:    2 GNRGMEELIPLVNRLQDAFSAIGQNASLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVTCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGHNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPPDIEQQIKDMLLQFVTKDNCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDITAALQAERKFFLSHPAYRHLADRMGTAYLQKILNQQLTNHIRDTLPGLRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKRIEGSGDQVDTYELSGGAKINRIFHERFPFEMVKLESDEKTLRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGQIKEPCQKCVDMVIGELVNTVRQCTQKLAQYPMLREEMERIVTQHIRDRESRTKDQVLLLIDIELAYVNTNHEDFIGFANAQQKSSQLSKKKAAGNQDE--------IMVIRKGWLTINNIGIMKGGAKEYWFVLTAETLSWYKDDEEKEKKYMLPVDNLKLKDIEKSFMSSKHIFALFSTEHRNVYKDYRQLELASESQEEVDSWKASFLRAGVYPERSVDKEKAEAEDSNSDSQIHSLDPQLERQVEIVRNLVDSYLSIIHRTVRDLIPKTIMHLMVNNTKEFIHADLLAHLYSCGDQNTLMEESQEQAQRRDEMLRMYHALREGLNIIGDISTTTVTTTAPPPVDDSWLQVTGMPCGRRSPMSSPTPQRRAPPGPPRPGGRAAPGPPSRPAVSPDPGPTPSVPSRPNRAP-----PPGVPSRPSKGSPAHGESPQSS 845          
BLAST of Dynamin-1 vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 1605.5 bits (4156), Expect = 0.000e+0
Identity = 824/824 (100.00%), Postives = 824/824 (100.00%), Query Frame = 3
Query:   48 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXLAPTVPKSPNLTSASNLIPPLIPQ 2519
            MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMPPPSPGGNRRAPPPPPGMKIPPTRLAPTVPKSPNLTSASNLIPPLIPQ
Sbjct:    1 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMPPPSPGGNRRAPPPPPGMKIPPTRLAPTVPKSPNLTSASNLIPPLIPQ 824          
BLAST of Dynamin-1 vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 1604.73 bits (4154), Expect = 0.000e+0
Identity = 828/840 (98.57%), Postives = 828/840 (98.57%), Query Frame = 3
Query:   48 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXLAPTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSRS 2567
            MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQ            IIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMPPPSPGGNRRAPPPPPGMKIPPTRLAPTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSRS
Sbjct:    1 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQ------------IIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMPPPSPGGNRRAPPPPPGMKIPPTRLAPTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSRS 828          
BLAST of Dynamin-1 vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 1571.6 bits (4068), Expect = 0.000e+0
Identity = 812/824 (98.54%), Postives = 812/824 (98.54%), Query Frame = 3
Query:   48 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXLAPTVPKSPNLTSASNLIPPLIPQ 2519
            MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQ            IIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMPPPSPGGNRRAPPPPPGMKIPPTRLAPTVPKSPNLTSASNLIPPLIPQ
Sbjct:    1 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQ------------IIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMPPPSPGGNRRAPPPPPGMKIPPTRLAPTVPKSPNLTSASNLIPPLIPQ 812          
BLAST of Dynamin-1 vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 1571.21 bits (4067), Expect = 0.000e+0
Identity = 812/824 (98.54%), Postives = 812/824 (98.54%), Query Frame = 3
Query:   48 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMXXXXXXXXXXXXXXXXXXXXXXXXLAPTVPKSPNLTSASNLIPPLIPQ 2519
            MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQ            IIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMPPPSPGGNRRAPPPPPGMKIPPTRLAPTVPKSPNLTSASNLIPPLIPQ
Sbjct:    1 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQ------------IIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAENSSSFNQMPPPSPGGNRRAPPPPPGMKIPPTRLAPTVPKSPNLTSASNLIPPLIPQ 812          
BLAST of Dynamin-1 vs. Planmine SMEST
Match: SMESG000021502.1 (SMESG000021502.1)

HSP 1 Score: 1080.09 bits (2792), Expect = 0.000e+0
Identity = 513/766 (66.97%), Postives = 656/766 (85.64%), Query Frame = 3
Query:   48 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETXXXXXXXXXXXXXXMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNS--IQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEW 2339
            M GN GME LI +VN+LQDAF S+ IP+NL+LPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL  + +EYAEF+HC NKKFTDF+EVR+EIEA+T+R+TG NKGIS+ PINLRVYSP+VLNLTLIDLPG+TKVAVGDQP +IE QIR+MI+++I  ENCLILAVSPANSD+ANSDALK++KEVDP G+RTIGVITKLDLMDEGTDAR+IL+NKLLPLRRGY+G+VNRSQ+DIDGKKDI+ ALA+ERKFF++H SY+H+ADRMGT YLQKVLNQQLTNHIR++LPQL+N++++QL S+E+EV   ++IRP+DP+YKTKAL++ VQ FET+F ++I+G G+EI+T  LSGGA+IN+IFHERFPYEL+K+E DE++LR +ISYAIKN HGIRTG+F PDMAFE IV+++I+KLK P++KC+DLV+ ELIK++H CT KM+N+PRLREEIER+ +Q+++ +EV  KDQ+I L+++QL+Y+NTNH DF   AN ++K++D  +NKLGNQ S NV       IIR+GWLT+QN+ +LR G +D +F+L +D+L+W+KD+E+ E KF + LEGL+++D+  GF  KK  FALFNP+ KNVYKDYKQLELVAE+QE++D WKASFLRAG+YP K E+E +  E  +S  IQGDP LERQVETIRNLVESYM+I++K+ RDLVPKTIM +I++EVK F + ++L  +Y   D  TLMEES +E  +RE +LR + A+K+AL+II+EVS+ T+S PVP  V ++W
Sbjct:    1 MSGNYGMEQLIQVVNRLQDAFVSLNIPLNLNLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGAGAEIETKELSGGAIINQIFHERFPYELIKLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFQRDANGDRKTADGERNKLGNQYSDNVRK-----IIREGWLTLQNVTILRGGSKDLYFILTSDSLSWFKDDEKTEKKFDMKLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEVSSKTVSVPVPSAVNDDW 760          
The following BLAST results are available for this feature:
BLAST of Dynamin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNM10.000e+065.46dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
DNM10.000e+065.54dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
DNM10.000e+065.12dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
DNM10.000e+064.99dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
DNM10.000e+065.42dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
back to top
BLAST of Dynamin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyn-10.000e+064.13Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055][more]
dyn-10.000e+064.13Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055][more]
drp-17.083e-13646.76Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-17.083e-13646.76Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-17.083e-13646.76Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Dynamin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shi0.000e+064.86gene:FBgn0003392 transcript:FBtr0301596[more]
shi0.000e+064.86gene:FBgn0003392 transcript:FBtr0301597[more]
shi0.000e+065.23gene:FBgn0003392 transcript:FBtr0301595[more]
shi0.000e+065.23gene:FBgn0003392 transcript:FBtr0301594[more]
shi0.000e+065.23gene:FBgn0003392 transcript:FBtr0074123[more]
back to top
BLAST of Dynamin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1a0.000e+069.33dynamin 1a [Source:NCBI gene;Acc:100307098][more]
dnm1a0.000e+069.07dynamin 1a [Source:NCBI gene;Acc:100307098][more]
dnm1b0.000e+065.65dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3][more]
dnm1b0.000e+065.45dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3][more]
dnm2a0.000e+069.46dynamin 2a [Source:ZFIN;Acc:ZDB-GENE-050913-84][more]
back to top
BLAST of Dynamin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ei240.000e+066.78etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-... [more]
ei240.000e+067.30etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-... [more]
ei240.000e+064.84etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-... [more]
ei240.000e+064.73etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-... [more]
ei240.000e+064.91etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Dynamin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnm10.000e+065.58dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
Dnm10.000e+065.65dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
Dnm10.000e+065.50dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
Dnm10.000e+065.11dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
Dnm10.000e+065.53dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
back to top
BLAST of Dynamin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q05193|DYN1_HUMAN0.000e+065.46Dynamin-1 OS=Homo sapiens OX=9606 GN=DNM1 PE=1 SV=... [more]
sp|P39053|DYN1_MOUSE0.000e+065.50Dynamin-1 OS=Mus musculus OX=10090 GN=Dnm1 PE=1 SV... [more]
sp|P21575|DYN1_RAT0.000e+065.11Dynamin-1 OS=Rattus norvegicus OX=10116 GN=Dnm1 PE... [more]
sp|Q08DF4|DYN1_BOVIN0.000e+064.66Dynamin-1 OS=Bos taurus OX=9913 GN=DNM1 PE=2 SV=1[more]
sp|P39052|DYN2_RAT0.000e+065.20Dynamin-2 OS=Rattus norvegicus OX=10116 GN=Dnm2 PE... [more]
back to top
BLAST of Dynamin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A094ZKG00.000e+074.12Dynamin-1 OS=Schistosoma haematobium OX=6185 GN=MS... [more]
A0A5K4EDF90.000e+074.41Dynamin, putative OS=Schistosoma mansoni OX=6183 P... [more]
A0A5K4ED860.000e+074.28Dynamin, putative OS=Schistosoma mansoni OX=6183 P... [more]
A0A5K4EE900.000e+074.28Dynamin, putative OS=Schistosoma mansoni OX=6183 P... [more]
C4Q9B40.000e+074.28Dynamin, putative OS=Schistosoma mansoni OX=6183 G... [more]
back to top
BLAST of Dynamin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1b0.000e+065.41dynamin-1 [Source:NCBI gene;Acc:103047879][more]
dnm1b0.000e+065.22dynamin-1 [Source:NCBI gene;Acc:103047879][more]
dnm1b0.000e+065.34dynamin-1 [Source:NCBI gene;Acc:103047879][more]
dnm1b0.000e+069.02dynamin-1 [Source:NCBI gene;Acc:103047879][more]
dnm1a0.000e+068.43dynamin-1 [Source:NCBI gene;Acc:103024863][more]
back to top
BLAST of Dynamin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006976.10.000e+071.93pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1... [more]
ENSPMAT00000002816.11.102e-14345.11pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-... [more]
ENSPMAT00000002195.16.503e-7356.25pep scaffold:Pmarinus_7.0:GL484008:1783:12172:-1 g... [more]
mxb1.863e-5632.10myxovirus (influenza) resistance B [Source:NCBI ge... [more]
ENSPMAT00000007915.18.227e-5637.75pep scaffold:Pmarinus_7.0:GL487011:231:8254:1 gene... [more]
back to top
BLAST of Dynamin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
DNM11.121e-15145.64Dynamin-related GTPase involved in mitochondrial o... [more]
VPS12.057e-14344.57Dynamin-like GTPase required for vacuolar sorting;... [more]
MGM19.508e-4946.61Mitochondrial GTPase, present in complex with Ugo1... [more]
back to top
BLAST of Dynamin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO321910.000e+071.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348951.401e-14446.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433484.644e-9457.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403599.843e-2528.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynamin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1a0.000e+068.08dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm1a0.000e+067.95dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm1a0.000e+068.04dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm1a0.000e+067.86dynamin 1 [Source:NCBI gene;Acc:101157793][more]
ENSORLT00000022079.20.000e+063.94dynamin-1 [Source:NCBI gene;Acc:101154874][more]
back to top
BLAST of Dynamin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067156.10.000e+0100.00SMESG000067156.1[more]
SMESG000067156.10.000e+098.57SMESG000067156.1[more]
SMESG000067156.10.000e+098.54SMESG000067156.1[more]
SMESG000067156.10.000e+098.54SMESG000067156.1[more]
SMESG000021502.10.000e+066.97SMESG000021502.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025232 ID=SMED30025232|Name=Dynamin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2719bp
TTTTGAATTGCTGAATTTTGAAATAGATATCTGATAATAAATTAGCAATG
GAAGGAAATTCTGGAATGGAGATGTTGATTCCAATTGTGAATAAGTTGCA
AGATGCCTTTTCTTCAATTGGGATTCCAATAAATTTGGATTTGCCGCAAA
TCGCTGTTGTTGGTAGCCAGAGCGCCGGAAAAAGTAGCGTTTTGGAGAAT
TTTGTCGGAAGAGACTTTTTGCCTCGTGGCAGTGGAATAGTTACCCGTAG
GCCTTTGGTTTTGCAATTGAATTTTTCCAATTCCGAATATGCCGAATTTA
TTCATTGCAAAAATAAAAAGTTTACAGATTTCGATGAAGTAAGAAAAGAA
ATTGAAGCGGAAACTGATAGACTGACTGGCAGTAACAAGGGAATTTCCAG
TGTTCCAATTAACTTACGAGTTTACTCACCACATGTTCTAAATCTAACTT
TGATTGACTTACCTGGACTCACGAAAGTTGCGGTTGGAGATCAACCCCCG
GATATTGAAAAGCAAATTCGGTCAATGATTATGGAATTTATTACCTTGGA
GAATTGTTTGATTCTAGCTGTGTCTCCAGCGAATTCAGATATTGCCAACT
CAGATGCTTTGAAACTTGCAAAAGAAGTCGACCCTCAAGGTCTGAGAACA
ATTGGAGTTATAACTAAATTAGACTTAATGGACGAAGGTACTGATGCAAG
AGAGATTTTAGAAAATAAATTACTTCCTTTAAGAAGAGGATATATTGGAG
TGGTAAATCGTAGTCAAAAGGATATCGATGGAAAAAAAGACATCAAATTA
GCATTAGCCTCTGAACGAAAATTTTTCATGTCTCATCCAAGCTATCGTCA
TATGGCTGACAGGATGGGTACCGGATACTTGCAGAAAGTTCTGAATCAAC
AACTAACCAATCACATTCGCGAGACACTTCCGCAGCTGAGGAACAATCTT
CAGAGCCAATTGCTTTCAATGGAAAAAGAAGTAACCGAGTACAGAAATAT
TCGGCCAGATGATCCTTCGTATAAAACAAAGGCTTTATTATTGACAGTTC
AGAAATTTGAAACTGAGTTCTGCCAGGCAATTGACGGTACCGGATCAGAG
ATAGATACCCACACCCTCTCTGGGGGAGCCCTGATCAACAAAATCTTCCA
CGAGAGATTTCCATACGAATTAGTAAAAATAGAGTGTGACGAGAAGCAGC
TGAGAACAGAAATAAGTTACGCAATTAAAAATATTCACGGCATCCGAACT
GGACTTTTTACTCCTGACATGGCATTCGAAACTATCGTTCGTAAACAAAT
TGATAAATTGAAGGGCCCCACAATTAAATGTATAGACCTTGTCATATCAG
AACTGATCAAAGTCGTCCATGACTGCACTGCTAAAATGGAGAACTTTCCA
CGTTTAAGAGAAGAAATAGAAAGAATTGTTACTCAACAGCTGAAGGAGAA
AGAAGTGAGAACAAAAGATCAGTTGATAATGTTAGTGAACATCCAGTTAT
CCTATATGAACACAAACCACGAAGATTTCATTGGATTTGCAAATGCCGAA
CAGAAATCAAGTGACAGTGGCAAAAATAAATTGGGAAACCAGGTATCCCG
CAATGTTACAGCTCCCGCGTTTGTGCCAATTATTCGAAAAGGCTGGCTGA
CAATACAGAACATTCCTGTTTTACGCAGTGGAGGTCGAGACTTTTGGTTC
ATGCTTAATACCGACACATTGACATGGTACAAAGATGAAGAGGAAAAGGA
AGTGAAATTTGTCTTACCTCTTGAAGGGCTAAGGATACGTGATGTGGAAA
GCGGATTCTGGGGGAAAAAGTATATTTTCGCTCTATTCAATCCGGACTCG
AAAAATGTTTATAAAGATTACAAACAGTTGGAGTTAGTAGCGGAAAGTCA
AGAGTTAATGGACTGTTGGAAAGCCTCGTTTTTACGTGCCGGCATTTACC
CAGTAAAACAAGAAAGTGAATCTAATAATACTGAAGCTGATAACTCAATT
CAAGGAGATCCGGTTTTAGAACGGCAAGTGGAAACCATTCGCAATCTCGT
AGAATCCTATATGAGAATAATTAACAAAACTCAAAGAGACTTAGTTCCAA
AAACCATTATGCATATGATAGTGAATGAAGTAAAGCAATTCTTCCGCGGT
GACCTGCTGCCTATGCTATACCAATGCGGTGATCCGACAACATTAATGGA
AGAGTCAGCAGAAGAGCTTCAAAAGAGAGAAGAAATGTTACGTATGTATG
ATGCAATGAAAGAAGCGTTGGAAATAATAAGTGAGGTTTCTACTGGTACA
ATTTCAACGCCTGTTCCACCCCCCGTAACCAATGAATGGCTTAGTGCGGA
AAATTCATCCTCATTTAATCAAATGCCACCACCATCTCCGGGAGGTAACA
GGAGAGCGCCTCCACCCCCTCCTGGAATGAAAATTCCTCCAACTAGATTG
GCTCCAACAGTTCCTAAATCTCCTAATCTTACATCAGCTAGTAATCTGAT
TCCTCCTCTCATTCCTCAACGCCCATCAGGCGGCGGTAAAAGTACACCAA
ATATCCCCTCTCGTAGTTAATTTGGTGTCCATTTGGACAAATTTGGACTG
GATTTCTTTTCTTTTTAAATTGCAAATTGTTGATATGTTGCATTGAATTT
CATTTGTAATTTTTGGTAGATTAGACATTGTTTCGTGTAATTCGATTCTT
GGTCACAGAATGGGCATAG
back to top

protein sequence of SMED30025232-orf-1

>SMED30025232-orf-1 ID=SMED30025232-orf-1|Name=SMED30025232-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=841bp
MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLE
NFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRK
EIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQP
PDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLR
TIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIK
LALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNN
LQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGS
EIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIR
TGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENF
PRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANA
EQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFW
FMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPD
SKNVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEADNS
IQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFR
GDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTG
TISTPVPPPVTNEWLSAENSSSFNQMPPPSPGGNRRAPPPPPGMKIPPTR
LAPTVPKSPNLTSASNLIPPLIPQRPSGGGKSTPNIPSRS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000418head
PLANA:0002100synapse
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027741DNM1
IPR013809ENTH
IPR022812Dynamin_SF
IPR001849PH_domain
IPR001401Dynamin_GTPase
IPR003130GED
IPR000375Dynamin_central
IPR027417P-loop_NTPase
IPR011993PH-like_dom_sf
IPR019762Dynamin_GTPase_CS
IPR020850GED_dom
IPR030381G_DYNAMIN_dom
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0072583clathrin-dependent endocytosis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 298..318
NoneNo IPR availableGENE3DG3DSA:1.20.120.1240coord: 319..718
e-value: 0.0
score: 1033.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 7..743
e-value: 0.0
score: 1033.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 781..804
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 805..820
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 770..840
NoneNo IPR availableCDDcd01256PH_dynamincoord: 527..635
e-value: 2.27162E-61
score: 200.625
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 527..634
IPR022812Dynamin superfamilyPRINTSPR00195DYNAMINcoord: 219..238
score: 51.22
coord: 32..50
score: 84.1
coord: 127..144
score: 78.8
coord: 57..74
score: 85.94
coord: 177..195
score: 68.42
coord: 196..212
score: 76.47
IPR022812Dynamin superfamilyPFAMPF00350Dynamin_Ncoord: 35..207
e-value: 6.7E-56
score: 189.0
IPR022812Dynamin superfamilyPANTHERPTHR11566DYNAMINcoord: 5..790
IPR001401Dynamin, GTPase domainSMARTSM00053dynamin_3coord: 7..246
e-value: 2.5E-176
score: 601.8
IPR001401Dynamin, GTPase domainCDDcd08771DLP_1coord: 30..295
e-value: 2.55277E-146
score: 430.128
IPR003130Dynamin GTPase effectorSMARTSM00302GED_2coord: 656..747
e-value: 2.3E-22
score: 90.3
IPR003130Dynamin GTPase effectorPFAMPF02212GEDcoord: 658..747
e-value: 3.6E-23
score: 81.5
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 528..635
e-value: 7.5E-12
score: 55.4
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 529..628
e-value: 4.6E-8
score: 33.5
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 527..633
score: 12.28
IPR000375Dynamin central domainPFAMPF01031Dynamin_Mcoord: 217..502
e-value: 3.2E-100
score: 335.0
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 497..658
e-value: 0.0
score: 1033.1
IPR027741Dynamin-1PANTHERPTHR11566:SF32DYNAMIN-1coord: 5..790
IPR019762Dynamin, GTPase region, conserved sitePROSITEPS00410G_DYNAMIN_1coord: 58..67
IPR020850GTPase effector domainPROSITEPS51388GEDcoord: 661..752
score: 23.214
IPR030381Dynamin-type guanine nucleotide-binding (G) domainPROSITEPS51718G_DYNAMIN_2coord: 29..295
score: 74.531
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 5..303