radial spoke head protein 6 homolog A

Overview
Nameradial spoke head protein 6 homolog A
Smed IDSMED30025231
Uniprot Best hitRadial spoke head protein 6 homolog A OS=Mus musculus OX=10090 GN=Rsph6a PE=1 SV=1 (E=1.13922e-125)
Length (bp)2090
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of radial spoke head protein 6 homolog A (SMED30025231) t-SNE clustered cells

Violin plots show distribution of expression levels for radial spoke head protein 6 homolog A (SMED30025231) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of radial spoke head protein 6 homolog A (SMED30025231) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for radial spoke head protein 6 homolog A (SMED30025231) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025231

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025231SMESG000079294.1 SMESG000044179.1 SmedASXL_011072SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30025231SMESG000079294.1 SMESG000044179.1 dd_Smed_v4_3854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30025231SMESG000079294.1 SMESG000044179.1 dd_Smed_v4_3854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025231SMESG000079294.1 SMESG000044179.1 dd_Smed_v4_3854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025231SMESG000079294.1 SMESG000044179.1 dd_Smed_v4_3854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30025231SMESG000079294.1 SMESG000044179.1 dd_Smed_v4_3854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025231SMESG000079294.1 SMESG000044179.1 dd_Smed_v6_3854_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30025231SMESG000079294.1 SMESG000044179.1 dd_Smed_v4_3854_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025231SMESG000079294.1 SMESG000044179.1 dd_Smed_v4_3854_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30025231SMESG000079294.1 SMESG000044179.1 dd_Smed_v4_3854_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30025231SMESG000079294.1 SMESG000044179.1 dd_Smed_v4_3854_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Human
Match: RSPH6A (radial spoke head 6 homolog A [Source:HGNC Symbol;Acc:HGNC:14241])

HSP 1 Score: 375.17 bits (962), Expect = 1.699e-119
Identity = 221/486 (45.47%), Postives = 309/486 (63.58%), Query Frame = 2
Query:  167 NAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEK--TKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXS-GPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            NAK++LLQ S    +SLY+ LV L+ K+  ++ ++    +E L R  + E +  K  T++   E    + +AE QK+LF  +        +  EE   T +PN+M+T +YFEQA VG++ +ES R++LAMK LVE QPI   RFWGK+ G  R+Y + E E  EG++   +E      +  +      E     + ++ ++I+   PK  WK P ++P EE+ +G NK +YFVCN PG  W RL  VTPAQI  +R I+K+ TG LD+ + SYPPFPG E +YLRA I+RISA T +SPLGFY F EEE + EEE    R  + E+P+FE IP+ +LVD S+ANW HH Q+ILPQGR +W NP  K  EE +  E+EE+ +E  E   +  GPPLLTP++ED E+  +  W+  LS ++ PQY+VAV+ SNLWPGA+A+A+GK F+NIYIGWG KY   + NP + A +Q E+ SG EI E+ DPT
Sbjct:  201 NAKAYLLQTSINCDLSLYEHLVNLLTKILNQRPEDPLSVLESLNRTTQWEWFHPKLDTLRDDPEMQPTYKMAEKQKALFTRSGGGTEGEQEMEEEVGETPVPNIMETAFYFEQAGVGLSSDESFRIFLAMKQLVEQQPIHTCRFWGKILGIKRSYLVAEVEFREGEEEAEEEEVEEMTEGGEVMEAHGEEEGEEDEEKAVDIV---PKSVWKPPPVIPKEESRSGANKYLYFVCNEPGLPWTRLPHVTPAQIVNARKIKKFFTGYLDTPVVSYPPFPGNEANYLRAQIARISAATQVSPLGFYQFSEEEGDEEEEGGAGRDSYEENPDFEGIPVLELVD-SMANWVHHTQHILPQGRCTWVNPLQKTEEEEDLGEEEEKADEGPEEVEQEVGPPLLTPLSEDAEIMHLAPWTTRLSCSLCPQYSVAVVRSNLWPGAYAYASGKKFENIYIGWGHKYSPESFNPALPAPIQQEYPSGPEIMEMSDPT 682          
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Human
Match: RSPH4A (radial spoke head component 4A [Source:HGNC Symbol;Acc:HGNC:21558])

HSP 1 Score: 366.311 bits (939), Expect = 4.163e-116
Identity = 222/486 (45.68%), Postives = 312/486 (64.20%), Query Frame = 2
Query:  167 NAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEK---TKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXSGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            NAK++LL+ S  +G +LYD L  ++ K+  E+ +N     E + + +K  +++ K   ++  NE    + +AE QK+LF     ++  +D +LE++     LPN+M++ +YFEQA VG+  +E+ R++LA+K L +  PI   RFWGK+ G   NY + E E  EG+D    E + + ++ D         N  +E  E+ E  DE PK  +K+P  +P EE+  G NK VYFVCN PG  W +L  V PAQI  +R I+K+ TG LD+ + SYPPFPG E +YLRA I+RISA TH+SPLGFY F EEE E EEE +  R+ F E+P+FE I + DLV+ SL+NW HH Q+IL QGR +W+N   KN EE EEE++E++  +  E E   G PLLTPI+ED E+  +P W+  LSS ++PQYA+AVL SNLWPGA+AF+ GK F+N YIGWG KY   N+ P V   V  E+ SG EITE++DP+
Sbjct:  213 NAKAYLLKTSSNSGFNLYDHLSNMLTKILNERPENAVDIFENISQDVKMAHFSKKFDALQNENELLPTYEIAEKQKALFLQG--HLEGVDQELEDEIAENALPNVMESAFYFEQAGVGLGTDETYRIFLALKQLTDTHPIQRCRFWGKILGLEMNYIVAEVEFREGEDEEEVEEEDVAEERD---------NGESEAHEDEE--DELPKSFYKAPQAIPKEESRTGANKYVYFVCNEPGRPWVKLPPVIPAQIVIARKIKKFFTGRLDAPIISYPPFPGNESNYLRAQIARISAGTHVSPLGFYQFGEEEGEEEEEAEGGRNSFEENPDFEGIQVIDLVE-SLSNWVHHVQHILSQGRCNWFNSIQKNEEEEEEEDEEKDDSDYIEQEV--GLPLLTPISEDLEIQNIPPWTTRLSSNLIPQYAIAVLQSNLWPGAYAFSNGKKFENFYIGWGHKYSPDNYTPPVPPPVYQEYPSGPEITEMDDPS 682          
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Human
Match: RSPH6A (radial spoke head 6 homolog A [Source:HGNC Symbol;Acc:HGNC:14241])

HSP 1 Score: 344.739 bits (883), Expect = 3.837e-111
Identity = 200/418 (47.85%), Postives = 273/418 (65.31%), Query Frame = 2
Query:  371 FVLAELQKSLFENASFNIHHIDDDLEEK--TKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXS-GPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            + +AE QK+LF  +        +  EE   T +PN+M+T +YFEQA VG++ +ES R++LAMK LVE QPI   RFWGK+ G  R+Y + E E  EG++   +E      +  +      E     + ++ ++I+   PK  WK P ++P EE+ +G NK +YFVCN PG  W RL  VTPAQI  +R I+K+ TG LD+ + SYPPFPG E +YLRA I+RISA T +SPLGFY F EEE + EEE    R  + E+P+FE IP+ +LVD S+ANW HH Q+ILPQGR +W NP  K  EE +  E+EE+ +E  E   +  GPPLLTP++ED E+  +  W+  LS ++ PQY+VAV+ SNLWPGA+A+A+GK F+NIYIGWG KY   + NP + A +Q E+ SG EI E+ DPT
Sbjct:    5 YKMAEKQKALFTRSGGGTEGEQEMEEEVGETPVPNIMETAFYFEQAGVGLSSDESFRIFLAMKQLVEQQPIHTCRFWGKILGIKRSYLVAEVEFREGEEEAEEEEVEEMTEGGEVMEAHGEEEGEEDEEKAVDIV---PKSVWKPPPVIPKEESRSGANKYLYFVCNEPGLPWTRLPHVTPAQIVNARKIKKFFTGYLDTPVVSYPPFPGNEANYLRAQIARISAATQVSPLGFYQFSEEEGDEEEEGGAGRDSYEENPDFEGIPVLELVD-SMANWVHHTQHILPQGRCTWVNPLQKTEEEEDLGEEEEKADEGPEEVEQEVGPPLLTPLSEDAEIMHLAPWTTRLSCSLCPQYSVAVVRSNLWPGAYAYASGKKFENIYIGWGHKYSPESFNPALPAPIQQEYPSGPEIMEMSDPT 418          
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Human
Match: RSPH6A (radial spoke head 6 homolog A [Source:HGNC Symbol;Acc:HGNC:14241])

HSP 1 Score: 327.405 bits (838), Expect = 9.050e-102
Identity = 197/442 (44.57%), Postives = 279/442 (63.12%), Query Frame = 2
Query:  167 NAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEK--TKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXS-GPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATG 1483
            NAK++LLQ S    +SLY+ LV L+ K+  ++ ++    +E L R  + E +  K  T++   E    + +AE QK+LF  +        +  EE   T +PN+M+T +YFEQA VG++ +ES R++LAMK LVE QPI   RFWGK+ G  R+Y + E E  EG++   +E      +  +      E     + ++ ++I+   PK  WK P ++P EE+ +G NK +YFVCN PG  W RL  VTPAQI  +R I+K+ TG LD+ + SYPPFPG E +YLRA I+RISA T +SPLGFY F EEE + EEE    R  + E+P+FE IP+ +LVD S+ANW HH Q+ILPQGR +W NP  K  EE +  E+EE+ +E  E   +  GPPLLTP++ED E+  +  W+  LS ++ PQY+VAV+ SNLWPGA+A+A+G
Sbjct:  201 NAKAYLLQTSINCDLSLYEHLVNLLTKILNQRPEDPLSVLESLNRTTQWEWFHPKLDTLRDDPEMQPTYKMAEKQKALFTRSGGGTEGEQEMEEEVGETPVPNIMETAFYFEQAGVGLSSDESFRIFLAMKQLVEQQPIHTCRFWGKILGIKRSYLVAEVEFREGEEEAEEEEVEEMTEGGEVMEAHGEEEGEEDEEKAVDIV---PKSVWKPPPVIPKEESRSGANKYLYFVCNEPGLPWTRLPHVTPAQIVNARKIKKFFTGYLDTPVVSYPPFPGNEANYLRAQIARISAATQVSPLGFYQFSEEEGDEEEEGGAGRDSYEENPDFEGIPVLELVD-SMANWVHHTQHILPQGRCTWVNPLQKTEEEEDLGEEEEKADEGPEEVEQEVGPPLLTPLSEDAEIMHLAPWTTRLSCSLCPQYSVAVVRSNLWPGAYAYASG 638          
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Human
Match: RSPH4A (radial spoke head component 4A [Source:HGNC Symbol;Acc:HGNC:21558])

HSP 1 Score: 254.603 bits (649), Expect = 5.163e-75
Identity = 153/356 (42.98%), Postives = 221/356 (62.08%), Query Frame = 2
Query:  167 NAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEK---TKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQ 1225
            NAK++LL+ S  +G +LYD L  ++ K+  E+ +N     E + + +K  +++ K   ++  NE    + +AE QK+LF     ++  +D +LE++     LPN+M++ +YFEQA VG+  +E+ R++LA+K L +  PI   RFWGK+ G   NY + E E  EG+D    E + + ++ D         N  +E  E+ E  DE PK  +K+P  +P EE+  G NK VYFVCN PG  W +L  V PAQI  +R I+K+ TG LD+ + SYPPFPG E +YLRA I+RISA TH+SPLGFY F EEE E EEE +  R+ F E+P+FE I + DLV+ SL+NW HH Q+IL Q
Sbjct:  213 NAKAYLLKTSSNSGFNLYDHLSNMLTKILNERPENAVDIFENISQDVKMAHFSKKFDALQNENELLPTYEIAEKQKALFLQG--HLEGVDQELEDEIAENALPNVMESAFYFEQAGVGLGTDETYRIFLALKQLTDTHPIQRCRFWGKILGLEMNYIVAEVEFREGEDEEEVEEEDVAEERD---------NGESEAHEDEE--DELPKSFYKAPQAIPKEESRTGANKYVYFVCNEPGRPWVKLPPVIPAQIVIARKIKKFFTGRLDAPIISYPPFPGNESNYLRAQIARISAGTHVSPLGFYQFGEEEGEEEEEAEGGRNSFEENPDFEGIQVIDLVE-SLSNWVHHVQHILSQ 554          
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Fly
Match: CG3121 (gene:FBgn0034957 transcript:FBtr0072161)

HSP 1 Score: 129.798 bits (325), Expect = 7.372e-31
Identity = 105/360 (29.17%), Postives = 167/360 (46.39%), Query Frame = 2
Query:  170 AKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENY-------------AHKASTIKQSNEPSMEF-VLAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTF-----------YYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEA----EMIEGKDNYMDE--------FDLLKQKEDK-----------------ENILKQETNKVNETD------EEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFY 1069
            AKS L + S  +G +L+D L  +I+++ +E+  N     EE  R ++ + +               ++  + +    SM+   + E +  + E+ S      ++D+  +  + + M+ F           +Y+ Q    I+ ++  +L  AM  L  H  I   RFWG + G   +YYIVEA    E I  +   M+E        F + K +EDK                 E    +E  K+          EE+E+ D PP            E  G G N+  YFV N   ++W  L  VTP QI  SR I+K+LTG+L++ + SYP FPGKE+HYLR +I RI+A T+I+P+G+Y
Sbjct:   87 AKSILQKYSTLSGDNLFDHLSDIIKRVIDERPPNVIDFFEEFSRNVREQKFHLPERFPPSGVFDEVRSFRVAKKILQSMKLPYVVEGEDLMGEDLSVEDLRTNEDM--RIVIDDSMRYFVTFNERVQQLQFYWTQCGFSISNDDIFQLASAMNRLQTHPSIMQCRFWGCINGLKASYYIVEASLTREEIASRLVMMEEEMRQKQIPFPMRKDREDKPPPAHIGPELTPGIYGWEEFPPEELEKMKPKAAPVPLVEEMELYDIPP------------EFIGKGCNRYSYFVVNSLFDDWIELPIVTPRQIVVSRQIKKFLTGDLEADVISYPCFPGKEKHYLRTLIGRITAGTYIAPVGYY 432          

HSP 2 Score: 56.225 bits (134), Expect = 8.416e-8
Identity = 35/97 (36.08%), Postives = 49/97 (50.52%), Query Frame = 2
Query: 1331 GPPLLTPINEDEEVNGMPAWSANLSSTIVPQYA-VAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSG-QEITEIEDPT 1615
            GP +L+    D       +W A ++S    Q   + V+ SN+WPGA+ F   KT ++IY+GWG KY   N     L  VQ EF    ++  E  DPT
Sbjct:  572 GPSILSSCANDMNPEVPVSWLARMTSKYTNQKERMLVMQSNVWPGAYTFIFEKTCESIYLGWGHKYYARNIPFKHLPMVQEEFPHNPEDFVEANDPT 668          
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Zebrafish
Match: rsph4a (radial spoke head component 4A [Source:ZFIN;Acc:ZDB-GENE-030131-7437])

HSP 1 Score: 343.199 bits (879), Expect = 1.041e-109
Identity = 213/482 (44.19%), Postives = 302/482 (62.66%), Query Frame = 2
Query:  173 KSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSK-NTXXXXXXXXXXXXXXXXXXXXXSGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            K+F+++ S KT ++LYD LV L+ ++ +E+ +N    +E++  ++K      K  T++ S   S   VLAE QK+LF + + +    +++L + + LPN+ +  ++FEQA VG+ REE  R++LA+K+LV+ Q +   RFWGK+ GT  NY + E E  EG+    +      ++  +E+  ++E  +  +  E +E  D  PK  +K    VP E N  G NK  YFVC  PG  W RL  VTP QI+ +R IR++ TG LD+ + SYPPFPG E +YLRA I+RISA TH+SPLGFY F     E E ED   R  F E+P FE I + ++ + SL  W HH Q+IL QGR  W N T K   +  E+ EDEE +EE DE EPE GPPLLTP++ED ++N  P WS+ +SS I+PQ+A+AVL SNLWPGA+A+ +GK F NIYIGWGLK++     P++    Q+EF SG E TE  DP+
Sbjct:   20 KAFMMKNSTKTNLNLYDHLVRLLTRVMDERPENAVDVMEDMSLELKGSVLQEKQDTLRDSPSSSPALVLAEQQKTLFMHTAGDGGDHEEELVD-SPLPNVAELAFFFEQAGVGLGREEIQRIFLALKHLVDTQLLLRCRFWGKILGTQGNYLVAEGEFREGEGEEDEG----TEQTPEEDEREEELQEGKDEAELVEAADPLPKSTYKPSASVPKEGNHTGANKFTYFVCQEPGMPWVRLPVVTPVQITVARQIRRFFTGKLDAPVVSYPPFPGNEANYLRAQIARISAGTHVSPLGFYQFG----EDEGEDDGLRDSFEENPTFEGIQVNEMAE-SLNLWVHHVQHILTQGRCVWVNVTKKPVDDVDEDAEDEEREEEPDELEPEVGPPLLTPLSEDAKLNDTPPWSSMMSSNIIPQFAIAVLRSNLWPGAYAYCSGKNFGNIYIGWGLKFIGEPFTPVLPPPPQSEFPSGPETTEALDPS 491          
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Xenopus
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:Xenbase;Acc:XB-GENE-5909177])

HSP 1 Score: 325.094 bits (832), Expect = 1.067e-102
Identity = 210/494 (42.51%), Postives = 294/494 (59.51%), Query Frame = 2
Query:  140 LIPRNKDFLNAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLE-EKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXS-GPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            L P       AKSFLLQ +D +G+SLY+ L  L+ ++  E+  N     E L  ++        +  ++   E S     AE+Q++LF          + + E  ++ LPNL+   +  +Q  V + R+E++R+ LA+K L +  P+    FWGK+ G+  +Y + E +          E +  + +E  E   K E     E +E  E  D PPK  ++ P ++P EENG G NK VY+VC+  G EW RL  VTPAQIS +R IR   TGNLD+ + +YPPFPG E + LRA I+RISA TH+SPLG+Y F EEE E EEE    R  + E+P+FE IP+ +LV+ SL+NW HH Q+ILPQGR  W N + K+ EE +EEE EEE++E +       GPPLLTP++ED E+   P W+A LS+ ++P YA+AVL SNLWPGA+  ++ K F+NIYIGWGLKY+   ++P      Q E+ SG EITE  DPT
Sbjct:    7 LDPEELQIQYAKSFLLQ-TDNSGLSLYEHLSALLSRILSERPPNALEVFESLSAELHWSRLKQGSDVLRAPREESHTCRKAEVQRALFSRGDGEGEESEAEGEMTESPLPNLLDLAHLLQQGGVNLGRDEAVRISLALKRLTDTHPLQVCHFWGKILGSGGSYLVAEVQF--------REGEDDEAEEGGEEEEKGEVEDDVEEEENEEAEDLPPKSTYRPPPVIPKEENGTGANKHVYYVCSEAGAEWVRLPPVTPAQISAARKIRHLFTGNLDAPVITYPPFPGTEINLLRAQIARISAGTHVSPLGYYQFGEEEGEEEEEGA-VRDTYEENPDFEGIPVSELVE-SLSNWVHHVQHILPQGRCVWVNTSVKSEEEEDEEEAEEEEKEEENEPEPEVGPPLLTPLSEDAEIGQTPPWTAFLSTHLIPHYALAVLRSNLWPGAYTVSSAKKFENIYIGWGLKYMPEGYSPPAPPAPQAEYPSGPEITESTDPT 489          
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Mouse
Match: Rsph6a (radial spoke head 6 homolog A (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1927643])

HSP 1 Score: 392.889 bits (1008), Expect = 1.629e-126
Identity = 232/492 (47.15%), Postives = 321/492 (65.24%), Query Frame = 2
Query:  146 PRNKDFLNAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEI-EILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXS-GPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            PR     NAK++LL+ S    +SLY+ LV L+ K+  ++ ++    +E L R ++ E +  K  T++   E    + +AE QK+LF           ++    + +PN+M+T +YFEQA VG++ +ES R++LA+K LVE QPI   RFWGK+ G  R+Y + E E  EG++   +E    + +E  E     ET+   E +E+  +++D  PKP+WK P I+P EE+ +GTNK +YFVCN PG  W RL  VTPAQI  +R I+K+ TG LD+ + SYPPFPG E +YLRA I+RISA THISPLGFY F EEE + EEE    R  F E+P+FE IP+ +LVD S+ANW HH Q+ILPQGR +W NP  K  EE E  E+EE+ +E  E   +  GPPLLTP++ED E+  +  W+  LS ++ PQY+VA++ SNLWPGA+A+ATGK F+NIYIGWG KY   N NP++ A +Q E+ SG EITE+ DPT
Sbjct:  187 PRELAIQNAKAYLLRTSMSCNLSLYEHLVNLLTKILNQRPEDPLSILESLNRTMQWEWFHPKLDTLRDDPEMQPTYEMAEKQKALFIRGGGEGEQEMEEEVTDSPVPNIMETAFYFEQAGVGLSSDESFRIFLALKQLVEQQPIHMCRFWGKILGLSRSYLVAEVEFREGEEEGEEE----EVEEMMEGGEVLETHGEEEGEEDEEKVVDSVPKPQWKPPPIIPKEESRSGTNKYLYFVCNEPGRPWTRLPHVTPAQIVCARKIKKFFTGFLDTPVISYPPFPGNEANYLRAQIARISAATHISPLGFYQFGEEEGDEEEEGGAGRDSFEENPDFEGIPVLELVD-SMANWVHHTQHILPQGRCTWVNPLQKTEEEEELGEEEEKADEAMEEVEQEVGPPLLTPLSEDAEIMHLSPWTTRLSCSLSPQYSVAIVRSNLWPGAYAYATGKKFENIYIGWGHKYSPENFNPMLPALIQQEYPSGPEITEMSDPT 673          
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Mouse
Match: Rsph4a (radial spoke head 4 homolog A (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:3027894])

HSP 1 Score: 379.793 bits (974), Expect = 1.717e-121
Identity = 223/487 (45.79%), Postives = 310/487 (63.66%), Query Frame = 2
Query:  167 NAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEK---TKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXS-GPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            NAK++LL  S K+G++LYD L  ++ K+ +E+  +    IE + + +K  ++  K  T+    E    + +AE QK+LF     ++   D +LEE+   + LPN+M++ YYFEQA VG+  +E+ R++LA+K L +  PI   RFWGK+ G   NY + E E  +G+D    E + + ++ D       E  +              PK  +K+P ++P EE+  G NK VYFVCNVPG  W RL  VTPAQI T+R I+K+ TG LD+ + SYPPFPG E +YLRA I+RISA TH+SPLGFY F  EEE  EEE +  R  + E+P+FE I + DLV+ SL+NW HH QYILPQGR +W+NP  K+ +E EEEE++EEK E  +   +  GPPLLTPI+ED  +  +P+W+  LSS ++PQYA+AVL SNLWPGA+AF+ GK F+N YIGWG KY   N+ P     V  E+ SG EITE+ DP+
Sbjct:  212 NAKAYLLSTSSKSGLNLYDHLSKVLTKILDERPADAVDIIENISQDVKMAHFNKKLDTLHNEYEMLPAYEIAETQKALFLQG--HLEGADSELEEEMAESSLPNVMESAYYFEQAGVGLGTDETYRVFLALKQLTDTHPIQRCRFWGKILGLEMNYIVAEVEFRDGEDEEEVEEEGIAEERDNGGSEAGEEEEEEL-----------PKSLYKAPQVIPKEESRTGANKYVYFVCNVPGRPWVRLPSVTPAQIVTARKIKKFFTGRLDAAVISYPPFPGNESNYLRAQIARISAGTHVSPLGFYQF-GEEEGEEEEVEGGRDSYEENPDFEGIQVIDLVE-SLSNWVHHVQYILPQGRCNWFNPIQKDEDEEEEEEEDEEKGEEPDYIEQEVGPPLLTPISEDLGIQNIPSWTTQLSSNLIPQYAIAVLRSNLWPGAYAFSNGKKFENFYIGWGHKYCVENYTPPSPPPVYQEYPSGPEITEMNDPS 683          
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Mouse
Match: Rsph6a (radial spoke head 6 homolog A (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1927643])

HSP 1 Score: 125.176 bits (313), Expect = 3.670e-30
Identity = 55/95 (57.89%), Postives = 73/95 (76.84%), Query Frame = 2
Query: 1331 GPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            GPPLLTP++ED E+  +  W+  LS ++ PQY+VA++ SNLWPGA+A+ATGK F+NIYIGWG KY   N NP++ A +Q E+ SG EITE+ DPT
Sbjct:  324 GPPLLTPLSEDAEIMHLSPWTTRLSCSLSPQYSVAIVRSNLWPGAYAYATGKKFENIYIGWGHKYSPENFNPMLPALIQQEYPSGPEITEMSDPT 418          
BLAST of radial spoke head protein 6 homolog A vs. UniProt
Match: sp|Q8CDR2|RSH6A_MOUSE (Radial spoke head protein 6 homolog A OS=Mus musculus OX=10090 GN=Rsph6a PE=1 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.139e-125
Identity = 232/492 (47.15%), Postives = 321/492 (65.24%), Query Frame = 2
Query:  146 PRNKDFLNAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEI-EILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXS-GPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            PR     NAK++LL+ S    +SLY+ LV L+ K+  ++ ++    +E L R ++ E +  K  T++   E    + +AE QK+LF           ++    + +PN+M+T +YFEQA VG++ +ES R++LA+K LVE QPI   RFWGK+ G  R+Y + E E  EG++   +E    + +E  E     ET+   E +E+  +++D  PKP+WK P I+P EE+ +GTNK +YFVCN PG  W RL  VTPAQI  +R I+K+ TG LD+ + SYPPFPG E +YLRA I+RISA THISPLGFY F EEE + EEE    R  F E+P+FE IP+ +LVD S+ANW HH Q+ILPQGR +W NP  K  EE E  E+EE+ +E  E   +  GPPLLTP++ED E+  +  W+  LS ++ PQY+VA++ SNLWPGA+A+ATGK F+NIYIGWG KY   N NP++ A +Q E+ SG EITE+ DPT
Sbjct:  187 PRELAIQNAKAYLLRTSMSCNLSLYEHLVNLLTKILNQRPEDPLSILESLNRTMQWEWFHPKLDTLRDDPEMQPTYEMAEKQKALFIRGGGEGEQEMEEEVTDSPVPNIMETAFYFEQAGVGLSSDESFRIFLALKQLVEQQPIHMCRFWGKILGLSRSYLVAEVEFREGEEEGEEE----EVEEMMEGGEVLETHGEEEGEEDEEKVVDSVPKPQWKPPPIIPKEESRSGTNKYLYFVCNEPGRPWTRLPHVTPAQIVCARKIKKFFTGFLDTPVISYPPFPGNEANYLRAQIARISAATHISPLGFYQFGEEEGDEEEEGGAGRDSFEENPDFEGIPVLELVD-SMANWVHHTQHILPQGRCTWVNPLQKTEEEEELGEEEEKADEAMEEVEQEVGPPLLTPLSEDAEIMHLSPWTTRLSCSLSPQYSVAIVRSNLWPGAYAYATGKKFENIYIGWGHKYSPENFNPMLPALIQQEYPSGPEITEMSDPT 673          
BLAST of radial spoke head protein 6 homolog A vs. UniProt
Match: sp|Q8BYM7|RSH4A_MOUSE (Radial spoke head protein 4 homolog A OS=Mus musculus OX=10090 GN=Rsph4a PE=1 SV=2)

HSP 1 Score: 379.793 bits (974), Expect = 1.201e-120
Identity = 223/487 (45.79%), Postives = 310/487 (63.66%), Query Frame = 2
Query:  167 NAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEK---TKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXS-GPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            NAK++LL  S K+G++LYD L  ++ K+ +E+  +    IE + + +K  ++  K  T+    E    + +AE QK+LF     ++   D +LEE+   + LPN+M++ YYFEQA VG+  +E+ R++LA+K L +  PI   RFWGK+ G   NY + E E  +G+D    E + + ++ D       E  +              PK  +K+P ++P EE+  G NK VYFVCNVPG  W RL  VTPAQI T+R I+K+ TG LD+ + SYPPFPG E +YLRA I+RISA TH+SPLGFY F  EEE  EEE +  R  + E+P+FE I + DLV+ SL+NW HH QYILPQGR +W+NP  K+ +E EEEE++EEK E  +   +  GPPLLTPI+ED  +  +P+W+  LSS ++PQYA+AVL SNLWPGA+AF+ GK F+N YIGWG KY   N+ P     V  E+ SG EITE+ DP+
Sbjct:  212 NAKAYLLSTSSKSGLNLYDHLSKVLTKILDERPADAVDIIENISQDVKMAHFNKKLDTLHNEYEMLPAYEIAETQKALFLQG--HLEGADSELEEEMAESSLPNVMESAYYFEQAGVGLGTDETYRVFLALKQLTDTHPIQRCRFWGKILGLEMNYIVAEVEFRDGEDEEEVEEEGIAEERDNGGSEAGEEEEEEL-----------PKSLYKAPQVIPKEESRTGANKYVYFVCNVPGRPWVRLPSVTPAQIVTARKIKKFFTGRLDAAVISYPPFPGNESNYLRAQIARISAGTHVSPLGFYQF-GEEEGEEEEVEGGRDSYEENPDFEGIQVIDLVE-SLSNWVHHVQYILPQGRCNWFNPIQKDEDEEEEEEEDEEKGEEPDYIEQEVGPPLLTPISEDLGIQNIPSWTTQLSSNLIPQYAIAVLRSNLWPGAYAFSNGKKFENFYIGWGHKYCVENYTPPSPPPVYQEYPSGPEITEMNDPS 683          
BLAST of radial spoke head protein 6 homolog A vs. UniProt
Match: sp|Q9H0K4|RSH6A_HUMAN (Radial spoke head protein 6 homolog A OS=Homo sapiens OX=9606 GN=RSPH6A PE=1 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 8.158e-119
Identity = 221/486 (45.47%), Postives = 309/486 (63.58%), Query Frame = 2
Query:  167 NAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEK--TKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXS-GPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            NAK++LLQ S    +SLY+ LV L+ K+  ++ ++    +E L R  + E +  K  T++   E    + +AE QK+LF  +        +  EE   T +PN+M+T +YFEQA VG++ +ES R++LAMK LVE QPI   RFWGK+ G  R+Y + E E  EG++   +E      +  +      E     + ++ ++I+   PK  WK P ++P EE+ +G NK +YFVCN PG  W RL  VTPAQI  +R I+K+ TG LD+ + SYPPFPG E +YLRA I+RISA T +SPLGFY F EEE + EEE    R  + E+P+FE IP+ +LVD S+ANW HH Q+ILPQGR +W NP  K  EE +  E+EE+ +E  E   +  GPPLLTP++ED E+  +  W+  LS ++ PQY+VAV+ SNLWPGA+A+A+GK F+NIYIGWG KY   + NP + A +Q E+ SG EI E+ DPT
Sbjct:  201 NAKAYLLQTSINCDLSLYEHLVNLLTKILNQRPEDPLSVLESLNRTTQWEWFHPKLDTLRDDPEMQPTYKMAEKQKALFTRSGGGTEGEQEMEEEVGETPVPNIMETAFYFEQAGVGLSSDESFRIFLAMKQLVEQQPIHTCRFWGKILGIKRSYLVAEVEFREGEEEAEEEEVEEMTEGGEVMEAHGEEEGEEDEEKAVDIV---PKSVWKPPPVIPKEESRSGANKYLYFVCNEPGLPWTRLPHVTPAQIVNARKIKKFFTGYLDTPVVSYPPFPGNEANYLRAQIARISAATQVSPLGFYQFSEEEGDEEEEGGAGRDSYEENPDFEGIPVLELVD-SMANWVHHTQHILPQGRCTWVNPLQKTEEEEDLGEEEEKADEGPEEVEQEVGPPLLTPLSEDAEIMHLAPWTTRLSCSLCPQYSVAVVRSNLWPGAYAYASGKKFENIYIGWGHKYSPESFNPALPAPIQQEYPSGPEIMEMSDPT 682          
BLAST of radial spoke head protein 6 homolog A vs. UniProt
Match: sp|Q5TD94|RSH4A_HUMAN (Radial spoke head protein 4 homolog A OS=Homo sapiens OX=9606 GN=RSPH4A PE=1 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 1.999e-115
Identity = 222/486 (45.68%), Postives = 312/486 (64.20%), Query Frame = 2
Query:  167 NAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEK---TKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXSGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            NAK++LL+ S  +G +LYD L  ++ K+  E+ +N     E + + +K  +++ K   ++  NE    + +AE QK+LF     ++  +D +LE++     LPN+M++ +YFEQA VG+  +E+ R++LA+K L +  PI   RFWGK+ G   NY + E E  EG+D    E + + ++ D         N  +E  E+ E  DE PK  +K+P  +P EE+  G NK VYFVCN PG  W +L  V PAQI  +R I+K+ TG LD+ + SYPPFPG E +YLRA I+RISA TH+SPLGFY F EEE E EEE +  R+ F E+P+FE I + DLV+ SL+NW HH Q+IL QGR +W+N   KN EE EEE++E++  +  E E   G PLLTPI+ED E+  +P W+  LSS ++PQYA+AVL SNLWPGA+AF+ GK F+N YIGWG KY   N+ P V   V  E+ SG EITE++DP+
Sbjct:  213 NAKAYLLKTSSNSGFNLYDHLSNMLTKILNERPENAVDIFENISQDVKMAHFSKKFDALQNENELLPTYEIAEKQKALFLQG--HLEGVDQELEDEIAENALPNVMESAFYFEQAGVGLGTDETYRIFLALKQLTDTHPIQRCRFWGKILGLEMNYIVAEVEFREGEDEEEVEEEDVAEERD---------NGESEAHEDEE--DELPKSFYKAPQAIPKEESRTGANKYVYFVCNEPGRPWVKLPPVIPAQIVIARKIKKFFTGRLDAPIISYPPFPGNESNYLRAQIARISAGTHVSPLGFYQFGEEEGEEEEEAEGGRNSFEENPDFEGIQVIDLVE-SLSNWVHHVQHILSQGRCNWFNSIQKNEEEEEEEDEEKDDSDYIEQEV--GLPLLTPISEDLEIQNIPPWTTRLSSNLIPQYAIAVLQSNLWPGAYAFSNGKKFENFYIGWGHKYSPDNYTPPVPPPVYQEYPSGPEITEMDDPS 682          
BLAST of radial spoke head protein 6 homolog A vs. UniProt
Match: sp|A1L0Z6|RSH6A_XENTR (Radial spoke head protein 6 homolog A OS=Xenopus tropicalis OX=8364 GN=rsph6a PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 4.160e-102
Identity = 210/494 (42.51%), Postives = 294/494 (59.51%), Query Frame = 2
Query:  140 LIPRNKDFLNAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLE-EKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXS-GPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            L P       AKSFLLQ +D +G+SLY+ L  L+ ++  E+  N     E L  ++        +  ++   E S     AE+Q++LF          + + E  ++ LPNL+   +  +Q  V + R+E++R+ LA+K L +  P+    FWGK+ G+  +Y + E +          E +  + +E  E   K E     E +E  E  D PPK  ++ P ++P EENG G NK VY+VC+  G EW RL  VTPAQIS +R IR   TGNLD+ + +YPPFPG E + LRA I+RISA TH+SPLG+Y F EEE E EEE    R  + E+P+FE IP+ +LV+ SL+NW HH Q+ILPQGR  W N + K+ EE +EEE EEE++E +       GPPLLTP++ED E+   P W+A LS+ ++P YA+AVL SNLWPGA+  ++ K F+NIYIGWGLKY+   ++P      Q E+ SG EITE  DPT
Sbjct:   10 LDPEELQIQYAKSFLLQ-TDNSGLSLYEHLSALLSRILSERPPNALEVFESLSAELHWSRLKQGSDVLRAPREESHTCRKAEVQRALFSRGDGEGEESEAEGEMTESPLPNLLDLAHLLQQGGVNLGRDEAVRISLALKRLTDTHPLQVCHFWGKILGSGGSYLVAEVQF--------REGEDDEAEEGGEEEEKGEVEDDVEEEENEEAEDLPPKSTYRPPPVIPKEENGTGANKHVYYVCSEAGAEWVRLPPVTPAQISAARKIRHLFTGNLDAPVITYPPFPGTEINLLRAQIARISAGTHVSPLGYYQFGEEEGEEEEEGA-VRDTYEENPDFEGIPVSELVE-SLSNWVHHVQHILPQGRCVWVNTSVKSEEEEDEEEAEEEEKEEENEPEPEVGPPLLTPLSEDAEIGQTPPWTAFLSTHLIPHYALAVLRSNLWPGAYTVSSAKKFENIYIGWGLKYMPEGYSPPAPPAPQAEYPSGPEITESTDPT 492          
BLAST of radial spoke head protein 6 homolog A vs. TrEMBL
Match: gnl|BL_ORD_ID|22606572 (tr|A0A2C9K7T3|A0A2C9K7T3_BIOGL Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106056903 PE=4 SV=1)

HSP 1 Score: 439.884 bits (1130), Expect = 8.760e-144
Identity = 253/492 (51.42%), Postives = 341/492 (69.31%), Query Frame = 2
Query:  149 RNKDFLNAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHH-IDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXSGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPTPD 1621
            +NK+F  AK++LLQ S  TG+++YD L  ++ K+ +E+ DN     E++ +  KR  +     TI+   + S E  LA++Q+ LF     +    +  D + +T LPNLM+  ++FEQA +G+NREE +R+WLAMKNLV++ P+ ++RFWGK+ GT +NYY+ E E  EG +   +E +  + KE+ ++I K    +  + + E + +   PKP++KSP +VP EEN  G NKK YFVCN PG+ W +L  V+P QIS +R I+KY TG LD+ + SYPPFPG E +YLR+ I+RISA THISP GFY FDEEEEE EE  +  R  FVE+ +FE IP+R+L DPSL+NW HH Q+ILPQGR SWWNP  K  E+ EE+E+EEE+EE DEPEPE GPPLLTPI EDEEV GMPAW+  LSS ++ Q++VAV+ SNLWPGAHAFA  K F+NIYIG+G KY   N+ P     +Q EF SG EITE +DPTP+
Sbjct:   14 KNKEFQKAKAYLLQSSTATGLNVYDHLSRVLGKILDERPDNVVDIFEDISKDCKRTKFTSDVDTIQDKVDRSTEVALAQIQRKLFTRVGEDGEEEVAQDEDVETPLPNLMELCFFFEQAAIGLNREEVVRIWLAMKNLVDNHPLQHVRFWGKILGTEQNYYVAEVEYREGDEEEDEEEETEEAKEEDKDIDKDAGEEGEDEETEEDDI---PKPDFKSPPVVPKEENRTGANKKTYFVCNDPGKPWVKLPMVSPNQISAARQIKKYFTGRLDAPVVSYPPFPGNEANYLRSQIARISAGTHISPSGFYQFDEEEEEEEEG-EGGRDHFVENIDFEGIPVRELADPSLSNWVHHVQHILPQGRCSWWNPVQKAEEDFEEDEEEEEREEPDEPEPEVGPPLLTPIAEDEEVGGMPAWTPTLSSQLISQFSVAVMHSNLWPGAHAFAIDKKFENIYIGYGHKYKPENYTPPNPPPIQEEFPSGPEITEADDPTPE 501          
BLAST of radial spoke head protein 6 homolog A vs. TrEMBL
Match: gnl|BL_ORD_ID|20577259 (tr|A0A0B7B924|A0A0B7B924_9EUPU Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF167247 PE=4 SV=1)

HSP 1 Score: 427.943 bits (1099), Expect = 3.730e-139
Identity = 251/501 (50.10%), Postives = 344/501 (68.66%), Query Frame = 2
Query:  140 LIPRNKDFLNAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEE-------KTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXSGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPTPD 1621
            L  + KDF  AKS+LL  S  TGM+LYD L  ++ K+ +E+ DN     E++ +  KR  +     TI+   + S E  LA++Q+ LF  A+      DD  +E       +T LPNLM+  ++FEQA +G+NREE +R+WLA+K+LV+  P+ ++RFWGK+FGT +NYYI E E  EG++   +E +  +  ED+ +I  ++   + E +E     D+ PKP++K P I+P E+N  G N+KVYF+CN PG+ W RL  V P QI T+R I+KY+TG LD+ + SYPPFPG E +YLR+ I+RISA THISPLGFY FDEEEEE EE     R  FVE+ +FE +P ++L+DPSL+NW HH  +ILPQGR +WWNP  KN EE+++EE+EEEKEE DEPEPE GPPLLTP++ED+ +  +P+WS  LSS+++PQY++AV+ SNLWPGAHAFA  K F+NIYIG+G KY   N+ P     +Q EF S  EITE +DPTP+
Sbjct:   18 LAEKEKDFQKAKSYLLTASTNTGMNLYDHLSRVLGKILDERPDNVIDIFEDISKDEKRTKFTASQDTIQDKVDRSTEVALAQIQRKLFTKAT------DDGEDELIREEDVETPLPNLMEICFFFEQAGIGLNREEMVRVWLALKSLVDTHPLQHVRFWGKIFGTEQNYYIAEVEYREGEEEEEEEDEPEETPEDELSI--KDDAALKEEEE-----DDTPKPDFKPPPIIPKEDNKTGANRKVYFICNDPGKPWIRLPSVQPQQIITARQIKKYMTGRLDAAVVSYPPFPGNESNYLRSQIARISAGTHISPLGFYQFDEEEEEEEE--AEGRDHFVENIDFEGVPAKELIDPSLSNWVHHVHHILPQGRCTWWNPIQKNEEELDDEEEEEEKEEPDEPEPEVGPPLLTPVSEDDGIGSLPSWSPALSSSLIPQYSIAVMHSNLWPGAHAFAFEKKFENIYIGFGHKYKPENYTPPPPPAIQEEFPSLPEITEADDPTPE 503          
BLAST of radial spoke head protein 6 homolog A vs. TrEMBL
Match: gnl|BL_ORD_ID|25046618 (tr|C3ZMT5|C3ZMT5_BRAFL Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_123432 PE=4 SV=1)

HSP 1 Score: 427.557 bits (1098), Expect = 5.741e-139
Identity = 247/510 (48.43%), Postives = 351/510 (68.82%), Query Frame = 2
Query:   86 SNKSNRSARPTSSESENVLIPRNKDFLNAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXSGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            S K ++S  P    + N  + R  +  NAKS++L+ S  TG++LYD L  ++ K+ +E+ +N    IE++ ++ KR  + +K  T++   + + E  LAE  K LFE         + + E +T LPN+M+  YYFEQA +G++REE  R++LA+K LV+ +P+  +RFWGK+ GT  NY I E E       Y +  +  +++E+ E+  +++  +  + +E     D+ PKP++K P ++P EEN AG NKKVYFVCN  G+EW +L  VTPAQ++ +R I+K+LTG L++ + SYPPFPG E +YLRA I+RISA T +SPLGF+ FD EEEE +EE + +R  +VE+P+FE +P+RDL DPSLANW HH Q+ILPQGR +W+NP  K  +E E+EEDEEEKEE DEPEPE GPPLLTP++ED E++GMP W+A +SS +VPQYA+AV+ SNLWPG+ AF  G+ F+NIY+GWG KY + N++P     VQ EF SG EITEI+DPT
Sbjct:    2 STKGSKSGTPEPQNNAN--LQREMEIQNAKSYMLKASTNTGLNLYDHLSRVLTKVLDERPENVVDIIEDISKEAKRSKFVYKGDTVRDEFDKTTEVALAETHKMLFEKGEGEGGEPEAEEEVETPLPNIMELSYYFEQAGIGLSREECFRIFLALKQLVDTRPLQTVRFWGKVLGTEMNYIIAEVE-------YREGEEEEEEEEEGEDKDEEKDEEPQDEEEGEGEEDDIPKPDYKPPPVIPKEENRAGANKKVYFVCNEAGKEWVKLPPVTPAQLAVARKIKKFLTGRLEAPIISYPPFPGNESNYLRAQIARISAGTQVSPLGFFQFD-EEEEEQEEGEEARDTYVENPDFEPVPVRDLTDPSLANWVHHVQHILPQGRCTWFNPVQKQEDEFEDEEDEEEKEEPDEPEPEVGPPLLTPVSEDVEIDGMPPWTAKVSSHLVPQYAIAVVRSNLWPGSVAFCHGRRFENIYVGWGHKYASENYSPPPPPPVQEEFPSGPEITEIDDPT 501          
BLAST of radial spoke head protein 6 homolog A vs. TrEMBL
Match: gnl|BL_ORD_ID|23850579 (tr|V4ABQ0|V4ABQ0_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_118662 PE=4 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 1.616e-138
Identity = 257/515 (49.90%), Postives = 342/515 (66.41%), Query Frame = 2
Query:   77 MSTSNKSNRSARPTSSESENVLIPRNKDFLNAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXSGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPTPD 1621
            MSTS  +N   +P  + S   L  +  +F+ AKS+LL  S  TGM+LYD L  ++ ++ +E+ +N    IE++    KR  +  KA T++   + S E  LA+LQK LF            D E +T LPNLM+  +YFEQA +G+NREE IR+WLA+KNLV++ P+ ++RFWGK+ GT +NYY+ E   +E ++   +E +  + +ED       E  +    +++I      PKPE+KSP + P E+N  G NKK YFVCN PG+ W +L  V P Q+S +R I+K+ TG LD+ +  YPPF G E +YLRA I+RISA THISPLGFY FDEEEEE EE    +R  FVE+ +FE I +R+L DPSL NW HH Q+ILPQGR SWWNP  K+ ++ E+E++EEE+EE DEPEPE GPPLLTPI ED+EV GM  W+  LSS I+PQY++AV+ SNLWPGAHAFA  K F+NIYIG+G KY   N +P+    VQ EF SG EITE EDPTP+
Sbjct:    1 MSTS-PTNEEVKP-DTPSTTQLSAKENEFIKAKSYLLTASTNTGMNLYDHLSKVLNRVLDERPNNVADIIEDISNDTKRSKFTSKADTVQDKVDKSTEVALAQLQKKLFSKGEGEEEEPQPDEEVETPLPNLMELSFYFEQAAIGLNREEVIRVWLALKNLVDNHPLQHVRFWGKILGTEQNYYVAE---VEYREGDEEEEEEEENEEDTTEKDDAEEGEEETEEDDI------PKPEFKSPALPPKEDNRTGVNKKTYFVCNEPGKPWVKLPAVNPTQVSVARKIKKFFTGRLDAPVVCYPPFTGNESNYLRAQIARISAGTHISPLGFYQFDEEEEEEEE--GEARDHFVENLDFEGITVRELADPSLTNWVHHVQHILPQGRCSWWNPVQKSEDDFEDEDEEEEREEPDEPEPEVGPPLLTPIAEDDEVGGMSPWTPKLSSNIIPQYSIAVMHSNLWPGAHAFAFEKKFENIYIGYGHKYAQDNFSPVPPPAVQEEFPSGPEITEGEDPTPE 502          
BLAST of radial spoke head protein 6 homolog A vs. TrEMBL
Match: gnl|BL_ORD_ID|15729524 (tr|R7UDR4|R7UDR4_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_150439 PE=4 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 1.326e-137
Identity = 243/478 (50.84%), Postives = 332/478 (69.46%), Query Frame = 2
Query:  161 FLNAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXSGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEI 1594
            F NAKS+LLQ S KTG+SLY+ L  ++ ++ +E+  +     E+L R  K+  +  +  T++   + S E  LAE+Q+ LF            + + +T LPNLM+  YYFEQA VG+NREE +R+WLA+KNLV++ P+ ++RFWGK+FGT +NY I E E     ++  +E +  ++  +++   K   +  +E +EE +I    PKP++K P +VP EEN  G NKK YF+CN PG+ W +L  VTPAQIS +R ++K+ TG LD+ +  YPPFPG E +YLRA I+R+SA THISPLGFY FDEEEEE EE     R  FVE+ EFE IP+R+LVDPSL+NW HH Q+ILPQGR  WWNP  KN ++ E+EE++EE+EE DEPEPE GPPLLTP++ED EV+ MP W+  +SS +VPQYA++V+ SNLWPGAHAFAT K F+N+YIGWG KY + N++P  +  +Q EF SG EI
Sbjct:   16 FTNAKSYLLQVSTKTGLSLYEHLAAVLSRILDERPKDVVDTFEDLSRDQKKAKFTSEVDTVQDKIDKSTEVALAEIQEKLFSKGEGEDAEEIPEEDVETPLPNLMELCYYFEQAGVGLNREEMVRIWLALKNLVDNHPLQHVRFWGKIFGTEQNYIIAEVEY-REGEDEEEEEEEAEETHEEDTTEKDNDDDEDEENEEDDI----PKPDYKPPPVVPKEENRTGANKKTYFICNDPGKPWVKLPSVTPAQISLARKVKKFFTGRLDAPVVCYPPFPGNEANYLRAQIARVSAGTHISPLGFYQFDEEEEEEEE--GGGRDTFVENLEFEGIPVRELVDPSLSNWVHHVQHILPQGRCQWWNPVQKNEDDFEDEEEDEEREEPDEPEPEEGPPLLTPLSEDNEVDSMPPWTPKISSKLVPQYAISVMHSNLWPGAHAFATEKKFENVYIGWGHKYASDNYSPPPVPAIQEEFSSGPEI 486          
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Cavefish
Match: rsph4a (radial spoke head component 4A [Source:ZFIN;Acc:ZDB-GENE-030131-7437])

HSP 1 Score: 318.546 bits (815), Expect = 1.763e-100
Identity = 220/494 (44.53%), Postives = 308/494 (62.35%), Query Frame = 2
Query:  146 PRNKDFLNAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEE---KTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXX-XXXXXXXXXXXXXXXXXXXSGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            PR +  LN K+FLL+ S KT  + YD L  ++ K+ +E+  N     E++  ++K        ST++   E +  F LA+ QK+LF      I    D+ EE   +T LPNL++  ++F+QA+VG+ REE+ R++LA+K LV+ Q +   RFWGK+ G   NY + E E  + ++         + +E +++  ++E    +E    + I D  PK  +K P  VP E   +GTNK  YFVC  PG  W RL  VTPAQI  +R IRK  TG+LD+ + +YPPFPG E +YLRA I+RISA T +SPLGFY F  EEEE EE ++ +R  F+E+PEFE IP+ D+V+ SL+ W HH Q+I  QGR  W   + K  EE  +E E EE +EE DEPEPE GPPLLTP++ED  VN  P WS  +SS ++P+YA+A + SNLWPGA+A+A+G  F+NIYIGWGLKY+   + P +    Q E+ S  EITE+ DP+
Sbjct:   13 PRQQAALNFKAFLLKSSTKTNQN-YDHLARVLTKVMDERPPNAVDVFEDISLQVKANQLQDNQSTLRSIPENNAAFALAQEQKALF------IRGAGDEQEEGMAETPLPNLVEQSFFFDQAEVGLGREETQRIFLALKQLVDTQHLQRCRFWGKILGREANYIVAEVECRDEEEE--------QAEETQKDEEEEEARDEDEVGVGVHINDLLPKSTYKPPPSVPMEARSSGTNKFSYFVCREPGLPWVRLPDVTPAQIVVARQIRKLFTGHLDAPIITYPPFPGNEANYLRAQIARISAGTQVSPLGFYVF--EEEEEEEAEEGARDNFIENPEFEGIPVPDMVE-SLSTWVHHVQHINKQGRCVWVRISEKTEEELDDEAEGEEREEEPDEPEPEVGPPLLTPLSED-AVNNTPPWSTRISSNLIPEYAIAYVRSNLWPGAYAYASG-NFENIYIGWGLKYLGEPYTPPMPPTPQQEYPSEPEITEVLDPS 486          
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Sea Lamprey
Match: rsph4a (radial spoke head component 4A [Source:ZFIN;Acc:ZDB-GENE-030131-7437])

HSP 1 Score: 345.51 bits (885), Expect = 1.397e-111
Identity = 208/480 (43.33%), Postives = 297/480 (61.88%), Query Frame = 2
Query:  218 YDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEIL------------DEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXS--GPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            YD L  L+ +L +E+ +      EEL R++KR   A  A+T +     + +  LA+LQ+ LF  A+       DD   ++ LPNL++  +Y+EQA VG+ REE+ R+ LA+K LV+ QP+   RFWGK+  T   Y + E E  EG+    DE       E+KE    +ET++ +    E                D+ PK E+K P +   E    G N+  YFV N PG+ W++L  VTPAQI T+R IR+  TG+LD+ + SYPPFPG E + LRA I+RISA T +SPLGFY F+E+EEE EE+    R   +E+P+FE IP+R+LVD +LANW HH Q+ILPQGR  W NP  ++ +  EEE++E+E++  +  EPE   GPPLLTP++ED E+ G   W+A LSST VPQ+A +VL SNLWPG++A+  GK F+N+Y+GWG+KYV    +P ++    +E+  G E+ E +DP+
Sbjct:    1 YDHLASLLSRLLDERPNGALDMFEELSREVKRSRMAGVATTFRDERTTNAQDELAKLQRGLFPAANDKTDDDPDDEMVESPLPNLLEQAFYWEQAGVGLGREETFRILLALKQLVDEQPLQRCRFWGKVLATQGAYLVAEVEFREGEGEDEDEEGEEADAENKEG--GEETDRTSRGRGESTSGQSEGEGNGAVDDDDYPKSEYKPPPVTRREAMRFGANRYTYFVTNEPGKPWEKLPWVTPAQIVTARRIRRLFTGHLDAPVISYPPFPGNEANLLRAQIARISAGTQVSPLGFYQFEEDEEEGEEDAVGGRETCIENPDFEGIPVRELVD-NLANWVHHTQHILPQGRCVWINPKQRSEDPEEEEQEEDEEDTEEPDEPEPEVGPPLLTPLSEDAEIEGTAPWTARLSSTAVPQHAFSVLRSNLWPGSYAYCKGKIFENLYMGWGVKYVAGGFSPALVPMPCSEYAGGPEVAEEKDPS 477          
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Nematostella
Match: EDO48571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIU6])

HSP 1 Score: 397.512 bits (1020), Expect = 3.880e-131
Identity = 236/493 (47.87%), Postives = 328/493 (66.53%), Query Frame = 2
Query:  167 NAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFEN---ASF-----NIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEP-PKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKN-TXXXXXXXXXXXXXXXXXXXXXSGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            NAKS+LL+ S  + +++YD L  ++ +L  ++ +     ++EL R  KR  +     TI+   + S E +LA  Q++LFE     SF           D+   ++ LP++M+   YFEQA VG+NREE+ R++LA+K LV+  PI + R WGK+ G   NY I E E  EG+D  +D    +++ ++ E+IL  +  K     ++ ++ D+  PK ++K P  VP EEN  G NKK YFVC   G+ W RL  VTPAQI  +R I+K+ TGNLD+ + SYPPFPG E ++LRA I+RISATTHISPLG+Y F  EEEE EE++  +R  FV + EFE + + D+ DPS ANW HH QYILPQGR SW+NP+ K   EE+EEE++EEE+EE DEPEPE+GPPLLTP++ED EV+GMP W+ + SST+VPQY+++V+ SNLWPGAHAFA  + F+NIY+GWG KY   N++P      Q E+ SG +ITE EDP+
Sbjct:   18 NAKSYLLKTSASSNINVYDHLASVLTQLLTDRPEASTEILDELVRDKKRAVFKPNFDTIQDQQDDSTEVLLARTQQTLFERRPEKSFIEPEPEPDPELDEDLLESPLPDIMELANYFEQAGVGLNREETFRIFLALKQLVDSHPIRSCRLWGKILGLQGNYIIAEVEFHEGEDP-LD----MEEPQEHEHILTPDYRKSKHHLKDFDVEDDDIPKADYKPPSFVPKEENRTGCNKKTYFVCTEAGKPWVRLPSVTPAQIRVARQIKKFFTGNLDAPVVSYPPFPGNEANFLRAQIARISATTHISPLGYYMF--EEEEEEEDEAAARDTFVVNQEFEGLTVGDMTDPSCANWVHHVQYILPQGRCSWFNPSQKKDEEEMEEEDEEEEREEPDEPEPETGPPLLTPLSEDGEVDGMPPWATHKSSTLVPQYSISVMHSNLWPGAHAFALERKFENIYVGWGQKYAADNYSPPPPPVPQEEYPSGPDITEAEDPS 503          
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Nematostella
Match: EDO47350 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMI3])

HSP 1 Score: 343.584 bits (880), Expect = 1.496e-110
Identity = 222/487 (45.59%), Postives = 317/487 (65.09%), Query Frame = 2
Query:  158 DFLNAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEE-KTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXSGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPT 1615
            D  NAK++LL+ +  +  +LYD L  +I K+ +E+ +N    +E+   K+K      +   ++  +  + +   AE+Q+ LFE          +  E+ +T LP+LM   +YFEQA +G++REE  R++L++K LV+ +P+  + FWGKLFG   NYYI E E  EG++         +++E+ E   +++  + NE DEE+   D+ PK +WK P ++P EEN AG NKKVYFV   PG+ W +L  VTPAQI  SR IRK+LTG LD+ + SYPPFPG E +YLRA I+RISA +HISP G+Y F  EEEE EEE+   R  ++ + +FE I +R+L DPSL NW HH Q+ILPQGR  W NP  K  EE EEEE++EE++E++EP+ E+GP LL  + +DE VNGMPAW+  +SS ++P+YA+AV+ SN WPGA+AFA  K F+NIYIGWG KY   N+ P        E+ +  E+TE++DPT
Sbjct:    8 DIQNAKAYLLKNNASSNKNLYDHLSEVISKVLDERPNNCVDVLEDFSNKVK----IGEKEKVEDESAKAQDKETAEMQQKLFEKEGAGEGGEPEAEEDVETPLPDLMNLAFYFEQAGIGLSREEMFRIFLSLKQLVDSKPLQTVHFWGKLFGIENNYYIAEVEYREGEEEEE------EEEEEGEGEEEEKEKEENEEDEEVAEEDDTPKSDWKPPPVIPKEENRAGANKKVYFVTTEPGKPWIKLPPVTPAQIGISRQIRKFLTGRLDAPIVSYPPFPGNETNYLRAQIARISAGSHISPAGYYMF--EEEEEEEEEGEERDSYMLNVDFEGINVRELADPSLNNWVHHVQHILPQGRCVWHNPIEKTEEEFEEEEEDEERDEVEEPKKETGPTLLMSVADDEPVNGMPAWTPYVSSELLPKYALAVMRSNRWPGAYAFAKDKKFENIYIGWGHKYDASNYTPPPPPPTMEEYPTVPEVTEVDDPT 482          
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Medaka
Match: rsph4a (radial spoke head protein 4 homolog A [Source:NCBI gene;Acc:101159735])

HSP 1 Score: 300.442 bits (768), Expect = 2.894e-94
Identity = 194/445 (43.60%), Postives = 276/445 (62.02%), Query Frame = 2
Query:  173 KSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSK-NTXXXXXXXXXXXXXXXXXXXXXSGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIY 1504
            K+FL + S ++  +LYD LV+L+ K+ +E+ D+    +E++  ++KR ++     +++    PS+   LAE Q  LF++A  + +H D  +E  T  PN+ ++ +Y EQA VG+ REE  R+ LA+K LVE   +   R WGK+ GT  +Y I EAE  EG +    + DL +++E++    + ET+ V             P+  +  P +VP E  G G N+  YFVCN PG  W +L  V+PAQI+ +R I K  TG LDS + SYPPFPGKE +YLRA I+RISA T +SP GFY     EEE EEE++ +  + + +PEFE +   ++   SL++W HH Q+IL QGR +W N   K   + IEEEE  E+ E+ DEPEPE GPPLLT +++D E+   P WS  LSSTI PQ+AVAVL SNLWPGA A++ GK F+NIY
Sbjct:   28 KAFLQKSSSRSDRNLYDHLVLLLAKIMDERPDDAVDVLEDMSLELKRASFKDTQRSLRDHVTPSVGERLAEQQLLLFKHAQ-DFNHEDPTVE--TGFPNVNESAFYLEQAGVGLGREEMQRILLALKLLVESHGLPQCRLWGKILGTESSYIIAEAEYTEGDEEQSTDEDLQEEEEEESGTQENETDPV-------------PRSTYLHPPMVPKEALGTGANRFFYFVCNEPGLPWVKLPSVSPAQITAARHICKGFTGRLDSPVLSYPPFPGKEANYLRAQIARISAGTQVSPSGFY--QTVEEEGEEEEEMAHDQCLVNPEFEGVSSLEMAQ-SLSSWVHHIQHILKQGRCTWVNTAMKVEEDSIEEEEAAEKDEQADEPEPEYGPPLLTNLSQDAEMFHTPPWSLRLSSTITPQHAVAVLRSNLWPGAFAYSNGKRFENIY 453          
BLAST of radial spoke head protein 6 homolog A vs. Planmine SMEST
Match: SMESG000044179.1 (SMESG000044179.1)

HSP 1 Score: 987.638 bits (2552), Expect = 0.000e+0
Identity = 513/515 (99.61%), Postives = 514/515 (99.81%), Query Frame = 2
Query:   77 MSTSNKSNRSARPTSSESENVLIPRNKDFLNAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXSGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPTPD 1621
            MSTSNKSNR ARPTSSESENVLIPRNKDFLNAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEE+EILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDEEEEEAEEEDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTEEIEEEEDEEEKEEMDEPEPESGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPTPD
Sbjct:    1 MSTSNKSNRPARPTSSESENVLIPRNKDFLNAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEELEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDEEEEEAEEEDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTEEIEEEEDEEEKEEMDEPEPESGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPTPD 515          
BLAST of radial spoke head protein 6 homolog A vs. Planmine SMEST
Match: SMESG000079294.1 (SMESG000079294.1)

HSP 1 Score: 796.579 bits (2056), Expect = 0.000e+0
Identity = 418/419 (99.76%), Postives = 419/419 (100.00%), Query Frame = 2
Query:  365 MEFVLAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXSGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPTPD 1621
            MEFVLAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEE+EILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDEEEEEAEEEDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTEEIEEEEDEEEKEEMDEPEPESGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPTPD
Sbjct:    1 MEFVLAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEELEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDEEEEEAEEEDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTEEIEEEEDEEEKEEMDEPEPESGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPTPD 419          
BLAST of radial spoke head protein 6 homolog A vs. Planmine SMEST
Match: SMESG000044927.1 (SMESG000044927.1)

HSP 1 Score: 354.755 bits (909), Expect = 1.846e-114
Identity = 221/484 (45.66%), Postives = 303/484 (62.60%), Query Frame = 2
Query:  173 KSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLFENASFNIHHI--DDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXSGPPLLTPINEDEEVNGMPAWSANLSSTIVPQYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQEITEIEDPTP 1618
            K++L     + G SL+  L   I+K+ EE+ +N  ++I E      REN   +  +     + S++  LAE+QK LF     +      +DD+E  T LPN+M T +++EQA + +NREE  R+ LAMK LV  QP+   RFWGK+FG  +NYY+ E E  EG++   +E +    +ED+ N  +Q+  +  E            K  WK+P ++P EE   G NKKVYFVCN  G+ W RL  VTPAQI  +R I+KY TG LD+++ S PPFPG E + LRA I+RISA T ISP+GFYTFD EEEEAEE  +  +  ++E+P++  + L++L DPSL+NW HH  +ILPQGR  WWNPT KN    +E E+EEE+      E E GP LLTPI++D  V G+  W+  +SS+ +P+YAV V+SSNLW GAHAFA GK F+N+YIGWG K    N+ P   A +  E++ G+EITEI DPTP
Sbjct:   30 KTYLTVNQLENGKSLFSHLTNCIKKILEERPNNA-LDIFENYSDNVREN---RLKSDSYGQDMSIDVGLAEIQKELFSKGDGDEEEAVPEDDIE--TPLPNMMLTAFFYEQAGLVMNREEVYRVSLAMKKLVNTQPVEKARFWGKIFGIHQNYYVAEVEFREGEEIEEEEEETEVVEEDR-NESRQDEEEEPEDLPP--------KSSWKAPPVIPKEEFRTGANKKVYFVCNEAGKPWIRLPHVTPAQIQITRKIKKYFTGMLDAEVKSSPPFPGLEINLLRAQIARISAGTQISPIGFYTFDNEEEEAEE--ETIQDNYIENPDYAPLHLKELADPSLSNWVHHTNHILPQGRCVWWNPTQKNE---DEFEEEEEEVMETTVEAERGPSLLTPISQDFSVEGLQPWTVRISSSRIPEYAVTVVSSNLWLGAHAFAFGKHFNNVYIGWGFKENQNNYAPCPPAEILVEYVGGKEITEIADPTP 493          
BLAST of radial spoke head protein 6 homolog A vs. Planmine SMEST
Match: SMESG000018289.1 (SMESG000018289.1)

HSP 1 Score: 270.011 bits (689), Expect = 1.017e-81
Identity = 207/513 (40.35%), Postives = 301/513 (58.67%), Query Frame = 2
Query:  140 LIPRNKDFLNAKSFLLQPSDKTGMSLYDFLVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFVLAELQKSLF-----------ENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREESIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDEFDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEENGAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLASYPPFPGKERHYLRAIISRISATTHISPLGFYTFDXXXXXXXXXDKNSRSKFVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTXXXXXXXXXXXXXXXXXXXXXSGP------PLLTPINEDEEVNGMPAWSANLSSTIVP-QYAVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEFLSGQE---ITEIEDPT 1615
            L P ++++ N K +L   S++TG++LYD LV LI+ L E   +N     E++ +++KR    +    +    +PS E  LA++QK LF           +    N   I+DD EE++ LPNLM   ++FEQA VG+NREE  R+W+ MK L +   ++ + FWGK+ G  +NYYI + E  EG+D   +E +  ++++++     +E NK  E  EE       PK +WK P  +P EE G G NK +YF CN PG+ W RL +VTP QI+ SR I K+ TG     + S+PPFPGKE + L   + RISA T++SP GFY     +EE E E+       ++  EFE   L +L+DP L  W HHG +IL QGR  + +P +K+ EE EEEE+EEE+EE +  E           PLL+P+ ED+ +NG PAW   +SS +VP +YAV  LSS  WPGAHAFA G+ F N+Y+G+G KY+  N++P+ L  +  E++  +    + E  DPT
Sbjct:    9 LAPNDQEYANTKGYLQSLSNQTGLNLYDHLVSLIKYLLEHHPNNAVDGFEQISQEVKRLRMGNNDDMMHGKLDPSTEVDLAQIQKKLFWRKLPTADMPIDTEPENPDEIEDDDEEESPLPNLMLNVFFFEQAGVGVNREEIFRVWMGMKQLAKKSRLSKVTFWGKVLGLSQNYYITQVEFEEGEDEEEEEEEEPEEEQEEAPETAEEINKA-EGAEEEIPPPPFPKNKWKPPKKLPPEEKGRGANKNIYFACNEPGKPWFRLPRVTPEQITVSRQITKFFTGRPGEDVISFPPFPGKEINLLAVQVIRISAATYVSPSGFYE---MDEEEEPEEDEVPENLIQAEEFEPPELEELLDPELTGWVHHGLHILKQGRCQYADPKAKDEEEEEEEEEEEEEEEEEGAEEAEEEEPEEGPPLLSPLEEDDPINGNPAWRVRISSLLVPPKYAVVCLSSLRWPGAHAFAQGQNFANLYLGFGHKYIADNYSPIDLPKIMKEYVHPERKPPLKEALDPT 517          
The following BLAST results are available for this feature:
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RSPH6A1.699e-11945.47radial spoke head 6 homolog A [Source:HGNC Symbol;... [more]
RSPH4A4.163e-11645.68radial spoke head component 4A [Source:HGNC Symbol... [more]
RSPH6A3.837e-11147.85radial spoke head 6 homolog A [Source:HGNC Symbol;... [more]
RSPH6A9.050e-10244.57radial spoke head 6 homolog A [Source:HGNC Symbol;... [more]
RSPH4A5.163e-7542.98radial spoke head component 4A [Source:HGNC Symbol... [more]
back to top
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG31217.372e-3129.17gene:FBgn0034957 transcript:FBtr0072161[more]
back to top
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rsph4a1.041e-10944.19radial spoke head component 4A [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cc2d2a1.067e-10242.51coiled-coil and C2 domain containing 2A [Source:Xe... [more]
back to top
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rsph6a1.629e-12647.15radial spoke head 6 homolog A (Chlamydomonas) [Sou... [more]
Rsph4a1.717e-12145.79radial spoke head 4 homolog A (Chlamydomonas) [Sou... [more]
Rsph6a3.670e-3057.89radial spoke head 6 homolog A (Chlamydomonas) [Sou... [more]
back to top
BLAST of radial spoke head protein 6 homolog A vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CDR2|RSH6A_MOUSE1.139e-12547.15Radial spoke head protein 6 homolog A OS=Mus muscu... [more]
sp|Q8BYM7|RSH4A_MOUSE1.201e-12045.79Radial spoke head protein 4 homolog A OS=Mus muscu... [more]
sp|Q9H0K4|RSH6A_HUMAN8.158e-11945.47Radial spoke head protein 6 homolog A OS=Homo sapi... [more]
sp|Q5TD94|RSH4A_HUMAN1.999e-11545.68Radial spoke head protein 4 homolog A OS=Homo sapi... [more]
sp|A1L0Z6|RSH6A_XENTR4.160e-10242.51Radial spoke head protein 6 homolog A OS=Xenopus t... [more]
back to top
BLAST of radial spoke head protein 6 homolog A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|226065728.760e-14451.42tr|A0A2C9K7T3|A0A2C9K7T3_BIOGL Uncharacterized pro... [more]
gnl|BL_ORD_ID|205772593.730e-13950.10tr|A0A0B7B924|A0A0B7B924_9EUPU Uncharacterized pro... [more]
gnl|BL_ORD_ID|250466185.741e-13948.43tr|C3ZMT5|C3ZMT5_BRAFL Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|238505791.616e-13849.90tr|V4ABQ0|V4ABQ0_LOTGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|157295241.326e-13750.84tr|R7UDR4|R7UDR4_CAPTE Uncharacterized protein OS=... [more]
back to top
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rsph4a1.763e-10044.53radial spoke head component 4A [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rsph4a1.397e-11143.33radial spoke head component 4A [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO485713.880e-13147.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473501.496e-11045.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of radial spoke head protein 6 homolog A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rsph4a2.894e-9443.60radial spoke head protein 4 homolog A [Source:NCBI... [more]
back to top
BLAST of radial spoke head protein 6 homolog A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000044179.10.000e+099.61SMESG000044179.1[more]
SMESG000079294.10.000e+099.76SMESG000079294.1[more]
SMESG000044927.11.846e-11445.66SMESG000044927.1[more]
SMESG000018289.11.017e-8140.35SMESG000018289.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025231 ID=SMED30025231|Name=radial spoke head protein 6 homolog A|organism=Schmidtea mediterranea sexual|type=transcript|length=2090bp
CTAAAGTTAGAATATTTGAAATTAAATTTCTAATTTCATTAAATAATTCA
AGATTATTTATTAAATAAGAACTCTAATGTCTACATCGAATAAATCGAAT
AGATCTGCAAGGCCGACGAGTTCAGAATCGGAAAATGTTTTGATACCGAG
AAATAAAGATTTCTTAAATGCAAAATCTTTCCTTCTGCAACCATCTGACA
AAACCGGAATGTCTCTATATGATTTCCTGGTTATTCTGATAAGGAAATTG
TACGAAGAGAAAACAGACAATAAACAGATTAACATTGAAGAGTTATGTAG
GAAAATTAAAAGAGAAAATTATGCACACAAAGCCAGCACAATAAAACAGT
CAAATGAGCCTTCAATGGAGTTCGTTTTAGCAGAATTGCAGAAATCGCTT
TTTGAGAATGCCTCTTTCAATATACATCATATTGATGATGATCTTGAAGA
GAAAACGAAATTGCCGAATCTGATGCAAACATTTTACTATTTCGAACAAG
CCCAAGTCGGGATAAATCGTGAAGAAAGCATTCGGTTGTGGCTGGCAATG
AAAAATTTGGTGGAGCATCAACCAATAGCTAATATGAGATTCTGGGGCAA
ATTATTTGGAACTGTTAGAAATTATTATATCGTTGAGGCGGAAATGATAG
AAGGAAAAGATAACTATATGGATGAATTCGATTTATTAAAACAAAAGGAA
GATAAAGAAAATATTCTGAAACAAGAAACAAATAAGGTCAATGAAACGGA
TGAAGAAATTGAAATATTGGATGAGCCCCCAAAACCAGAATGGAAGTCAC
CGGTTATCGTGCCATTTGAAGAGAATGGAGCTGGAACAAATAAAAAAGTT
TATTTTGTTTGCAATGTCCCCGGTGAAGAATGGCAAAGATTATCGAAAGT
TACTCCTGCTCAAATTTCTACGTCAAGATTGATTAGAAAATACTTAACTG
GAAACCTAGATTCAAAATTAGCAAGTTATCCGCCATTTCCTGGAAAAGAG
CGGCATTATTTGCGAGCGATAATTTCCCGAATTTCTGCTACTACTCACAT
CTCCCCATTAGGTTTTTATACTTTTGATGAAGAAGAAGAAGAAGCAGAAG
AAGAAGACAAAAATTCACGAAGCAAATTTGTCGAAGATCCGGAATTTGAA
CAAATTCCTTTGAGAGATTTAGTCGATCCAAGTTTAGCAAATTGGGCTCA
TCATGGTCAATATATCTTACCCCAAGGAAGGACTTCCTGGTGGAATCCAA
CTTCAAAAAACACAGAAGAAATAGAAGAGGAAGAAGATGAAGAAGAAAAG
GAAGAAATGGATGAACCCGAACCTGAGTCGGGACCTCCTTTGCTAACACC
AATAAATGAAGATGAAGAAGTCAATGGAATGCCAGCATGGTCAGCAAACT
TGTCGTCAACAATTGTTCCCCAATATGCTGTGGCAGTGTTATCATCTAAC
TTATGGCCTGGGGCTCATGCCTTTGCAACTGGAAAAACCTTCGATAACAT
TTATATTGGATGGGGATTGAAATATGTTACACCAAATCATAATCCTTTGG
TTTTGGCTGGGGTTCAGACTGAATTTTTGTCGGGTCAGGAAATCACAGAA
ATTGAAGACCCAACACCAGATGAAGAAGCAGCGGCCCGGGCAGCATTAGC
TCAAGCTGCTGAACAAGCTGAAGAAGCCGAAGAAGGCGAAGAAGGAGAAG
AAGAAGGTGAAGAAGAAGACGATTAAATTTTAGTGACTAAATCATGTATT
AAAGGTTTAAAAAAATGATTGAAGATTTTTAAATTTGATGAATTTTGGAA
ACATTTTTTTTTAGACTAATTGGTTTTTCCATTTGATTTCTATGAAAATA
TGCCATAAAATCTTACTTTTTATATTGTTTTTATTGATTCTCGGCATATC
GGAGACCCAAATTACCATATTATTTCCGGCAACCAGGAGAGTTATAAATA
TGATAATATTTCCAACAATTATTTACTCACATGAAGCTTTCCCTTTTTGT
CTTCTGTCAATAAAATCTCTCCAGCTTCATTTATTTTATAATTATATATT
GTTTGTTTAAACTAATTGACTACAACCTCCAGTTTTGTCG
back to top

protein sequence of SMED30025231-orf-1

>SMED30025231-orf-1 ID=SMED30025231-orf-1|Name=SMED30025231-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=550bp
MSTSNKSNRSARPTSSESENVLIPRNKDFLNAKSFLLQPSDKTGMSLYDF
LVILIRKLYEEKTDNKQINIEELCRKIKRENYAHKASTIKQSNEPSMEFV
LAELQKSLFENASFNIHHIDDDLEEKTKLPNLMQTFYYFEQAQVGINREE
SIRLWLAMKNLVEHQPIANMRFWGKLFGTVRNYYIVEAEMIEGKDNYMDE
FDLLKQKEDKENILKQETNKVNETDEEIEILDEPPKPEWKSPVIVPFEEN
GAGTNKKVYFVCNVPGEEWQRLSKVTPAQISTSRLIRKYLTGNLDSKLAS
YPPFPGKERHYLRAIISRISATTHISPLGFYTFDEEEEEAEEEDKNSRSK
FVEDPEFEQIPLRDLVDPSLANWAHHGQYILPQGRTSWWNPTSKNTEEIE
EEEDEEEKEEMDEPEPESGPPLLTPINEDEEVNGMPAWSANLSSTIVPQY
AVAVLSSNLWPGAHAFATGKTFDNIYIGWGLKYVTPNHNPLVLAGVQTEF
LSGQEITEIEDPTPDEEAAARAALAQAAEQAEEAEEGEEGEEEGEEEDD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0001534radial spoke
GO:0005622intracellular
GO:0005929cilium
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
GO:0060294cilium movement involved in cell motility
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR006802Radial_spoke
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 204..227
NoneNo IPR availableCOILSCoilCoilcoord: 517..548
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 510..549
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 397..416
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 390..422
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 531..549
IPR006802Radial spokehead-like proteinPFAMPF04712Radial_spokecoord: 29..523
e-value: 1.2E-174
score: 581.9
IPR006802Radial spokehead-like proteinPANTHERPTHR13159RADIAL SPOKEHEAD-RELATEDcoord: 26..547