Eukaryotic initiation factor 4A

Overview
NameEukaryotic initiation factor 4A
Smed IDSMED30025220
Length (bp)1469
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eukaryotic initiation factor 4A (SMED30025220) t-SNE clustered cells

Violin plots show distribution of expression levels for Eukaryotic initiation factor 4A (SMED30025220) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Eukaryotic initiation factor 4A (SMED30025220) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Eukaryotic initiation factor 4A (SMED30025220) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025220

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30025220SMESG000058317.1 dd_Smed_v4_349_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025220SMESG000058317.1 dd_Smed_v4_349_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025220SMESG000058317.1 dd_Smed_v4_349_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025220SMESG000058317.1 dd_Smed_v4_349_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025220SMESG000058317.1 Contig39323uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025220SMESG000058317.1 Contig39323newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30025220SMESG000058317.1 dd_Smed_v4_349_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Human
Match: EIF4A1 (eukaryotic translation initiation factor 4A1 [Source:HGNC Symbol;Acc:HGNC:3282])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 282/390 (72.31%), Postives = 334/390 (85.64%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLE-NGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N+ ++ +SFDDMNL E LLRGIYAYGFEKPSAIQQRA+LP I+G+DVIAQAQSGTGKTATF+++ILQ+I++     QALVLAPTRELA+QI KV++ALGDYMGA  +ACIGGT V+ +V  L+    H+IVGTPGRV DM+ R  L    IKMFVLDEADEMLSRGFK+QI+ + Q +  +TQ+VLLSATMP DVLEVT+KFMR+P++ILVKKEELTLEGIRQFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS+MHGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAIN VT++D RTL+D+E++Y+T IEEMP+N+ADLI
Sbjct:   17 MEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 406          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Human
Match: EIF4A2 (eukaryotic translation initiation factor 4A2 [Source:HGNC Symbol;Acc:HGNC:3284])

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 276/390 (70.77%), Postives = 334/390 (85.64%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLE-NGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            M+  G IE+N+ ++ ++FDDMNLKE LLRGIYAYGFEKPSAIQQRA++P I+G+DVIAQAQSGTGKTATF+++ILQ++++   E QALVLAPTRELA+QI KVI+ALGDYMGA  +ACIGGT V+ ++  L+    H++VGTPGRV DM+ R  L    IKMFVLDEADEMLSRGFK+QI+ + Q +    Q+VLLSATMP DVLEVT+KFMR+P++ILVKKEELTLEGI+QFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAINFVT++D R L+D+E++Y+T +EEMPMN+ADLI
Sbjct:   19 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 408          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Human
Match: EIF4A2 (eukaryotic translation initiation factor 4A2 [Source:HGNC Symbol;Acc:HGNC:3284])

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 276/390 (70.77%), Postives = 334/390 (85.64%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLE-NGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            M+  G IE+N+ ++ ++FDDMNLKE LLRGIYAYGFEKPSAIQQRA++P I+G+DVIAQAQSGTGKTATF+++ILQ++++   E QALVLAPTRELA+QI KVI+ALGDYMGA  +ACIGGT V+ ++  L+    H++VGTPGRV DM+ R  L    IKMFVLDEADEMLSRGFK+QI+ + Q +    Q+VLLSATMP DVLEVT+KFMR+P++ILVKKEELTLEGI+QFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAINFVT++D R L+D+E++Y+T +EEMPMN+ADLI
Sbjct:   18 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 407          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Human
Match: EIF4A3 (eukaryotic translation initiation factor 4A3 [Source:HGNC Symbol;Acc:HGNC:18683])

HSP 1 Score: 518.079 bits (1333), Expect = 0.000e+0
Identity = 260/385 (67.53%), Postives = 319/385 (82.86%), Query Frame = 2
Query:   89 EIETNYE-KVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            E ET+ E  VT +FD M L+EDLLRGIYAYGFEKPSAIQQRA+   I+G DVIAQ+QSGTGKTATFS+++LQ +D+   E QAL+LAPTRELA QI K ++ALGDYM  + +ACIGGT V ED+  L+ G HV+ GTPGRV DMI R +L+T  IKM VLDEADEML++GFKEQI+ V +Y+   TQ+VL+SAT+P ++LE+T KFM +P++ILVK++ELTLEGI+QF+V V  EE+KF+TL DLY+TLTITQAVIFCNT+RKVD LT+ ++   F VSSMHGDM Q  R+ IMKEFRSG+SR+LI+TD+ ARG+DV QVSL+INYDLP+NRE YIHRIGR GR+GRKGVAINFV  DDIR L+D+E YYST I+EMPMN+ADLI
Sbjct:   27 EFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 411          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Human
Match: EIF4A3 (eukaryotic translation initiation factor 4A3 [Source:HGNC Symbol;Acc:HGNC:18683])

HSP 1 Score: 518.079 bits (1333), Expect = 0.000e+0
Identity = 260/385 (67.53%), Postives = 319/385 (82.86%), Query Frame = 2
Query:   89 EIETNYE-KVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            E ET+ E  VT +FD M L+EDLLRGIYAYGFEKPSAIQQRA+   I+G DVIAQ+QSGTGKTATFS+++LQ +D+   E QAL+LAPTRELA QI K ++ALGDYM  + +ACIGGT V ED+  L+ G HV+ GTPGRV DMI R +L+T  IKM VLDEADEML++GFKEQI+ V +Y+   TQ+VL+SAT+P ++LE+T KFM +P++ILVK++ELTLEGI+QF+V V  EE+KF+TL DLY+TLTITQAVIFCNT+RKVD LT+ ++   F VSSMHGDM Q  R+ IMKEFRSG+SR+LI+TD+ ARG+DV QVSL+INYDLP+NRE YIHRIGR GR+GRKGVAINFV  DDIR L+D+E YYST I+EMPMN+ADLI
Sbjct:   27 EFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 411          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Celegans
Match: inf-1 (Eukaryotic initiation factor 4A [Source:UniProtKB/Swiss-Prot;Acc:P27639])

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 273/385 (70.91%), Postives = 321/385 (83.38%), Query Frame = 2
Query:   86 GEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            G IE NY++V ESFDDM LKE+LLRGIY +GFEKPSAIQ+RA++P   G DVIAQAQSGTGKTATFSV+ILQRID     VQALV+APTRELA+QI KV+ ALG+Y+      CIGGT V++D   LE G+HV+VGTPGRV DMI R  L T+ IKMFVLDEADEMLSRGFK+QI+ V + +  D Q+VLLSATMP +VL+VT +FMRNP++ILVKK+ELTLEGIRQFY+NV  +E+KF+ L DLY  + +TQAVIFCNTRRKVD LT+ +   QF VS +HGDM Q  RD IM+EFRSGSSR+LITTD+LARGIDVQQVSLVINYDLPSNRENYIHRIGR GRFGRKGVAINFVT++D R L+++ESYY+T IEEMP +IADLI
Sbjct:   18 GLIEGNYDQVVESFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKDVIAQAQSGTGKTATFSVSILQRIDHEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVRDDQRKLEAGIHVVVGTPGRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQFYINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTVSCLHGDMDQAERDTIMREFRSGSSRVLITTDILARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKGVAINFVTENDARQLKEIESYYTTQIEEMPESIADLI 402          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Celegans
Match: inf-1 (Eukaryotic initiation factor 4A [Source:UniProtKB/Swiss-Prot;Acc:P27639])

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 273/385 (70.91%), Postives = 321/385 (83.38%), Query Frame = 2
Query:   86 GEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            G IE NY++V ESFDDM LKE+LLRGIY +GFEKPSAIQ+RA++P   G DVIAQAQSGTGKTATFSV+ILQRID     VQALV+APTRELA+QI KV+ ALG+Y+      CIGGT V++D   LE G+HV+VGTPGRV DMI R  L T+ IKMFVLDEADEMLSRGFK+QI+ V + +  D Q+VLLSATMP +VL+VT +FMRNP++ILVKK+ELTLEGIRQFY+NV  +E+KF+ L DLY  + +TQAVIFCNTRRKVD LT+ +   QF VS +HGDM Q  RD IM+EFRSGSSR+LITTD+LARGIDVQQVSLVINYDLPSNRENYIHRIGR GRFGRKGVAINFVT++D R L+++ESYY+T IEEMP +IADLI
Sbjct:   18 GLIEGNYDQVVESFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKDVIAQAQSGTGKTATFSVSILQRIDHEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVRDDQRKLEAGIHVVVGTPGRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQFYINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTVSCLHGDMDQAERDTIMREFRSGSSRVLITTDILARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKGVAINFVTENDARQLKEIESYYTTQIEEMPESIADLI 402          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Celegans
Match: inf-1 (Eukaryotic initiation factor 4A [Source:UniProtKB/Swiss-Prot;Acc:P27639])

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 273/385 (70.91%), Postives = 321/385 (83.38%), Query Frame = 2
Query:   86 GEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            G IE NY++V ESFDDM LKE+LLRGIY +GFEKPSAIQ+RA++P   G DVIAQAQSGTGKTATFSV+ILQRID     VQALV+APTRELA+QI KV+ ALG+Y+      CIGGT V++D   LE G+HV+VGTPGRV DMI R  L T+ IKMFVLDEADEMLSRGFK+QI+ V + +  D Q+VLLSATMP +VL+VT +FMRNP++ILVKK+ELTLEGIRQFY+NV  +E+KF+ L DLY  + +TQAVIFCNTRRKVD LT+ +   QF VS +HGDM Q  RD IM+EFRSGSSR+LITTD+LARGIDVQQVSLVINYDLPSNRENYIHRIGR GRFGRKGVAINFVT++D R L+++ESYY+T IEEMP +IADLI
Sbjct:   18 GLIEGNYDQVVESFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKDVIAQAQSGTGKTATFSVSILQRIDHEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVRDDQRKLEAGIHVVVGTPGRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQFYINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTVSCLHGDMDQAERDTIMREFRSGSSRVLITTDILARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKGVAINFVTENDARQLKEIESYYTTQIEEMPESIADLI 402          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Celegans
Match: F33D11.10 (pep chromosome:WBcel235:I:5866514:5868139:-1 gene:WBGene00018007.1 transcript:F33D11.10.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F33D11.10)

HSP 1 Score: 516.924 bits (1330), Expect = 0.000e+0
Identity = 257/385 (66.75%), Postives = 319/385 (82.86%), Query Frame = 2
Query:   89 EIETNYE-KVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            E E++ E  V  +FD M L+EDLLRGIYAYGFEKPSAIQQRAV   ++  DVIAQAQSGTGKTATFS+++LQ +D    E QAL+L+PTRELA QI KV++ALGDYM  + +ACIGGT + ED+  L+ G HV+ GTPGRV DMI R NL+T  IK+ VLDEADEML++GFKEQ++ + +Y+    Q+VLLSAT+P ++LE+T KFM +P++ILVK++ELTLEGI+QF+V V  EE+KF+TL DLY+TLTITQAV+FCNTRRKVD LTD +K   F VSSMHGDM+Q  RD++MKEFR+G++R+LI+TD+ ARG+DV QVSLVINYDLP+NRE YIHRIGR GRFGRKGVAINFV QDD+R L+D+E YYST I+EMPMNIAD+I
Sbjct:   15 EFESSEEVNVIPTFDKMGLREDLLRGIYAYGFEKPSAIQQRAVPAILKARDVIAQAQSGTGKTATFSISVLQSLDTQVRETQALILSPTRELAVQIQKVVLALGDYMNVQCHACIGGTNLGEDIRKLDYGQHVVSGTPGRVFDMIRRRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYRYLPPGAQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVDREEWKFDTLIDLYDTLTITQAVLFCNTRRKVDWLTDKMKEANFTVSSMHGDMEQKDRDEVMKEFRAGTTRVLISTDVWARGLDVPQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKQDDVRILRDIEQYYSTQIDEMPMNIADII 399          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Celegans
Match: Y65B4A.6 (pep chromosome:WBcel235:I:629492:636350:-1 gene:WBGene00022029.1 transcript:Y65B4A.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y65B4A.6)

HSP 1 Score: 515.768 bits (1327), Expect = 0.000e+0
Identity = 255/385 (66.23%), Postives = 319/385 (82.86%), Query Frame = 2
Query:   89 EIETNYE-KVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            E E++ E  +  +FD M L+EDLLRGIYAYGFEKPSAIQQRA+   ++  DVIAQAQSGTGKTATFS+++LQ +D    E QAL+L+PTRELA QI KV++ALGDYM  + +ACIGGT + ED+  L+ G HV+ GTPGRV DMI R NL+T  IK+ VLDEADEML++GFKEQ++ + +Y+    Q+VLLSAT+P ++LE+T KFM +P++ILVK++ELTLEGI+QF+V V  EE+KF+TL DLY+TLTITQAV+FCNTRRKVD LTD +K   F VSSMHGDM+Q  RD++MKEFR+G++R+LI+TD+ ARG+DV QVSLVINYDLP+NRE YIHRIGR GRFGRKGVAINFV QDD+R L+D+E YYST I+EMPMNIAD+I
Sbjct:   15 EFESSEEVSIIPTFDKMGLREDLLRGIYAYGFEKPSAIQQRAIPAILKARDVIAQAQSGTGKTATFSISVLQSLDTQVRETQALILSPTRELAVQIQKVVLALGDYMNVQCHACIGGTNLGEDIRKLDYGQHVVSGTPGRVFDMIRRRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYRYLPPGAQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVDREEWKFDTLIDLYDTLTITQAVLFCNTRRKVDWLTDKMKEANFTVSSMHGDMEQKDRDEVMKEFRAGTTRVLISTDVWARGLDVPQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKQDDVRILRDIEQYYSTQIDEMPMNIADII 399          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0079178)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 281/389 (72.24%), Postives = 326/389 (83.80%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+ + +V ++FDDMNL+E+LLRGIY YGFEKPSAIQQRA++P + G DVIAQAQSGTGKTATFS+AILQ+ID S  E QAL+LAPTRELA QI +V++ALG+YM   S+ACIGGT V+ED   LE+G HV+VGTPGRV DMI R  L+T  IK+FVLDEADEMLSRGFK+QI  V + +  D Q++LLSATMPPDVLEV+R FMR+PV ILVKKEELTLEGI+QFYVNV  E +K  TL DLY+TL+ITQ+VIFCNTRRKVD LT  +    F VS+MHGDM+Q  R+ IMK+FRSGSSR+LITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINF+T DD R L+D+E +Y T IEEMP NIADLI
Sbjct:   15 MEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0079175)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 281/389 (72.24%), Postives = 326/389 (83.80%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+ + +V ++FDDMNL+E+LLRGIY YGFEKPSAIQQRA++P + G DVIAQAQSGTGKTATFS+AILQ+ID S  E QAL+LAPTRELA QI +V++ALG+YM   S+ACIGGT V+ED   LE+G HV+VGTPGRV DMI R  L+T  IK+FVLDEADEMLSRGFK+QI  V + +  D Q++LLSATMPPDVLEV+R FMR+PV ILVKKEELTLEGI+QFYVNV  E +K  TL DLY+TL+ITQ+VIFCNTRRKVD LT  +    F VS+MHGDM+Q  R+ IMK+FRSGSSR+LITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINF+T DD R L+D+E +Y T IEEMP NIADLI
Sbjct:   15 MEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0079177)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 281/389 (72.24%), Postives = 326/389 (83.80%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+ + +V ++FDDMNL+E+LLRGIY YGFEKPSAIQQRA++P + G DVIAQAQSGTGKTATFS+AILQ+ID S  E QAL+LAPTRELA QI +V++ALG+YM   S+ACIGGT V+ED   LE+G HV+VGTPGRV DMI R  L+T  IK+FVLDEADEMLSRGFK+QI  V + +  D Q++LLSATMPPDVLEV+R FMR+PV ILVKKEELTLEGI+QFYVNV  E +K  TL DLY+TL+ITQ+VIFCNTRRKVD LT  +    F VS+MHGDM+Q  R+ IMK+FRSGSSR+LITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINF+T DD R L+D+E +Y T IEEMP NIADLI
Sbjct:   15 MEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0307068)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 281/389 (72.24%), Postives = 326/389 (83.80%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+ + +V ++FDDMNL+E+LLRGIY YGFEKPSAIQQRA++P + G DVIAQAQSGTGKTATFS+AILQ+ID S  E QAL+LAPTRELA QI +V++ALG+YM   S+ACIGGT V+ED   LE+G HV+VGTPGRV DMI R  L+T  IK+FVLDEADEMLSRGFK+QI  V + +  D Q++LLSATMPPDVLEV+R FMR+PV ILVKKEELTLEGI+QFYVNV  E +K  TL DLY+TL+ITQ+VIFCNTRRKVD LT  +    F VS+MHGDM+Q  R+ IMK+FRSGSSR+LITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINF+T DD R L+D+E +Y T IEEMP NIADLI
Sbjct:   15 MEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0079176)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 281/389 (72.24%), Postives = 326/389 (83.80%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+ + +V ++FDDMNL+E+LLRGIY YGFEKPSAIQQRA++P + G DVIAQAQSGTGKTATFS+AILQ+ID S  E QAL+LAPTRELA QI +V++ALG+YM   S+ACIGGT V+ED   LE+G HV+VGTPGRV DMI R  L+T  IK+FVLDEADEMLSRGFK+QI  V + +  D Q++LLSATMPPDVLEV+R FMR+PV ILVKKEELTLEGI+QFYVNV  E +K  TL DLY+TL+ITQ+VIFCNTRRKVD LT  +    F VS+MHGDM+Q  R+ IMK+FRSGSSR+LITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINF+T DD R L+D+E +Y T IEEMP NIADLI
Sbjct:   15 MEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Zebrafish
Match: eif4a1a (eukaryotic translation initiation factor 4A1A [Source:ZFIN;Acc:ZDB-GENE-031030-2])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 283/390 (72.56%), Postives = 336/390 (86.15%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGV-HVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N++++ +SFDDMNL+E LLRGIYAYGFEKPSAIQQRA+LP I+G+DVIAQAQSGTGKTATF+++ILQ+IDV     QA+VLAPTRELA+QI KV++ALGDYMGA  +ACIGGT V+ DV  L+  V H++VGTPGRV DM+ R  L    IKMF LDEADEMLSRGFK+QI+ + Q +  DTQ++LLSATMP +VLEVT KFMR+PV+ILVKKEELTLEGIRQFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM+Q  RD IMKEFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAIN +T+DD RTL+D+E++Y+T +EEMPMN+ADLI
Sbjct:   17 MEPDGVIESNWKEIVDSFDDMNLREALLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDVELKATQAMVLAPTRELAQQIQKVVLALGDYMGATCHACIGGTNVRNDVQKLQADVPHIVVGTPGRVFDMLNRRYLSPKYIKMFALDEADEMLSRGFKDQIYEIFQKLATDTQVILLSATMPQEVLEVTTKFMRDPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMEQKERDVIMKEFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMITEDDKRTLRDIETFYNTTVEEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Zebrafish
Match: eif4a1b (eukaryotic translation initiation factor 4A1B [Source:ZFIN;Acc:ZDB-GENE-040120-6])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 281/390 (72.05%), Postives = 333/390 (85.38%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLE-NGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N++++ +SFDDMNL+E LLRGIYAYGFEKPSAIQQRA+LP I+G+DVIAQAQSGTGKTATF+++ILQ+ID+     QALVLAPTRELA+QI KVI+ALGDYMGA  +ACIGGT V+ +V  L+    H++VGTPGRV DM+ R  L +  IKMFVLDEADEMLSRGFK+QI+ + Q +    Q+VLLSATMP +VL+VT KFMR PV+ILVKKEELTLEGIRQFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAIN VT+DD RTL+D+E++Y+T +EEMPMN+ADLI
Sbjct:   17 MEPDGVIESNWDEIVDSFDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDIELKGTQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEVQKLQAEAPHIVVGTPGRVYDMLNRKFLSSKYIKMFVLDEADEMLSRGFKDQIYEIFQKLSTSIQVVLLSATMPAEVLDVTTKFMREPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKDRDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Zebrafish
Match: eif4a1b (eukaryotic translation initiation factor 4A1B [Source:ZFIN;Acc:ZDB-GENE-040120-6])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 281/390 (72.05%), Postives = 333/390 (85.38%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLE-NGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N++++ +SFDDMNL+E LLRGIYAYGFEKPSAIQQRA+LP I+G+DVIAQAQSGTGKTATF+++ILQ+ID+     QALVLAPTRELA+QI KVI+ALGDYMGA  +ACIGGT V+ +V  L+    H++VGTPGRV DM+ R  L +  IKMFVLDEADEMLSRGFK+QI+ + Q +    Q+VLLSATMP +VL+VT KFMR PV+ILVKKEELTLEGIRQFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAIN VT+DD RTL+D+E++Y+T +EEMPMN+ADLI
Sbjct:   18 MEPDGVIESNWDEIVDSFDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDIELKGTQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEVQKLQAEAPHIVVGTPGRVYDMLNRKFLSSKYIKMFVLDEADEMLSRGFKDQIYEIFQKLSTSIQVVLLSATMPAEVLDVTTKFMREPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKDRDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNVADLI 407          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Zebrafish
Match: eif4a2 (eukaryotic translation initiation factor 4A, isoform 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2802])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 279/390 (71.54%), Postives = 335/390 (85.90%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLE-NGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N+ ++T++FDDMNLKE LLRGIYAYGFEKPSAIQQRA++P I+G+DVIAQAQSGTGKTATF+++ILQ++++ + E QALVLAPTRELA+QI KVI+ALGDYMGA  +ACIGGT V+ ++  L+    H++VGTPGRV DM+ R  L    IKMFVLDEADEMLSRGFK+QI+ + Q +  + Q+VLLSATMP DVLEVT KFMR PV+ILVKKEELTLEGI+QFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAINFVT++D R L+D+E++Y+T +EEMPMN+ADLI
Sbjct:   22 MEPDGVIESNWNEITDNFDDMNLKETLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEQKETQALVLAPTRELAQQIQKVILALGDYMGASCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLSTNIQVVLLSATMPADVLEVTTKFMREPVRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 411          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Zebrafish
Match: eif4a1b (eukaryotic translation initiation factor 4A1B [Source:ZFIN;Acc:ZDB-GENE-040120-6])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 281/390 (72.05%), Postives = 333/390 (85.38%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLE-NGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N++++ +SFDDMNL+E LLRGIYAYGFEKPSAIQQRA+LP I+G+DVIAQAQSGTGKTATF+++ILQ+ID+     QALVLAPTRELA+QI KVI+ALGDYMGA  +ACIGGT V+ +V  L+    H++VGTPGRV DM+ R  L +  IKMFVLDEADEMLSRGFK+QI+ + Q +    Q+VLLSATMP +VL+VT KFMR PV+ILVKKEELTLEGIRQFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAIN VT+DD RTL+D+E++Y+T +EEMPMN+ADLI
Sbjct:   17 MEPDGVIESNWDEIVDSFDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDIELKGTQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEVQKLQAEAPHIVVGTPGRVYDMLNRKFLSSKYIKMFVLDEADEMLSRGFKDQIYEIFQKLSTSIQVVLLSATMPAEVLDVTTKFMREPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKDRDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Xenopus
Match: eif4a1 (eukaryotic translation initiation factor 4A1 [Source:NCBI gene;Acc:496556])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 279/390 (71.54%), Postives = 334/390 (85.64%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLEN-GVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N+ +V +SFDDM+L E LLRGIYAYGFEKPSAIQQRA++P I+G+DVIAQAQSGTGKTATF+++ILQ+I++     QALVLAPTRELA+QI KV++ALGDYMGA  +ACIGGT V+ +V  L++   H++VGTPGRV DM+ R  L    IKMFVLDEADEMLSRGFK+QI+ + Q +  + Q+VLLSATMP DVLEVT+KFMR+P++ILVKKEELTLEGIRQFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAIN VT+DD RTL+D+E++Y+T +EEMPMN+ADLI
Sbjct:   19 MEPDGVIESNWNEVVDSFDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQIELDMKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQSEAPHIVVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLSSNAQVVLLSATMPADVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 408          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Xenopus
Match: eif4a1 (eukaryotic translation initiation factor 4A1 [Source:NCBI gene;Acc:496556])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 279/390 (71.54%), Postives = 334/390 (85.64%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLEN-GVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N+ +V +SFDDM+L E LLRGIYAYGFEKPSAIQQRA++P I+G+DVIAQAQSGTGKTATF+++ILQ+I++     QALVLAPTRELA+QI KV++ALGDYMGA  +ACIGGT V+ +V  L++   H++VGTPGRV DM+ R  L    IKMFVLDEADEMLSRGFK+QI+ + Q +  + Q+VLLSATMP DVLEVT+KFMR+P++ILVKKEELTLEGIRQFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAIN VT+DD RTL+D+E++Y+T +EEMPMN+ADLI
Sbjct:   13 MEPDGVIESNWNEVVDSFDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQIELDMKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQSEAPHIVVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLSSNAQVVLLSATMPADVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 402          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Xenopus
Match: eif4a1 (eukaryotic translation initiation factor 4A1 [Source:NCBI gene;Acc:496556])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 279/390 (71.54%), Postives = 334/390 (85.64%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLEN-GVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N+ +V +SFDDM+L E LLRGIYAYGFEKPSAIQQRA++P I+G+DVIAQAQSGTGKTATF+++ILQ+I++     QALVLAPTRELA+QI KV++ALGDYMGA  +ACIGGT V+ +V  L++   H++VGTPGRV DM+ R  L    IKMFVLDEADEMLSRGFK+QI+ + Q +  + Q+VLLSATMP DVLEVT+KFMR+P++ILVKKEELTLEGIRQFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAIN VT+DD RTL+D+E++Y+T +EEMPMN+ADLI
Sbjct:   20 MEPDGVIESNWNEVVDSFDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQIELDMKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQSEAPHIVVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLSSNAQVVLLSATMPADVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 409          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Xenopus
Match: eif4a1 (eukaryotic translation initiation factor 4A1 [Source:NCBI gene;Acc:496556])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 279/390 (71.54%), Postives = 334/390 (85.64%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLEN-GVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N+ +V +SFDDM+L E LLRGIYAYGFEKPSAIQQRA++P I+G+DVIAQAQSGTGKTATF+++ILQ+I++     QALVLAPTRELA+QI KV++ALGDYMGA  +ACIGGT V+ +V  L++   H++VGTPGRV DM+ R  L    IKMFVLDEADEMLSRGFK+QI+ + Q +  + Q+VLLSATMP DVLEVT+KFMR+P++ILVKKEELTLEGIRQFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAIN VT+DD RTL+D+E++Y+T +EEMPMN+ADLI
Sbjct:   15 MEPDGVIESNWNEVVDSFDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQIELDMKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQSEAPHIVVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLSSNAQVVLLSATMPADVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 404          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Xenopus
Match: eif4a1 (eukaryotic translation initiation factor 4A1 [Source:NCBI gene;Acc:496556])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 279/390 (71.54%), Postives = 334/390 (85.64%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLEN-GVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N+ +V +SFDDM+L E LLRGIYAYGFEKPSAIQQRA++P I+G+DVIAQAQSGTGKTATF+++ILQ+I++     QALVLAPTRELA+QI KV++ALGDYMGA  +ACIGGT V+ +V  L++   H++VGTPGRV DM+ R  L    IKMFVLDEADEMLSRGFK+QI+ + Q +  + Q+VLLSATMP DVLEVT+KFMR+P++ILVKKEELTLEGIRQFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAIN VT+DD RTL+D+E++Y+T +EEMPMN+ADLI
Sbjct:   17 MEPDGVIESNWNEVVDSFDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQIELDMKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQSEAPHIVVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLSSNAQVVLLSATMPADVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Mouse
Match: Eif4a1 (eukaryotic translation initiation factor 4A1 [Source:MGI Symbol;Acc:MGI:95303])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 282/390 (72.31%), Postives = 334/390 (85.64%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLE-NGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N+ ++ +SFDDMNL E LLRGIYAYGFEKPSAIQQRA+LP I+G+DVIAQAQSGTGKTATF+++ILQ+I++     QALVLAPTRELA+QI KV++ALGDYMGA  +ACIGGT V+ +V  L+    H+IVGTPGRV DM+ R  L    IKMFVLDEADEMLSRGFK+QI+ + Q +  +TQ+VLLSATMP DVLEVT+KFMR+P++ILVKKEELTLEGIRQFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS+MHGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAIN VT++D RTL+D+E++Y+T IEEMP+N+ADLI
Sbjct:   17 MEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 406          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Mouse
Match: Eif4a2 (eukaryotic translation initiation factor 4A2 [Source:MGI Symbol;Acc:MGI:106906])

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 276/390 (70.77%), Postives = 334/390 (85.64%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLE-NGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            M+  G IE+N+ ++ ++FDDMNLKE LLRGIYAYGFEKPSAIQQRA++P I+G+DVIAQAQSGTGKTATF+++ILQ++++   E QALVLAPTRELA+QI KVI+ALGDYMGA  +ACIGGT V+ ++  L+    H++VGTPGRV DM+ R  L    IKMFVLDEADEMLSRGFK+QI+ + Q +    Q+VLLSATMP DVLEVT+KFMR+P++ILVKKEELTLEGI+QFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAINFVT++D R L+D+E++Y+T +EEMPMN+ADLI
Sbjct:   19 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 408          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Mouse
Match: Eif4a2 (eukaryotic translation initiation factor 4A2 [Source:MGI Symbol;Acc:MGI:106906])

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 276/390 (70.77%), Postives = 334/390 (85.64%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLE-NGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            M+  G IE+N+ ++ ++FDDMNLKE LLRGIYAYGFEKPSAIQQRA++P I+G+DVIAQAQSGTGKTATF+++ILQ++++   E QALVLAPTRELA+QI KVI+ALGDYMGA  +ACIGGT V+ ++  L+    H++VGTPGRV DM+ R  L    IKMFVLDEADEMLSRGFK+QI+ + Q +    Q+VLLSATMP DVLEVT+KFMR+P++ILVKKEELTLEGI+QFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAINFVT++D R L+D+E++Y+T +EEMPMN+ADLI
Sbjct:   18 MDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 407          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Mouse
Match: Eif4a3 (eukaryotic translation initiation factor 4A3 [Source:MGI Symbol;Acc:MGI:1923731])

HSP 1 Score: 518.85 bits (1335), Expect = 0.000e+0
Identity = 261/385 (67.79%), Postives = 319/385 (82.86%), Query Frame = 2
Query:   89 EIETNYE-KVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            E ET+ E  VT +FD M L+EDLLRGIYAYGFEKPSAIQQRA+   I+G DVIAQ+QSGTGKTATFSV++LQ +D+   E QAL+LAPTRELA QI K ++ALGDYM  + +ACIGGT V ED+  L+ G HV+ GTPGRV DMI R +L+T  IKM VLDEADEML++GFKEQI+ V +Y+   TQ+VL+SAT+P ++LE+T KFM +P++ILVK++ELTLEGI+QF+V V  EE+KF+TL DLY+TLTITQAVIFCNT+RKVD LT+ ++   F VSSMHGDM Q  R+ IMKEFRSG+SR+LI+TD+ ARG+DV QVSL+INYDLP+NRE YIHRIGR GR+GRKGVAINFV  DDIR L+D+E YYST I+EMPMN+ADLI
Sbjct:   27 EFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSVSVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 411          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Mouse
Match: Eif4a3l1 (eukaryotic translation initiation factor 4A3 like 1 [Source:MGI Symbol;Acc:MGI:3644226])

HSP 1 Score: 510.375 bits (1313), Expect = 1.535e-179
Identity = 257/385 (66.75%), Postives = 316/385 (82.08%), Query Frame = 2
Query:   89 EIETNYE-KVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            E ET+ E   T +FD M L+EDLLRGIYAYGFEKPSAIQQRA+   ++G DVIAQ+QSGTGKTATFS+++LQ +D+   E QAL+LAPTRELA QI K ++ALGDYM  + +AC+GGT V ED+  L+ G HV+ GTPGRV DMI R +L T  IKM VLDEADEML+RGFKEQI+ V +Y+   TQ+VL+SAT+P ++LE+T KFM +P++ILVK++ELTLEGI+QF+V V  EE+KF+TL DLY+TLTITQAVIFC T+RKVD LT+ ++   F VSSMHGDM Q  R+ IMKEFRSG+SR+LI+TD+ ARG+DV QVSL+INYDLP+NRE YIHRIGR GR+GRKGVAINFV  DDIR L+D+E YYST I+EMPMN+ADLI
Sbjct:   27 EFETSEEVDATPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIMKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACVGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLTTRAIKMLVLDEADEMLNRGFKEQIYDVYRYLPPATQVVLVSATLPHEILEMTNKFMTHPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCITKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNLADLI 411          
BLAST of Eukaryotic initiation factor 4A vs. UniProt/SwissProt
Match: sp|Q4P331|IF4A_USTMA (ATP-dependent RNA helicase eIF4A OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=TIF1 PE=3 SV=1)

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 282/385 (73.25%), Postives = 333/385 (86.49%), Query Frame = 2
Query:   86 GEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            GEIE+N+E V ++FD+M LKE+LLRG+YAYGFE+PSAIQ RA++P I+GHDVIAQAQSGTGKTATFS+AILQRID S   VQAL+LAPTRELA+QI KV+IALGDYM    +ACIGGT V+ED+  L  G  V+VGTPGRV DMI R   KT+ +KMF LDEADEMLSRGFK+Q++ V Q +  DTQ VLLSATMP +VLEVT+KFMR+P++ILVK++ELTLEGI+QFYV V  E++K +TL DLYET+TITQAVIFCNTRRKVD LTD L  ++F VS+MHGDM+Q  R+ IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVT DD+R L+D+E +YST I+EMP+N+ADLI
Sbjct:   27 GEIESNWETVIDNFDNMELKEELLRGVYAYGFERPSAIQARAIVPVIKGHDVIAQAQSGTGKTATFSIAILQRIDPSIKAVQALILAPTRELAQQIQKVVIALGDYMKIDCHACIGGTNVREDMAKLNEGAQVVVGTPGRVYDMINRRAFKTDQLKMFCLDEADEMLSRGFKDQMYEVFQLLPQDTQCVLLSATMPQEVLEVTKKFMRDPIRILVKRDELTLEGIKQFYVAVEKEDWKLDTLCDLYETVTITQAVIFCNTRRKVDWLTDKLTSREFTVSAMHGDMEQAQREVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVTSDDVRMLRDIEQFYSTQIDEMPLNVADLI 411          
BLAST of Eukaryotic initiation factor 4A vs. UniProt/SwissProt
Match: sp|Q2HFP1|IF4A_CHAGB (ATP-dependent RNA helicase eIF4A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=TIF1 PE=3 SV=1)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 280/385 (72.73%), Postives = 337/385 (87.53%), Query Frame = 2
Query:   86 GEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            G+IE+NY++  +SFDDMNLK +LLRGIYAYGFE+PSAIQQRA++P I+GHDVIAQAQSGTGKTATFS+++LQ+ID +    QAL+LAPTRELA+QI KV+IA+GD+M  + +ACIGGT V++D+  L++G  VIVGTPGRV+DMI+R  LKT+ +KMFVLDEADEMLSRGF EQI+ + Q +   TQ+VLLSATMP DVLEVT KFMR+PV+ILVKK+ELTLEGI+QFY+ V  E++K +TL+DLYET+TITQAVIFCNTRRKVD LTD L+ + F VS+MHGDM Q  RD IMKEFRSGSSR+LI TDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAINFVT DD+R ++++E +YST IEEMPMN+ADLI
Sbjct:   13 GQIESNYDETVDSFDDMNLKSELLRGIYAYGFERPSAIQQRAIMPVIKGHDVIAQAQSGTGKTATFSISVLQKIDPTVKSCQALILAPTRELAQQIQKVVIAIGDFMNIECHACIGGTSVRDDMKALQDGPQVIVGTPGRVHDMIQRRILKTDQMKMFVLDEADEMLSRGFTEQIYDIFQLLPQSTQVVLLSATMPQDVLEVTTKFMRDPVRILVKKDELTLEGIKQFYIAVEKEDWKLDTLSDLYETVTITQAVIFCNTRRKVDWLTDKLQARDFTVSAMHGDMDQTQRDLIMKEFRSGSSRVLIATDLLARGIDVQQVSLVINYDLPANRENYIHRIGRGGRFGRKGVAINFVTADDVRMMREIEQFYSTQIEEMPMNVADLI 397          
BLAST of Eukaryotic initiation factor 4A vs. UniProt/SwissProt
Match: sp|A4QVP2|IF4A_MAGO7 (ATP-dependent RNA helicase eIF4A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=TIF1 PE=3 SV=1)

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 278/385 (72.21%), Postives = 337/385 (87.53%), Query Frame = 2
Query:   86 GEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            G+IE+NY++  +SFD+MNLK +LLRGIYAYGFE+PSAIQQRA++P I+GHDVIAQAQSGTGKTATFS+++LQ+ID +  + QAL+LAPTRELA+QI KV++A+GD+M  + +ACIGGT V++D+  L++G  V+VGTPGRV+DMI+R  LKT+ +KMFVLDEADEMLSRGF EQI+ + Q +   TQ+VLLSATMP DVLEVT KFMR+PV+ILVKK+ELTLEGI+QFY+ V  EE+K +TL+DLYET+TITQAVIFCNTRRKVD LTD L  + F VS+MHGDM Q  RD IMKEFRSGSSR+LI TDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAINFVT DD+R ++++E +YST IEEMPMN+ADLI
Sbjct:   12 GQIESNYDETVDSFDEMNLKSELLRGIYAYGFERPSAIQQRAIMPVIKGHDVIAQAQSGTGKTATFSISVLQKIDTNVKQCQALILAPTRELAQQIQKVVVAIGDFMNIECHACIGGTSVRDDMKALQDGPQVVVGTPGRVHDMIQRRFLKTDGMKMFVLDEADEMLSRGFTEQIYDIFQLLPQSTQVVLLSATMPQDVLEVTTKFMRDPVRILVKKDELTLEGIKQFYIAVEKEEWKLDTLSDLYETVTITQAVIFCNTRRKVDWLTDKLTARDFTVSAMHGDMDQAQRDLIMKEFRSGSSRVLIATDLLARGIDVQQVSLVINYDLPANRENYIHRIGRGGRFGRKGVAINFVTADDVRMMREIEQFYSTQIEEMPMNVADLI 396          
BLAST of Eukaryotic initiation factor 4A vs. UniProt/SwissProt
Match: sp|Q7RV88|IF4A_NEUCR (ATP-dependent RNA helicase eIF4A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=tif-1 PE=3 SV=2)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 279/385 (72.47%), Postives = 336/385 (87.27%), Query Frame = 2
Query:   86 GEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            G+IE+NY++  +SFD+MNLK +LLRGIYAYGFE+PSAIQQRA++P I+GHDVIAQAQSGTGKTATFS+++LQ+ID S    QAL+LAPTRELA+QI KV++A+GD+M  + +ACIGGT V++D+  L++G  V+VGTPGRV+DMI+R  LKT+++KMFVLDEADEMLSRGF EQI+ + Q +   TQ+VLLSATMP DVLEVT KFMR PV+ILVKK+ELTLEGI+QFY+ V  EE+K +TL+DLYET+TITQAVIFCNTRRKVD LTD L  + F VS+MHGDM Q  RD IMKEFRSGSSR+LI TDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAINFVT DD+R ++++E +YST IEEMPMN+ADLI
Sbjct:   13 GQIESNYDETVDSFDEMNLKPELLRGIYAYGFERPSAIQQRAIMPVIKGHDVIAQAQSGTGKTATFSISVLQKIDPSLKACQALILAPTRELAQQIQKVVVAIGDFMNIECHACIGGTSVRDDMKALQDGPQVVVGTPGRVHDMIQRRFLKTDSMKMFVLDEADEMLSRGFTEQIYDIFQLLPQSTQVVLLSATMPQDVLEVTTKFMREPVRILVKKDELTLEGIKQFYIAVEKEEWKLDTLSDLYETVTITQAVIFCNTRRKVDWLTDKLTARDFTVSAMHGDMDQAQRDLIMKEFRSGSSRVLIATDLLARGIDVQQVSLVINYDLPANRENYIHRIGRGGRFGRKGVAINFVTADDVRMMREIEQFYSTQIEEMPMNVADLI 397          
BLAST of Eukaryotic initiation factor 4A vs. UniProt/SwissProt
Match: sp|Q0UU86|IF4A_PHANO (ATP-dependent RNA helicase eIF4A OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) OX=321614 GN=TIF1 PE=3 SV=1)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 277/385 (71.95%), Postives = 335/385 (87.01%), Query Frame = 2
Query:   86 GEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            G+IE+NY++ T+SFD MNLK +LLRG+YAYGFE+PSAIQQRA++P I+GHDVIAQAQSGTGKTATFS++ LQ+ID +    QAL+LAPTRELA+QI KV++A+GD+M    +ACIGGT V++D+  L++G  V+VGTPGRV+DMI+R  LKT+++KMFVLDEADEMLSRGF EQI+ + Q +   TQ+VLLSATMP DVLEVT KFMR+PV+ILVKK+ELTLEGI+QFY+ V  E++K +TL+DLYET+TITQAVIFCNTRRKVD LTD L  + F VS+MHGDM Q  RD IMKEFRSGSSR+LI TDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAINFVT DD+R ++++E +YST IEEMPMN+ADLI
Sbjct:   12 GQIESNYDETTDSFDAMNLKAELLRGVYAYGFERPSAIQQRAIMPVIKGHDVIAQAQSGTGKTATFSISTLQKIDSNVKACQALILAPTRELAQQIQKVVVAIGDFMDVACHACIGGTSVRDDMKALQDGPQVVVGTPGRVHDMIQRRVLKTDHMKMFVLDEADEMLSRGFTEQIYDIFQLLPQSTQVVLLSATMPQDVLEVTTKFMRDPVRILVKKDELTLEGIKQFYIAVEKEDWKLDTLSDLYETVTITQAVIFCNTRRKVDWLTDKLTARDFTVSAMHGDMDQAQRDVIMKEFRSGSSRVLIATDLLARGIDVQQVSLVINYDLPANRENYIHRIGRGGRFGRKGVAINFVTADDVRMMREIEQFYSTQIEEMPMNVADLI 396          
BLAST of Eukaryotic initiation factor 4A vs. TrEMBL
Match: A4V6N0 (eIF4A isoform 1A protein OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 377/389 (96.92%), Postives = 384/389 (98.71%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            MENPGEIETNYEK+TESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDV+KNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTN+IKMFVLDEADEMLSRGFKEQIHSVIQ+IEHDTQIVLLSATMPPDVLEVTRKFMR+PVKILVKKEELTLEGIRQFYVNV  E+YKFETLTDLYETLTITQAVIFCNTRRKVD LT+SLK K FIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI
Sbjct:    1 MENPGEIETNYEKITESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVTKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNSIKMFVLDEADEMLSRGFKEQIHSVIQFIEHDTQIVLLSATMPPDVLEVTRKFMRSPVKILVKKEELTLEGIRQFYVNVSEEDYKFETLTDLYETLTITQAVIFCNTRRKVDYLTESLKAKPFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 389          
BLAST of Eukaryotic initiation factor 4A vs. TrEMBL
Match: A0A1Y1K7F5 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_10678 PE=3 SV=1)

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 294/388 (75.77%), Postives = 346/388 (89.18%), Query Frame = 2
Query:   80 NP-GEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            NP G IE+N+E+V ++FDDMNLKE+LLRGIYAYGFEKPSAIQQRA++P ++GHDVIAQAQSGTGKTATFS++ILQ+ID S  E QAL+LAPTRELA+QI KV+IALGD+M A+ +ACIGGT V+ED+  LE G+HV+VGTPGRV DMI R  L+TNNIKMFVLDEADEMLSRGFK+QIH V + +  D Q++LLSATMP DVL+VT+ FMRNPV+ILVKKEELTLEGI+QF+V V  E++K ETL DLY+TL+ITQAVIFCNTRRKVD LT+S+  + F VS+MHGDM+Q  RD IMK+FRSGSSR+LITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVT+DD RTL+D+E +Y+THI+EMPMN+ADLI
Sbjct:   34 NPDGVIESNWEEVVDNFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCVKGHDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDFMSAQCHACIGGTNVREDMRKLETGMHVVVGTPGRVYDMISRRALRTNNIKMFVLDEADEMLSRGFKDQIHDVFRMLNTDVQVILLSATMPSDVLDVTKSFMRNPVQILVKKEELTLEGIKQFFVYVEREDWKLETLCDLYDTLSITQAVIFCNTRRKVDMLTESMHKRDFTVSAMHGDMEQRERDVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVTEDDKRTLKDIEHFYNTHIDEMPMNVADLI 421          
BLAST of Eukaryotic initiation factor 4A vs. TrEMBL
Match: K4QDH4 (Eukaryotic initiation factor 4A OS=Phaedon cochleariae OX=80249 GN=eif4a PE=2 SV=1)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 291/389 (74.81%), Postives = 346/389 (88.95%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N+E+VT++FDDMNLKE+LLRGIYAYGFEKPSAIQQRA++P ++GHDVIAQAQSGTGKTATFS++ILQ+ID S  E QAL+LAPTRELA+QI KV+IALGD+M A+ +ACIGGT V+ED+  LE G+HV+VGTPGRV DMI R  L+T+NIKMFVLDEADEMLSRGFK+QIH V + +  D Q++LLSATMP DVL+VT+ FMRNPV+ILVKKEELTLEGI+QF+V V  E++K ETL DLY+TL+ITQAVIFCNTRRKVD LT+S+  + F VS+MHGDM+Q  RD IM++FR+GSSR+LITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVT+DD RTL+D+E +Y+T I+EMPMN+ADLI
Sbjct:   32 MEPDGIIESNWEEVTDNFDDMNLKEELLRGIYAYGFEKPSAIQQRAIIPCVKGHDVIAQAQSGTGKTATFSISILQQIDTSVRECQALILAPTRELAQQIQKVVIALGDFMSAQCHACIGGTNVREDMRKLETGMHVVVGTPGRVYDMITRRALRTSNIKMFVLDEADEMLSRGFKDQIHDVFKMLSSDVQVILLSATMPTDVLDVTKSFMRNPVRILVKKEELTLEGIKQFFVYVEREDWKLETLCDLYDTLSITQAVIFCNTRRKVDWLTESMHKRDFTVSAMHGDMEQRERDVIMRQFRTGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVTEDDKRTLKDIEQFYNTKIDEMPMNVADLI 420          
BLAST of Eukaryotic initiation factor 4A vs. TrEMBL
Match: A0A411G851 (Eukaryotic initiation factor 4A-II (Fragment) OS=Cotesia chilonis OX=89804 PE=2 SV=1)

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 292/389 (75.06%), Postives = 345/389 (88.69%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N+E+V E+FDDMNLKE+LLRGIYAYGFEKPSAIQQRA++P I+GHDVIAQAQSGTGKTATFS++ILQ ID S  E QAL+LAPTRELA+QI KV+IALGD+M A+ +ACIGGT V+ED+  LE GVHV+VGTPGRV DMI R  L+TN+IK+FVLDEADEMLSRGFK+QI+ V + +  D Q++LLSATMP DVLEVT  FMRNP++ILVKKEELTLEGI+QF++NV  E++K +TL DLY+TL+ITQAVIFCNTRRKVD LT+S+  + F VS+MHGDM+Q  RD IM++FR+GSSR+LITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVTQDD RTL+D+E +Y+THI+EMPMN+ADLI
Sbjct:   37 MEPDGVIESNWEQVVENFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIKGHDVIAQAQSGTGKTATFSISILQLIDTSLRECQALILAPTRELAQQIQKVVIALGDFMNAQCHACIGGTNVREDMKKLEMGVHVVVGTPGRVMDMINRRALRTNSIKLFVLDEADEMLSRGFKDQIYDVFKTLNPDIQVILLSATMPADVLEVTGYFMRNPIQILVKKEELTLEGIKQFFINVEREDWKLDTLCDLYDTLSITQAVIFCNTRRKVDALTESMHKRDFTVSAMHGDMEQRERDVIMRQFRTGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVTQDDRRTLEDIEKFYNTHIDEMPMNVADLI 425          
BLAST of Eukaryotic initiation factor 4A vs. TrEMBL
Match: A0A1V9XU99 (Eukaryotic initiation factor 4A-II-like OS=Tropilaelaps mercedesae OX=418985 GN=BIW11_07404 PE=3 SV=1)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 288/389 (74.04%), Postives = 345/389 (88.69%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            M+  G IE+NY+KV +SFDDM L+E+LLRGIYAYGFE+PSAIQQRA+LP IEG+DVIAQAQSGTGKTATFS++ILQ+I++   + QAL+LAPTRELA+QI KV+IALGDYM AK +ACIGGT V++D+ NLE G+HV+VGTPGRV DMI+R  L+T++I+MFVLDEADEMLSRGFKEQIH V + +   TQ++LLSATMP DVL+VT+ FMR+P++ILVKKEELTLEGI+QFYVNV  EE+KF+TL DLYETLTITQAVIFCNTRRKVD LTD +  K F VS++HGDM Q  R+ IM+ FRSGSSR+LITTDLLARGIDVQQVSLVIN+DLP+NRENYIHRIGRGGRFGRKGVAINFVT +D RTL+D+ES+Y+T +EEMP+N+ADLI
Sbjct:   32 MDPEGIIESNYDKVVDSFDDMKLREELLRGIYAYGFERPSAIQQRAILPCIEGNDVIAQAQSGTGKTATFSISILQQIEIENPQCQALILAPTRELAQQIQKVVIALGDYMSAKCHACIGGTNVKDDIRNLEKGMHVVVGTPGRVYDMIQRRALRTDSIRMFVLDEADEMLSRGFKEQIHDVFKTLSETTQVILLSATMPADVLDVTKCFMRDPIRILVKKEELTLEGIKQFYVNVDKEEWKFDTLCDLYETLTITQAVIFCNTRRKVDWLTDQMTKKDFTVSALHGDMSQHEREMIMRAFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTNRENYIHRIGRGGRFGRKGVAINFVTDEDKRTLKDIESFYNTAVEEMPVNVADLI 420          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Cavefish
Match: eif4a1a (eukaryotic initiation factor 4A-I [Source:NCBI gene;Acc:103045638])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 280/390 (71.79%), Postives = 334/390 (85.64%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGV-HVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE N+++V +SFDDMNL+E+LLRGIYAYGFEKPSAIQQRA+LP I+G+DVIAQAQSGTGKTATF+++ILQ+ID+     QA+VLAPTRELA+QI KV++ALGDYMGA  +ACIGGT V+ +V  L+  V H++VGTPGRV DM+ R  L   +IK F LDEADEMLSRGFK+QI+ + Q +  D Q++LLSATMP +VL+VT KFMR+PV+ILVKKEELTLEGIRQFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IMKEFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAIN VT+DD RTL+D+E++Y+T +EEMPMN+ADLI
Sbjct:   17 MEPDGVIEGNWKEVVDSFDDMNLRENLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIDIEMKATQAMVLAPTRELAQQIQKVVLALGDYMGATCHACIGGTNVRNEVQKLQADVPHIVVGTPGRVFDMLNRRYLSPRHIKQFALDEADEMLSRGFKDQIYEIFQKLSSDIQVILLSATMPQEVLDVTSKFMRDPVRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDLIMKEFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Cavefish
Match: eif4a2 (eukaryotic translation initiation factor 4A2 [Source:NCBI gene;Acc:103033197])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 277/390 (71.03%), Postives = 335/390 (85.90%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLE-NGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N+ ++T++FDDMNLKE LLRGIYAYGFEKPSAIQQRA++P I+G+DVIAQAQSGTGKTATF+++ILQ++++ + E QALVLAPTRELA+QI KVI+ALGDYMGA  +ACIGGT V+ ++  L+    H++VGTPGRV DM+ R  L    IKMFVLDEADEMLSRGFK+QI+ + Q +  + Q+VLLSATMP +VL+VT KFMR PV+ILVKKEELTLEGI+QFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAINFVT++D R L+D+E++Y+T +EEMPMN+ADLI
Sbjct:   22 MEPDGIIESNWNEITDNFDDMNLKETLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEQKETQALVLAPTRELAQQIQKVILALGDYMGASCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRFLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLSTNIQVVLLSATMPAEVLDVTTKFMREPVRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 411          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Cavefish
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:103037591])

HSP 1 Score: 520.005 bits (1338), Expect = 0.000e+0
Identity = 261/385 (67.79%), Postives = 319/385 (82.86%), Query Frame = 2
Query:   89 EIETNYE-KVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            E ET+ E  VT +FD M L+EDLLRGIYAYGFEKPSAIQQRA+   I+G DVIAQ+QSGTGKTATF V++LQ +D+   E QAL+LAPTRELA QI KV++ALGDYM  + +ACIGGT V ED+  L+ G HV+ GTPGRV DMI R +L+T  IKM VLDEADEML++GFKEQI+ V +Y+   TQ+VL+SAT+P ++LE+T KFM +P++ILVK++ELTLEGI+QF+V V  EE+KF+TL DLY+TLTITQAVIFCNT+RKVD LT+ ++   F VSSMHGDM Q  R+ IMKEFRSG+SR+LI+TD+ ARG+DV QVSL+INYDLP+NRE YIHRIGR GR+GRKGVAINFV  DDIR L+D+E YYST I+EMPMN+ADLI
Sbjct:   22 EFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Cavefish
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:103037591])

HSP 1 Score: 504.982 bits (1299), Expect = 7.017e-178
Identity = 251/366 (68.58%), Postives = 307/366 (83.88%), Query Frame = 2
Query:  143 KEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            +EDLLRGIYAYGFEKPSAIQQRA+   I+G DVIAQ+QSGTGKTATF V++LQ +D+   E QAL+LAPTRELA QI KV++ALGDYM  + +ACIGGT V ED+  L+ G HV+ GTPGRV DMI R +L+T  IKM VLDEADEML++GFKEQI+ V +Y+   TQ+VL+SAT+P ++LE+T KFM +P++ILVK++ELTLEGI+QF+V V  EE+KF+TL DLY+TLTITQAVIFCNT+RKVD LT+ ++   F VSSMHGDM Q  R+ IMKEFRSG+SR+LI+TD+ ARG+DV QVSL+INYDLP+NRE YIHRIGR GR+GRKGVAINFV  DDIR L+D+E YYST I+EMPMN+ADLI
Sbjct:   27 EEDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 392          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Cavefish
Match: eif4a1b (eukaryotic translation initiation factor 4A1B [Source:ZFIN;Acc:ZDB-GENE-040120-6])

HSP 1 Score: 503.442 bits (1295), Expect = 2.123e-177
Identity = 261/390 (66.92%), Postives = 311/390 (79.74%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLE-NGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N+ ++ ++FDDMNL+E LLRGIYAYGFEKPSAIQQRA+LP I+G+DVIAQAQSGTGKTATF+++ILQ++D      QALVLAPTRELA+Q+                           V  L+    H++VGTPGRV DM+ R  L + +IKMFVLDEADEMLSRGFK+QI+ + Q +   TQ+VLLSATMP +VLEVT KFMR PV+ILVKK+ELTLEGIRQFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAIN VT+DD RTL+D+E++Y+T +EEMPMN+ADLI
Sbjct:   19 MEPDGIIESNWHEIVDTFDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQLDPELRATQALVLAPTRELAQQVS--------------------------VAKLQAEAPHIVVGTPGRVFDMLSRKFLSSKSIKMFVLDEADEMLSRGFKDQIYEIFQKLPSSTQVVLLSATMPVEVLEVTTKFMREPVRILVKKDELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKDRDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNVADLI 382          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Sea Lamprey
Match: ddx6 (DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN;Acc:ZDB-GENE-070912-83])

HSP 1 Score: 279.256 bits (713), Expect = 5.757e-89
Identity = 151/369 (40.92%), Postives = 236/369 (63.96%), Query Frame = 2
Query:  125 FDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGA-KSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNI 1228
            F+D  LK +LL GI+  G+EKPS IQ+ ++  A+ G D++A+A++GTGK+  + + +L+R+D+ K  +QAL + PTRELA Q  ++ I L  +MG  K  A  GGT +++D+  L+  VHVI+ TPGR+ D+I +G  K + ++M VLDEAD++LS+ F + +  +I+ +  + QI+L SAT P  V +   + ++ P +I +  EELTL+GI QFY  V  E  K   L  L+  L I Q++IFCN+ ++V+ L   +    +    +H  M+Q+ R+++  +FR G  R L+ +DL  RGID+Q V++VIN+D P N E Y+HRIGR GR+G  G+AIN +T +D   L+ +E    T I+ +P  I
Sbjct:  101 FEDYCLKRELLMGIFEKGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDMKKPYIQALTIVPTRELALQTSQICIELSKHMGGVKVMATTGGTNLRDDILRLDETVHVIIATPGRILDLINKGLAKVDAVQMIVLDEADKLLSQDFVQMLDDIIRAMPRNRQILLYSATFPLSVQKFMNRHLQKPYEINLM-EELTLKGITQFYAYVN-ERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMKQEHRNRVFHDFRRGECRNLVCSDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRYGHLGLAINLITYEDRFNLKGIEEQLGTEIKPIPGTI 467          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000216.1 (pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-1 gene:ENSPMAG00000000186.1 transcript:ENSPMAT00000000216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 1.251e-60
Identity = 126/363 (34.71%), Postives = 201/363 (55.37%), Query Frame = 2
Query:  146 EDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNI---KMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMN 1225
            E L       G+++P+ IQ  A+  A++G D+I  A++G+GKT  F++ ILQ +  +   + ALVL PTRELA QI +   ALG  +G KS   +GG  +      L    HVI+ TPGR+ D +E  N K  NI   K  V+DEAD +L+  F+ ++  +++ I  + +  L SATM   V ++ R  ++ PVK  V  +  T+E ++Q+YV +   ++K   L  +   L     +IFC+T      +   L+   F    +HG M Q+ R   + +F+  +  IL+ TD+ +RG+D+  V +VIN+D+P++ ++YIHR+GR  R GR G +I FV+Q D+   Q +E      +   P N
Sbjct:    4 EVLCEACEQLGWKQPTKIQVEAIPVALQGKDIIGLAETGSGKTGAFALPILQALLDAPQRLFALVLTPTRELAFQISEQFEALGSSIGIKSAVVVGGIDMMSQSLALAKKPHVIIATPGRLVDHLE--NTKGFNIRALKYLVMDEADRILNMDFETEVDKILKVIPKERKTYLFSATMTKKVQKLQRAALKEPVKCSVSTKYQTVEKLQQYYVFIPA-KFKDSYLVYILNELAGNSFIIFCSTCNNTQRIALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKGKARSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVSQYDVELFQRIEHLIGKKLPAFPTN 363          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Sea Lamprey
Match: ddx39aa (DEAD (Asp-Glu-Ala-Asp) box polypeptide 39Aa [Source:ZFIN;Acc:ZDB-GENE-030131-4275])

HSP 1 Score: 196.823 bits (499), Expect = 4.377e-58
Identity = 139/390 (35.64%), Postives = 215/390 (55.13%), Query Frame = 2
Query:   89 EIETNYEKVTES-FDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYAC-IGGTRVQEDVGNL-ENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQI---HSVIQYIEHDTQIVLLSATMP--PDVLEVTRKFMRNPVKILVKKE-ELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVT-QDDIRTLQDLESYYSTHIEEMPMNI 1228
            E++ +Y  +  S F D  LK +LLR I   GFE PS +Q   +  AI G DV+ QA+SG GKTA F +A LQ+++ +  +V  LV+  TRELA QI K       YM     A   GG  +++D   L +N  H++VGTPGR+  +     L   ++K F+LDE D+ML     EQ+     V Q +      +LL A       VL  +      P+++ V  E +LTL G++Q+YV +   E K   L DL + L   Q VIF  + ++   L   L  + F   ++H  M Q+ R    ++F+    RIL+ T+L  RG+D+++V++V NYD+P + + Y+HR+ R GRFG KG+A+ FV+ ++D + L D++  +  ++ E+P  I
Sbjct:   33 EVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPTDGQVSVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRLA-LSRNKTLNLKHVKHFILDECDKML-----EQLVTASEVEQLLHISPHQLLLDACFADLTVVLCCSSWQCYPPMEVFVDDETKLTLHGLQQYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCMALAQLLIEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAVTFVSDENDAKILNDVQDRFEVNVSELPDEI 415          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Sea Lamprey
Match: ddx59 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 59 [Source:ZFIN;Acc:ZDB-GENE-050208-665])

HSP 1 Score: 192.586 bits (488), Expect = 1.497e-55
Identity = 128/386 (33.16%), Postives = 216/386 (55.96%), Query Frame = 2
Query:  125 FDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRI-DVSKNEVQ---ALVLAPTRELAKQIH---KVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEG-------IRQFYVNVGGEEYK---FETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFI-VSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNI 1228
            F    + E L + + A G+ +P+ +Q + + PA+ G DVI +A++G+GKTA F V I+  +     +EV+   A+V+ PTRELA QI    K ++A   +M  ++   IGG  +   +  L   V +++GTPGRV +++ R  L+ N++++FV+DE D ML  GF+EQ+ +V +    + Q +L+SAT+P   +E+  +  R+PV+I V  E   + G       +RQ  + V     K   FE L D  E L     V+F +++   D L D+++    +  ++MH D  Q  R  +++   +G   ++++T +L RG+D+  V LV+N+DLPS  + Y+H++GR GR GR+G AI+ +   D R   DL S       ++P  +
Sbjct:  140 FSHCPMPEALAQNLAACGYHEPTPVQMQMLPPALGGRDVIVRAETGSGKTAGFLVPIVALLAGCGPSEVRDPLAVVVTPTRELAMQIERQAKELMAGLPHM--RTALLIGGLPLPPQLHRLRQRVQLVIGTPGRVLEVLRRDALRLNSVRIFVIDEVDTMLKLGFREQVLAVREETPEERQSLLVSATLPTATVELAERLTRDPVRIAVAGEGSEVGGQAAPASNVRQIVLWVEEPSKKKKLFEILKD--EKLYHPPVVVFVDSKMGADLLADAVETVMGLKAAAMHADKPQTERTSVLQGLLAGEYEVVVSTGVLGRGLDLVNVRLVVNFDLPSTMDEYVHQVGRSGRLGRRGTAISLLNNRDRRLFLDLASRVEATGTQLPAQL 521          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003898.1 (pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 gene:ENSPMAG00000003524.1 transcript:ENSPMAT00000003898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.644 bits (457), Expect = 5.728e-51
Identity = 115/352 (32.67%), Postives = 187/352 (53.12%), Query Frame = 2
Query:  119 ESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEG-HDVIAQAQSGTGKTATFSVAILQRI---------DVSKNEVQ------------ALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQY----IEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIH 1096
            ESF ++ L E ++  +    +E+P+ +Q+ A+ P I+   D++A AQ+G+GKTA F + IL +I         + +KN+ +            +LVLAPTRELA QI+            +     GG  +   V  L+ G H++V TPGR+ DM+ERG +  ++ +  VLDEAD ML  GF+ QI  +++      + D Q ++ SAT P ++  + R F+ + + + V +     E I Q  V V   + +   L  L  T   +  ++F  T++  D L   L  + +  +S+HGD  Q  R++ +  FR+G   IL+ T + ARG+D+  V  VIN+DLPS+ E Y+H
Sbjct:   59 ESFHELELGEIIMSSVTLCRYERPTPVQKYAI-PIIKAKRDLMACAQTGSGKTAAFLLPILSQIYSGGPGKVVEDTKNQQETVKYGQRKQYPMSLVLAPTRELALQIYDEARKFAYRSCVRPCVVYGGADIGNQVRELQKGCHLLVATPGRLVDMMERGKVGLDHCRYLVLDEADRMLDMGFEPQIRRIVEQDVMPTKGDRQTLMFSATFPKEIQILARDFLEDYIFLAVGRVGSASENITQKVVWVEEMDKRSFLLDLLNATGRDSLTLVFVETKKGADALQGFLCSEGYSCTSIHGDRSQRDREEALSLFRTGRRPILVATAVAARGLDIPNVKHVINFDLPSDIEEYVH 409          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Yeast
Match: TIF1 (Translation initiation factor eIF4A; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G; protein abundance increases in response to DNA replication stress; TIF1 has a paralog, TIF2, that arose from the whole genome duplication [Source:SGD;Acc:S000001767])

HSP 1 Score: 514.227 bits (1323), Expect = 0.000e+0
Identity = 261/385 (67.79%), Postives = 316/385 (82.08%), Query Frame = 2
Query:   86 GEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
             +I+TNY+KV   FDDM L E+LLRG++ YGFE+PSAIQQRA++P IEGHDV+AQAQSGTGKT TFS+A LQRID S    QAL+LAPTRELA QI KV++AL  +M  K +ACIGGT   ED   L +   ++VGTPGRV D I+R   +T+ IKMF+LDEADEMLS GFKEQI+ +   +   TQ+VLLSATMP DVLEVT KFMRNPV+ILVKK+ELTLEGI+QFYVNV  EEYK+E LTDLY+++++TQAVIFCNTRRKV+ LT  L+  +F VS+++ D+ Q  RD IMKEFRSGSSRILI+TDLLARGIDVQQVSLVINYDLP+N+ENYIHRIGRGGRFGRKGVAINFVT +D+  +++LE +YST IEE+P +IA L+
Sbjct:   11 SQIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLRDA-QIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATLL 394          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Yeast
Match: TIF2 (Translation initiation factor eIF4A; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G; protein abundance increases in response to DNA replication stress; TIF2 has a paralog, TIF1, that arose from the whole genome duplication [Source:SGD;Acc:S000003674])

HSP 1 Score: 514.227 bits (1323), Expect = 0.000e+0
Identity = 261/385 (67.79%), Postives = 316/385 (82.08%), Query Frame = 2
Query:   86 GEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
             +I+TNY+KV   FDDM L E+LLRG++ YGFE+PSAIQQRA++P IEGHDV+AQAQSGTGKT TFS+A LQRID S    QAL+LAPTRELA QI KV++AL  +M  K +ACIGGT   ED   L +   ++VGTPGRV D I+R   +T+ IKMF+LDEADEMLS GFKEQI+ +   +   TQ+VLLSATMP DVLEVT KFMRNPV+ILVKK+ELTLEGI+QFYVNV  EEYK+E LTDLY+++++TQAVIFCNTRRKV+ LT  L+  +F VS+++ D+ Q  RD IMKEFRSGSSRILI+TDLLARGIDVQQVSLVINYDLP+N+ENYIHRIGRGGRFGRKGVAINFVT +D+  +++LE +YST IEE+P +IA L+
Sbjct:   11 SQIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLRDA-QIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATLL 394          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Yeast
Match: FAL1 (Nucleolar protein required for maturation of 18S rRNA; member of the eIF4A subfamily of DEAD-box ATP-dependent RNA helicases; 18S rRNA biogenesis defect of the null mutant is functionally complemented by human EIF4A3 [Source:SGD;Acc:S000002428])

HSP 1 Score: 446.817 bits (1148), Expect = 9.580e-156
Identity = 224/379 (59.10%), Postives = 298/379 (78.63%), Query Frame = 2
Query:  110 KVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLE-NGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSR--GFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADL 1237
            KV+ +F+ MNLK+DLLRGIY+YGFE PS+IQ RA+   I G DVIAQAQSGTGKTATF++ +LQ ID+ K ++QAL+L+PTRELA QI +V+  LGDYM   ++A  GG  +++D+  ++ +G   + GTPGRV DMI++  L+T N++M VLDEADE+LS   GFK+QI+ +   +  + Q+V++SATM  D+LEVTRKFM +PVKILVK++E++LEGI+Q+ VNV  EE+KF+TL D+Y++LTITQ VIFCNT++KVD L+  L    F V SMHGDM+Q+ RD++M +FR+G SR+LI+TD+ ARGIDVQQVSLVINYDLP   ENYIHRIGR GRFGRKGVAINF+T+ D+  L+++E +YS  I  MP N A+L
Sbjct:   20 KVSSTFESMNLKDDLLRGIYSYGFEAPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGLLQAIDLRKKDLQALILSPTRELASQIGQVVKNLGDYMNVNAFAITGGKTLKDDLKKMQKHGCQAVSGTPGRVLDMIKKQMLQTRNVQMLVLDEADELLSETLGFKQQIYDIFAKLPKNCQVVVVSATMNKDILEVTRKFMNDPVKILVKRDEISLEGIKQYVVNVDKEEWKFDTLCDIYDSLTITQCVIFCNTKKKVDWLSQRLIQSNFAVVSMHGDMKQEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDLPEIIENYIHRIGRSGRFGRKGVAINFITKADLAKLREIEKFYSIKINPMPANFAEL 398          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Yeast
Match: DHH1 (Cytoplasmic DEAD-box helicase, stimulates mRNA decapping; coordinates distinct steps in mRNA function and decay, interacting with both decapping and deadenylase complexes; role in translational repression, mRNA decay, and possibly mRNA export; interacts and cooperates with Ngr1p to promote specific mRNA decay; ATP- and RNA-bound form promotes processing body (PB) assembly, while ATPase stimulation by Not1p promotes PB disassembly; forms cytoplasmic foci on replication stress [Source:SGD;Acc:S000002319])

HSP 1 Score: 279.256 bits (713), Expect = 6.295e-89
Identity = 155/369 (42.01%), Postives = 223/369 (60.43%), Query Frame = 2
Query:  122 SFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNI 1228
            +F+D  LK +LL GI+  GFEKPS IQ+ A+  AI G D++A+A++GTGKTA F +  L+++    N++QAL++ PTRELA Q  +V+  LG + G       GGT +++D+  L   VH++VGTPGRV D+  R     ++  +F++DEAD+MLSR FK  I  ++ ++    Q +L SAT P  V E   K +  P +I +  EELTL+GI Q+Y  V  E  K   L  L+  L I QA+IFCN+  +V+ L   +    +     H  M+Q  R+++  EFR G  R L+ +DLL RGID+Q V++VIN+D P   E Y+HRIGR GRFG  G+AIN +  +D   L  +E    T I  +P  I
Sbjct:   47 TFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINL-MEELTLKGITQYYAFV-EERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATI 413          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Yeast
Match: DBP5 (Cytoplasmic ATP-dependent RNA helicase of the DEAD-box family; involved in mRNA export from the nucleus, remodeling messenger ribonucleoprotein particles (mRNPs), with ATPase activity stimulated by Gle1p, IP6 and Nup159p; involved in translation termination along with Sup45p (eRF1); role in the cellular response to heat stress [Source:SGD;Acc:S000005572])

HSP 1 Score: 249.595 bits (636), Expect = 9.312e-78
Identity = 154/370 (41.62%), Postives = 233/370 (62.97%), Query Frame = 2
Query:  119 ESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAI---EGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEML-SRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLP------SNRENYIHXXXXXXXXXXXXVAINFV-TQDDIRTLQDLESYY 1195
            +SFD++ L  +LL+GIYA  F+KPS IQ+RA LP +      ++IAQ+QSGTGKTA FS+ +L R++      QA+ LAP+RELA+Q  +V+  +G +    S   +  +  +    N +    VIVGTPG V D++ R  ++   IK+FVLDEAD ML  +G  +Q   V +++  DTQ+VL SAT    V +  +K + N   + ++  E+ ++ I+Q Y++   E  KF+ LT+LY  +TI  ++IF  T++  + L   LK +   VS +HGD+Q   RD+++ +FR G S++LITT++LARGID+  VS+V+NYDLP      ++   YIHRIGR GRFGRKGVAI+FV  ++    L  ++ Y+
Sbjct:   92 KSFDELGLAPELLKGIYAMKFQKPSKIQERA-LPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEK----NKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGLMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYF 456          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Nematostella
Match: EDO45225 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTJ5])

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 282/389 (72.49%), Postives = 321/389 (82.52%), Query Frame = 2
Query:   92 IETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNE------VQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            IE+N+++V ESFDDMNLKE LLRGIYAYGFEKPSAIQQRA+ P  +  DVIAQAQSGTGKTATF+++ILQ ID +  +       QALVLAPTRELA+QI KV++ALGDYM  K +ACIGGT V+ED   LE GVHV+VGTPGRV DMI RG L T +IK+FVLDEADEMLSRGFK+QI+ V   +    Q+VLLSATMP DVLEVT KFMR+ V+ILVK+EE+TLEGI+QF+V V  E++K +TL DLYETLTITQAVIF NTRRKVD L   +  K   VSSMHGDM Q  RD IMKEFRSGSSR+LITTDLLARGIDV QVSLVINYDLPSNRENYIHRIGRGGRFGRKG AINFVT DD+R L+D+E YY+T IEEMPMN+ADLI
Sbjct:   24 IESNWDEVVESFDDMNLKEALLRGIYAYGFEKPSAIQQRAIRPCCQARDVIAQAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMHVKCHACIGGTNVREDRMKLEEGVHVVVGTPGRVFDMINRGVLNTRDIKLFVLDEADEMLSRGFKDQIYDVFTRLPTSVQVVLLSATMPTDVLEVTNKFMRDVVRILVKREEVTLEGIKQFFVLVEKEDWKLDTLCDLYETLTITQAVIFANTRRKVDWLAAKMTEKDHTVSSMHGDMSQKERDIIMKEFRSGSSRVLITTDLLARGIDVHQVSLVINYDLPSNRENYIHRIGRGGRFGRKGAAINFVTNDDVRMLKDIEQYYNTKIEEMPMNVADLI 412          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Nematostella
Match: EDO48460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIU5])

HSP 1 Score: 522.316 bits (1344), Expect = 0.000e+0
Identity = 261/385 (67.79%), Postives = 321/385 (83.38%), Query Frame = 2
Query:   89 EIETNYE-KVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            E ET+ + +V  +FD M L+EDLLRGIYAYGFEKPSAIQQRA+ P ++G DVIAQAQSGTGKTATFS+++LQ ID    E QALVL+PTRELA QI KV++ALGDYM  + +ACIGGT + ED+  L+ G H++ GTPGRV DMI R NL+T +IKM VLDEADEML++GFKEQI+ V +Y+   TQ+VLLSAT+P ++LE+T KFM +P++ILVK++ELTLEGI+QF+V V  EE+KF+TL DLY+TLTITQAVIFCNT+RKVD LT+ ++   F V+SMHGDM Q  R+ IMK+FR+G SR+LI+TD+ ARG+DVQQVSLVINYDLP+NRE YIHRIGR GRFGRKGVAINFV  DDIR L+D+E YYST I+EMPMN+ADLI
Sbjct:   23 EFETSEDVEVLPTFDAMKLREDLLRGIYAYGFEKPSAIQQRAIKPILKGRDVIAQAQSGTGKTATFSISVLQAIDTQLREPQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTNIGEDIRKLDYGQHIVSGTPGRVFDMIRRRNLRTRSIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVASMHGDMPQKEREAIMKDFRAGQSRVLISTDVWARGLDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNVADLI 407          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Nematostella
Match: EDO39940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8H2])

HSP 1 Score: 293.123 bits (749), Expect = 9.967e-95
Identity = 159/365 (43.56%), Postives = 236/365 (64.66%), Query Frame = 2
Query:  125 FDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMP 1219
            F+D  LK +LL GI+  GF+KPS IQ+ ++  A+ G D++A+A++GTGKTA + V +L+R D +KN +QALVL PTRELA Q  ++ I LG +MGA+     GGT +++D+  L N VHVIV TPGRV D++++     +  +M V+DEAD++LS  FK+ +  +I+++  + QI+L SAT P  V +   K +R P +I +  +ELTL G+ Q+Y  V  E+ K   L  L++ L I Q++IFCN+ ++V+ L   +    F    +H  M Q  R+++  +FR G  R L+ +DL  RGID+Q V++VIN+D P N E Y+HRIGR GRFG  GVAIN +T DD   L  +E+   T I+ +P
Sbjct:   49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKHMGAQVMVTTGGTSLKDDILRLYNKVHVIVATPGRVLDLMKKKLADMSKCQMLVMDEADKLLSMDFKKMLEQIIKHLPENRQILLFSATFPISVRDFKEKHLRKPYEINL-MDELTLHGVTQYYAFV-EEKQKVHCLNTLFQKLQINQSIIFCNSVQRVELLARKILELGFSCFYIHARMSQSHRNRVFHDFRQGHCRNLVCSDLFTRGIDIQSVNVVINFDFPKNSETYLHRIGRSGRFGHLGVAINLITYDDRFDLYKIENELDTEIKPIP 411          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Nematostella
Match: EDO46214 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQR7])

HSP 1 Score: 236.113 bits (601), Expect = 3.664e-73
Identity = 145/374 (38.77%), Postives = 221/374 (59.09%), Query Frame = 2
Query:  125 FDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALG-DYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGE-------EYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQ-DDIRTLQDLESYYSTHIEEMP 1219
            F  + L   LLRG+   GFEKPS IQ +A+     G D+IAQA+SGTGKT  FSV  L+ +    N +Q ++L PTRE+A Q+  VI A+G  Y G      IGG  ++ED   L++  H+ VGTPGRV  +IE+  LKT +++MF+LDEAD++L   F++QI+ +   +  + Q++  SAT P  +    +K+M  P  + +   + +L+GI+QFY  V          + K + L  L  ++   Q ++F N + +   L+D+L  K +  + + G   Q  R + M++ +S   RILI+TDL ARGID + V+LV+N D+P N E Y+HRIGR GRFG +G+A+ +V    + R L+D+E      +E +P
Sbjct:   23 FHSLLLSPTLLRGLNEAGFEKPSPIQLKAIPLGRCGLDLIAQAKSGTGKTCVFSVIALENVITESNCIQIIILTPTREIAVQVKDVICAIGCHYDGLACKVFIGGISLEEDKKALKS-CHIAVGTPGRVKYLIEQKYLKTESVRMFILDEADKLLDESFQQQINWIFSALPENKQMMAFSATYPEVLANHLKKYMTEPTFVRLNAADPSLQGIKQFYSLVRFHPLPHKTFQEKVDGLIKLLSSVNFNQCLVFSNYQIRAKSLSDTLCRKGWPSTFIAGYQTQAKRLEAMEKLKSFHCRILISTDLTARGIDAENVNLVVNMDVPHNGETYLHRIGRAGRFGTEGMAVTYVANGKEERELRDIERSIDVKMELLP 395          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Nematostella
Match: EDO46520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPJ2])

HSP 1 Score: 234.187 bits (596), Expect = 5.723e-72
Identity = 145/382 (37.96%), Postives = 233/382 (60.99%), Query Frame = 2
Query:  116 TESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAV--LPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMG--AKSYACIGG--TRVQEDVGNLENGVHVIVGTPGRVNDMIERGN-LKTNNIKMFVLDEADEMLS-RGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLP------SNRENYIHXXXXXXXXXXXXVAINFVT-QDDIRTLQDLESYYSTHIEEM 1216
             +SF+++ L  +L RG+Y  GF KPS IQ+ A+  L A    ++IAQ+QSGTGKTA F + +L R+D +K   Q + L+PT ELA+Q  KV  A+G +      +YA  G    R Q+         H+I+GTPG + D I +    +   + +FVLDEAD M++ +G ++Q   + + +  D Q++L SAT   DV++     + NP+ I +++EE +L+ I+Q+YV     E KFE L ++Y  L+I Q V+FC+TRR    L + +  +   V+ + G++  + R  +++ FR G  ++LITT++ ARGIDV+QV+LVINYD+P      ++ E Y+HRIGR GRFG+ G+A+NF+  Q  +  ++ +E ++   I+ +
Sbjct:   45 AKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLADPPVNMIAQSQSGTGKTAAFVLTMLSRVDATKPYPQVICLSPTYELARQTGKVAEAMGKHCPHIKINYAVRGNQFPRGQKCTD------HIIIGTPGTLLDWIRKSKCFEPRKVSVFVLDEADIMIALQGHQDQSIRIHKSLHKDCQVLLFSATYDEDVMKFAETVVPNPIIIRLRREEESLDNIKQYYVVCKNSEDKFEALCNMYGVLSIGQCVVFCHTRRNAAWLAEKMVKEGHAVALLSGEITIEQRIAVLERFRLGKEKLLITTNVSARGIDVEQVTLVINYDMPMDMQGKADFETYLHRIGRTGRFGKSGIAVNFIDGQRSMNIMKKIEEHFGKKIQHL 420          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Medaka
Match: eif4a1a (eukaryotic initiation factor 4A-I [Source:NCBI gene;Acc:101155548])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 282/390 (72.31%), Postives = 334/390 (85.64%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLE-NGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N+ ++ +SFDDMNL+E LLRGIYAYGFEKPSAIQQRA++P I+G+DVIAQAQSGTGKTATF+++ILQ+IDV     QALVLAPTRELA+QI KV++ALGDYMGA  YACIGGT ++ +V  L+    H++VGTPGRV DM+ R N+    IKMFVLDEADEMLSRGFK+QI+ + Q +   TQ+VLLSATMP DVLEVT+KFMR P++ILVKKEELTLEGIRQFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAIN VT+DD RTL+D+E++Y+T +EEMPMN+ADLI
Sbjct:   16 MEPDGIIESNWNQIVDSFDDMNLREALLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQIDVEMKATQALVLAPTRELAQQIQKVVLALGDYMGANCYACIGGTNIRNEVQKLQAEAPHIVVGTPGRVFDMLSRKNISPKCIKMFVLDEADEMLSRGFKDQIYEIFQKLASSTQVVLLSATMPADVLEVTKKFMREPIRILVKKEELTLEGIRQFYINVEKEEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSALHGDMDQKERDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEDDKRTLRDIETFYNTTVEEMPMNVADLI 405          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Medaka
Match: eif4a2 (eukaryotic translation initiation factor 4A2 [Source:NCBI gene;Acc:101167901])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 278/390 (71.28%), Postives = 338/390 (86.67%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLE-NGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            ME  G IE+N+ ++T++FDDMNLKE LLRGIYAYGFEKPSAIQQRA++P I+G+DVIAQAQSGTGKTATF+++ILQ++D+ + E QALVLAPTRELA+QI KVI+ALGDYMGA  +ACIGGT ++ ++  L+    H++VGTPGRV DM+ R +L    IKMFVLDEADEMLSRGFK+QI+ + Q +  + Q+VLLSATMP DVLEVT+KFMR+P++ILVKKEELTLEGI+QFY+NV  EE+K +TL DLYETLTITQAVIF NTRRKVD LT+ +  + F VS++HGDM Q  RD IM+EFRSGSSR+LITTDLLARGIDVQQVSLVINYDLP+NRENYIHRIGRGGRFGRKGVAINFVT++D R L+D+E++Y+T +EEMPMN+ADLI
Sbjct:   22 MEPDGIIESNWNEITDNFDDMNLKETLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLDIEQKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNLRSEIQKLQAEAPHIVVGTPGRVFDMLNRRHLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLSTNIQVVLLSATMPADVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 411          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Medaka
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:101159793])

HSP 1 Score: 519.235 bits (1336), Expect = 0.000e+0
Identity = 260/385 (67.53%), Postives = 319/385 (82.86%), Query Frame = 2
Query:   89 EIETNYE-KVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            E ET+ E  VT +FD M L+EDLLRGIYAYGFEKPSAIQQRA+   I+G DVIAQ+QSGTGKTATF +++LQ +D+   E QAL+LAPTRELA QI KV++ALGDYM  + +ACIGGT V ED+  L+ G HV+ GTPGRV DMI R +L+T  IKM VLDEADEML++GFKEQI+ V +Y+   TQ+VL+SAT+P ++LE+T KFM +P++ILVK++ELTLEGI+QF+V V  EE+KF+TL DLY+TLTITQAVIFCNT+RKVD LT+ ++   F VSSMHGDM Q  R+ IMKEFRSG+SR+LI+TD+ ARG+DV QVSL+INYDLP+NRE YIHRIGR GR+GRKGVAINFV  DDIR L+D+E YYST I+EMPMN+ADLI
Sbjct:   22 EFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCISVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 406          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Medaka
Match: ENSORLT00000028513.1 (probable ATP-dependent RNA helicase ddx6 [Source:NCBI gene;Acc:101166148])

HSP 1 Score: 281.567 bits (719), Expect = 4.577e-89
Identity = 153/369 (41.46%), Postives = 240/369 (65.04%), Query Frame = 2
Query:  125 FDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGA-KSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNI 1228
            F+D  LK +LL GI+  G+EKPS IQ+ ++  A+ G D++A+A++GTGK+  + + +L+RID+ K+ +QA+V+ PTRELA Q+ ++ I +  +MG  K  A  GGT +++D+  L+  VHV++ TPGR+ D+I++G  K + ++M V+DEAD++LS+ F   I  +I ++  + QI+L SAT P  V +   K ++ P +I +  EELTL+GI QFY  V  E  K   L  L+  L I Q++IFCN+ ++V+ L   +    +    +H  M Q+ R+++  +FR+G  R L+ TDL  RGID+Q V++VIN+D P N E Y+HRIGR GRFG  G+AIN +T +D   L+ +E    T I+ +P +I
Sbjct:   91 FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDHIQAIVMVPTRELALQVSQISIQISKHMGGVKVMATTGGTNLRDDIMRLDEIVHVVIATPGRILDLIKKGVAKVDRVQMIVMDEADKLLSQDFVVLIEDIISFLAKNRQILLYSATFPMSVQKFMAKHLQKPYEINLM-EELTLKGITQFYAYVT-ERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMMQEYRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITSEDRFNLKAIEEQLVTDIKPIPSSI 457          
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Medaka
Match: ENSORLT00000045064.1 (probable ATP-dependent RNA helicase ddx6 [Source:NCBI gene;Acc:101166148])

HSP 1 Score: 281.567 bits (719), Expect = 4.577e-89
Identity = 153/369 (41.46%), Postives = 240/369 (65.04%), Query Frame = 2
Query:  125 FDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGA-KSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNI 1228
            F+D  LK +LL GI+  G+EKPS IQ+ ++  A+ G D++A+A++GTGK+  + + +L+RID+ K+ +QA+V+ PTRELA Q+ ++ I +  +MG  K  A  GGT +++D+  L+  VHV++ TPGR+ D+I++G  K + ++M V+DEAD++LS+ F   I  +I ++  + QI+L SAT P  V +   K ++ P +I +  EELTL+GI QFY  V  E  K   L  L+  L I Q++IFCN+ ++V+ L   +    +    +H  M Q+ R+++  +FR+G  R L+ TDL  RGID+Q V++VIN+D P N E Y+HRIGR GRFG  G+AIN +T +D   L+ +E    T I+ +P +I
Sbjct:   91 FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDHIQAIVMVPTRELALQVSQISIQISKHMGGVKVMATTGGTNLRDDIMRLDEIVHVVIATPGRILDLIKKGVAKVDRVQMIVMDEADKLLSQDFVVLIEDIISFLAKNRQILLYSATFPMSVQKFMAKHLQKPYEINLM-EELTLKGITQFYAYVT-ERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMMQEYRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITSEDRFNLKAIEEQLVTDIKPIPSSI 457          
BLAST of Eukaryotic initiation factor 4A vs. Planmine SMEST
Match: SMESG000058317.1 (SMESG000058317.1)

HSP 1 Score: 765.377 bits (1975), Expect = 0.000e+0
Identity = 388/389 (99.74%), Postives = 388/389 (99.74%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVG EEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI
Sbjct:    1 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGDEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 389          
BLAST of Eukaryotic initiation factor 4A vs. Planmine SMEST
Match: SMESG000000613.1 (SMESG000000613.1)

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 284/389 (73.01%), Postives = 339/389 (87.15%), Query Frame = 2
Query:   74 MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            MEN G IETNY+K+ ESF+D+NLKEDLLRGI+AYGFEKPSAIQ+RA+LPAIEGHDVIAQAQSGTGKTATFS+++LQ ID S N+ QA++LAPTRELA+QIHKVI+ +GDY+ AK  ACIGG  V++D+  LE+G+HV+VGTPGRV DM++RG++K+  IKMFVLDEADEMLSRGF+E +   I Y+E D Q+ +LSATMP +VL VT++FM++PVKILVK EELTLEGIRQFYVNV  EEYKF+TLTDLYE+LTITQAVIFCN + KV  LT++LK K F+VSS+HGDM Q  RDQIM EFRSGS+RILITTDLL RGIDVQQVSLVINYDLP NRENYIHRIGRGGRFGRKGVA+NFVT +DI  LQ LE++Y T ++EMPMN+A+ +
Sbjct:    1 MENIGVIETNYDKIVESFEDLNLKEDLLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGTGKTATFSISVLQNIDTSINKTQAIILAPTRELAQQIHKVIMTIGDYLSAKCCACIGGRNVRDDISKLESGMHVVVGTPGRVKDMLKRGHIKSEYIKMFVLDEADEMLSRGFQEDVCECITYLEADAQMFILSATMPDEVLTVTKRFMKDPVKILVKTEELTLEGIRQFYVNVSQEEYKFDTLTDLYESLTITQAVIFCNFKNKVITLTENLKSKGFVVSSVHGDMDQSSRDQIMNEFRSGSTRILITTDLLCRGIDVQQVSLVINYDLPKNRENYIHRIGRGGRFGRKGVALNFVTDNDISELQALETFYKTKVDEMPMNLAEFL 389          
BLAST of Eukaryotic initiation factor 4A vs. Planmine SMEST
Match: SMESG000040535.1 (SMESG000040535.1)

HSP 1 Score: 488.034 bits (1255), Expect = 1.837e-171
Identity = 235/377 (62.33%), Postives = 312/377 (82.76%), Query Frame = 2
Query:  110 KVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            K+ E+F+D+NLKE+LLRGI+AYGFEKPSAIQ+RA+LPAIEGHDVIAQAQSG+GKT TF++++LQ +D S N+VQA++LAPTRELA+Q + +I ++GD+MG K  ACIGG  V++D+ N+++G+ V+VGTPGRV DMI + +++T +IK+FVLDEADEMLSRGF++ +   + Y+E  TQI LLSATMP DVL V   FM++PV+ILV KEELTLEGIRQFYV+ G +EYK ETL DLY  LTI QAVIFCN +  V  LT++L  + F VS++H D+ Q  RDQIM +FR+GS+R+LITTDLL RGIDVQ +S+VINYDLP N+ENYIHRIGR GR+GRKGVA+NFVT  D + ++++E +Y+T I+E+PM++++ +
Sbjct:    4 KIIETFEDLNLKEELLRGIFAYGFEKPSAIQKRAILPAIEGHDVIAQAQSGSGKTGTFAISVLQNVDQSLNKVQAIILAPTRELAQQTNNIITSIGDFMGVKCCACIGGRNVKDDIRNIKSGMQVVVGTPGRVKDMINKRHIETTHIKIFVLDEADEMLSRGFQQDVCDCLGYLEPGTQIFLLSATMPDDVLSVANSFMKDPVRILVNKEELTLEGIRQFYVDCGRDEYKCETLVDLYHNLTIKQAVIFCNYKTSVISLTENLTQQGFTVSAVHSDIDQATRDQIMVQFRNGSTRVLITTDLLYRGIDVQNISIVINYDLPKNKENYIHRIGRCGRYGRKGVALNFVTNKDFQAMKEIERFYNTAIQELPMDLSEFL 380          
BLAST of Eukaryotic initiation factor 4A vs. Planmine SMEST
Match: SMESG000022208.1 (SMESG000022208.1)

HSP 1 Score: 477.633 bits (1228), Expect = 2.608e-167
Identity = 229/377 (60.74%), Postives = 310/377 (82.23%), Query Frame = 2
Query:  110 KVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            K+ E+F+D+NLKE+LLRGI+AYGFEKPSAIQ+ A+LPAIEGHDVIAQAQSG+GKT TF++++LQ +D S N++QA++LAPTRELA+Q + +I ++GD+MG K  +CIGG  V++D+ N+++G+ V+VGTPGRV DMI + +++T +IK+FVLDEADEMLSRGF++ +   + Y+E  TQI LLSAT+P +VL V   FM++PV+ILV KEELTLEGIRQFYV+   +EYK ETL DLY  LTI QAVIFCN +  V  LT++L  + F VS++H D+ Q  RDQIM +FR+GS+R+LITTDLL RGIDVQ +S+VINYDLP N+ENYIHRIGR GR+GRKGVA+NFVT  D + ++++E +Y+T I+E+PM++++ +
Sbjct:    4 KIIETFEDLNLKEELLRGIFAYGFEKPSAIQKLAILPAIEGHDVIAQAQSGSGKTRTFTISVLQNVDQSLNKIQAIILAPTRELAQQTNNIITSIGDFMGVKCCSCIGGRNVKDDIRNIKSGMQVVVGTPGRVKDMINKRHIETAHIKIFVLDEADEMLSRGFQQDVCDCLGYLEPATQIFLLSATIPDEVLSVANSFMKDPVRILVNKEELTLEGIRQFYVDCSKDEYKCETLIDLYHNLTIKQAVIFCNYKTSVISLTENLTQQGFTVSAVHSDIDQATRDQIMIQFRNGSTRVLITTDLLCRGIDVQNISIVINYDLPKNKENYIHRIGRCGRYGRKGVALNFVTNKDFQAMKEIERFYNTAIQELPMDLSEFL 380          
BLAST of Eukaryotic initiation factor 4A vs. Planmine SMEST
Match: SMESG000078818.1 (SMESG000078818.1)

HSP 1 Score: 477.633 bits (1228), Expect = 5.205e-167
Identity = 234/385 (60.78%), Postives = 310/385 (80.52%), Query Frame = 2
Query:   89 EIETNYE-KVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPAIEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQIHKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMPPDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLYETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKEFRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHXXXXXXXXXXXXVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI 1240
            E ET+ E  VT  F+ MNLKEDLLRGIYAYGFEKPSAIQ RA+   ++G DVIAQAQSGTGKT+  +++ LQ  D+   E Q L+L+PTRELA+Q  KVI+ALGDYM  + +ACIGG  + +D+  L+ G H++ GTPGRV DM++R NL+T+ I   VLDEADEML +GFKEQI+ + +Y+   TQ++L+SAT+P ++LE+T KFM NP++ILVK++ELTLEGI+Q++V+V  EE+KF+TL D+Y+T+T+TQ VIFCNT+RKV+ LT+ ++   F VSS+HGDM Q  RD+I ++FR+  +R+LITTD+ ARGIDVQ VSLVINYDLP+NRE YIHRIGR GR+GRKGVAINFV  DD+R L+D+E +Y+T I+EMPMN+A+L+
Sbjct:   14 EFETSEEIDVTPVFNKMNLKEDLLRGIYAYGFEKPSAIQARAIKQIVKGRDVIAQAQSGTGKTSLIAISSLQLTDIDLRETQILILSPTRELAQQTQKVILALGDYMNVQCHACIGGASMAQDMKKLDYGQHIVSGTPGRVFDMMQRRNLRTSKISTLVLDEADEMLDKGFKEQIYQIYRYLPPGTQVILISATLPHEILEMTSKFMTNPIRILVKRDELTLEGIKQYFVSVEREEWKFDTLCDIYDTVTVTQVVIFCNTKRKVEWLTEKMRENNFTVSSIHGDMPQGERDEITRQFRALETRVLITTDVWARGIDVQHVSLVINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKSDDVRILRDIEQFYATQIDEMPMNMAELV 398          
The following BLAST results are available for this feature:
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF4A10.000e+072.31eukaryotic translation initiation factor 4A1 [Sour... [more]
EIF4A20.000e+070.77eukaryotic translation initiation factor 4A2 [Sour... [more]
EIF4A20.000e+070.77eukaryotic translation initiation factor 4A2 [Sour... [more]
EIF4A30.000e+067.53eukaryotic translation initiation factor 4A3 [Sour... [more]
EIF4A30.000e+067.53eukaryotic translation initiation factor 4A3 [Sour... [more]
back to top
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inf-10.000e+070.91Eukaryotic initiation factor 4A [Source:UniProtKB... [more]
inf-10.000e+070.91Eukaryotic initiation factor 4A [Source:UniProtKB... [more]
inf-10.000e+070.91Eukaryotic initiation factor 4A [Source:UniProtKB... [more]
F33D11.100.000e+066.75pep chromosome:WBcel235:I:5866514:5868139:-1 gene:... [more]
Y65B4A.60.000e+066.23pep chromosome:WBcel235:I:629492:636350:-1 gene:WB... [more]
back to top
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eIF4A0.000e+072.24gene:FBgn0001942 transcript:FBtr0079178[more]
eIF4A0.000e+072.24gene:FBgn0001942 transcript:FBtr0079175[more]
eIF4A0.000e+072.24gene:FBgn0001942 transcript:FBtr0079177[more]
eIF4A0.000e+072.24gene:FBgn0001942 transcript:FBtr0307068[more]
eIF4A0.000e+072.24gene:FBgn0001942 transcript:FBtr0079176[more]
back to top
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4a1a0.000e+072.56eukaryotic translation initiation factor 4A1A [Sou... [more]
eif4a1b0.000e+072.05eukaryotic translation initiation factor 4A1B [Sou... [more]
eif4a1b0.000e+072.05eukaryotic translation initiation factor 4A1B [Sou... [more]
eif4a20.000e+071.54eukaryotic translation initiation factor 4A, isofo... [more]
eif4a1b0.000e+072.05eukaryotic translation initiation factor 4A1B [Sou... [more]
back to top
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4a10.000e+071.54eukaryotic translation initiation factor 4A1 [Sour... [more]
eif4a10.000e+071.54eukaryotic translation initiation factor 4A1 [Sour... [more]
eif4a10.000e+071.54eukaryotic translation initiation factor 4A1 [Sour... [more]
eif4a10.000e+071.54eukaryotic translation initiation factor 4A1 [Sour... [more]
eif4a10.000e+071.54eukaryotic translation initiation factor 4A1 [Sour... [more]
back to top
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eif4a10.000e+072.31eukaryotic translation initiation factor 4A1 [Sour... [more]
Eif4a20.000e+070.77eukaryotic translation initiation factor 4A2 [Sour... [more]
Eif4a20.000e+070.77eukaryotic translation initiation factor 4A2 [Sour... [more]
Eif4a30.000e+067.79eukaryotic translation initiation factor 4A3 [Sour... [more]
Eif4a3l11.535e-17966.75eukaryotic translation initiation factor 4A3 like ... [more]
back to top
BLAST of Eukaryotic initiation factor 4A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4P331|IF4A_USTMA0.000e+073.25ATP-dependent RNA helicase eIF4A OS=Ustilago maydi... [more]
sp|Q2HFP1|IF4A_CHAGB0.000e+072.73ATP-dependent RNA helicase eIF4A OS=Chaetomium glo... [more]
sp|A4QVP2|IF4A_MAGO70.000e+072.21ATP-dependent RNA helicase eIF4A OS=Magnaporthe or... [more]
sp|Q7RV88|IF4A_NEUCR0.000e+072.47ATP-dependent RNA helicase eIF4A OS=Neurospora cra... [more]
sp|Q0UU86|IF4A_PHANO0.000e+071.95ATP-dependent RNA helicase eIF4A OS=Phaeosphaeria ... [more]
back to top
BLAST of Eukaryotic initiation factor 4A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A4V6N00.000e+096.92eIF4A isoform 1A protein OS=Dugesia japonica OX=61... [more]
A0A1Y1K7F50.000e+075.77Uncharacterized protein OS=Photinus pyralis OX=705... [more]
K4QDH40.000e+074.81Eukaryotic initiation factor 4A OS=Phaedon cochlea... [more]
A0A411G8510.000e+075.06Eukaryotic initiation factor 4A-II (Fragment) OS=C... [more]
A0A1V9XU990.000e+074.04Eukaryotic initiation factor 4A-II-like OS=Tropila... [more]
back to top
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4a1a0.000e+071.79eukaryotic initiation factor 4A-I [Source:NCBI gen... [more]
eif4a20.000e+071.03eukaryotic translation initiation factor 4A2 [Sour... [more]
eif4a30.000e+067.79eukaryotic translation initiation factor 4A3 [Sour... [more]
eif4a37.017e-17868.58eukaryotic translation initiation factor 4A3 [Sour... [more]
eif4a1b2.123e-17766.92eukaryotic translation initiation factor 4A1B [Sou... [more]
back to top
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx65.757e-8940.92DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN... [more]
ENSPMAT00000000216.11.251e-6034.71pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-... [more]
ddx39aa4.377e-5835.64DEAD (Asp-Glu-Ala-Asp) box polypeptide 39Aa [Sourc... [more]
ddx591.497e-5533.16DEAD (Asp-Glu-Ala-Asp) box polypeptide 59 [Source:... [more]
ENSPMAT00000003898.15.728e-5132.67pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 ... [more]
back to top
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TIF10.000e+067.79Translation initiation factor eIF4A; DEA(D/H)-box ... [more]
TIF20.000e+067.79Translation initiation factor eIF4A; DEA(D/H)-box ... [more]
FAL19.580e-15659.10Nucleolar protein required for maturation of 18S r... [more]
DHH16.295e-8942.01Cytoplasmic DEAD-box helicase, stimulates mRNA dec... [more]
DBP59.312e-7841.62Cytoplasmic ATP-dependent RNA helicase of the DEAD... [more]
back to top
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO452250.000e+072.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484600.000e+067.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399409.967e-9543.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462143.664e-7338.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465205.723e-7237.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Eukaryotic initiation factor 4A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4a1a0.000e+072.31eukaryotic initiation factor 4A-I [Source:NCBI gen... [more]
eif4a20.000e+071.28eukaryotic translation initiation factor 4A2 [Sour... [more]
eif4a30.000e+067.53eukaryotic translation initiation factor 4A3 [Sour... [more]
ENSORLT00000028513.14.577e-8941.46probable ATP-dependent RNA helicase ddx6 [Source:N... [more]
ENSORLT00000045064.14.577e-8941.46probable ATP-dependent RNA helicase ddx6 [Source:N... [more]
back to top
BLAST of Eukaryotic initiation factor 4A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058317.10.000e+099.74SMESG000058317.1[more]
SMESG000000613.10.000e+073.01SMESG000000613.1[more]
SMESG000040535.11.837e-17162.33SMESG000040535.1[more]
SMESG000022208.12.608e-16760.74SMESG000022208.1[more]
SMESG000078818.15.205e-16760.78SMESG000078818.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025220 ID=SMED30025220|Name=Eukaryotic initiation factor 4A|organism=Schmidtea mediterranea sexual|type=transcript|length=1469bp
TTTGACTTTACTAAAATCCTTATAATTTTACTTTTTTAAATTCATAAACA
ATTAAATTAGATAAGCTCTTTAAATGGAGAATCCAGGCGAAATTGAGACG
AATTACGAGAAAGTCACAGAAAGCTTTGATGATATGAATCTGAAAGAAGA
TTTGCTTAGAGGTATATATGCATATGGTTTTGAAAAACCATCAGCCATTC
AGCAGAGAGCTGTTTTGCCAGCCATTGAAGGACATGATGTGATTGCTCAG
GCCCAGTCAGGTACAGGTAAAACTGCAACATTCAGTGTAGCTATCCTTCA
ACGTATTGATGTATCTAAAAATGAAGTTCAAGCTTTAGTACTAGCTCCAA
CCAGAGAATTAGCCAAACAGATACACAAAGTTATCATTGCTCTTGGAGAT
TATATGGGAGCCAAATCATATGCTTGTATCGGTGGAACTCGTGTTCAAGA
GGATGTGGGTAATCTAGAAAACGGAGTGCATGTTATTGTTGGTACTCCTG
GTCGAGTCAATGATATGATTGAACGAGGTAATTTAAAAACAAATAACATT
AAAATGTTTGTATTGGACGAAGCTGATGAGATGTTAAGTCGGGGTTTCAA
GGAACAAATTCATAGTGTAATTCAATACATTGAGCATGACACTCAAATTG
TATTATTATCAGCAACAATGCCACCAGATGTTTTAGAAGTTACTCGGAAG
TTTATGCGAAATCCTGTTAAGATTCTTGTTAAAAAAGAAGAATTAACATT
AGAAGGCATTAGGCAATTTTATGTCAATGTTGGGGGTGAAGAATATAAAT
TTGAAACATTAACCGATCTTTATGAAACATTAACAATTACTCAAGCGGTA
ATATTTTGTAATACTCGAAGGAAGGTGGATGGTTTGACAGATTCATTGAA
AGGCAAGCAGTTTATTGTTTCTTCAATGCATGGTGATATGCAGCAGGATA
TGCGTGATCAAATTATGAAAGAATTCCGAAGTGGATCAAGTAGAATATTG
ATTACAACTGATTTGTTAGCTCGTGGTATTGATGTCCAGCAAGTTTCTCT
TGTGATTAATTATGACCTCCCATCGAATCGGGAAAATTACATTCATAGAA
TCGGACGTGGTGGTCGTTTCGGTAGGAAAGGAGTTGCAATTAATTTTGTT
ACTCAAGACGATATAAGAACTCTACAAGATCTTGAGTCATATTATAGCAC
TCATATCGAAGAGATGCCGATGAACATTGCTGATTTGATATAGGGATGGT
GATTGGTCTAGCTTACATGAGTGTTGTCGTATTAGTAAAGATTTAATATA
ATTTGGAAAAGCATAAGTATTTTGATTTAGGAAAATTCTCTCATTGTTAT
TTAGTTGTCCACATTGAAACATAATTTTAAATTGTATTATTTTTGTAAAG
ATAATTTTTTGTTTAATGTTATATATAAGGTTAAGCATTTAATTAGTTCA
ATAAAAATGTTGACTTTAA
back to top

protein sequence of SMED30025220-orf-1

>SMED30025220-orf-1 ID=SMED30025220-orf-1|Name=SMED30025220-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=390bp
MENPGEIETNYEKVTESFDDMNLKEDLLRGIYAYGFEKPSAIQQRAVLPA
IEGHDVIAQAQSGTGKTATFSVAILQRIDVSKNEVQALVLAPTRELAKQI
HKVIIALGDYMGAKSYACIGGTRVQEDVGNLENGVHVIVGTPGRVNDMIE
RGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVIQYIEHDTQIVLLSATMP
PDVLEVTRKFMRNPVKILVKKEELTLEGIRQFYVNVGGEEYKFETLTDLY
ETLTITQAVIFCNTRRKVDGLTDSLKGKQFIVSSMHGDMQQDMRDQIMKE
FRSGSSRILITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFG
RKGVAINFVTQDDIRTLQDLESYYSTHIEEMPMNIADLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0003743translation initiation factor activity
GO:0004386helicase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0006413translational initiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 35..232
e-value: 2.6E-58
score: 209.7
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 47..217
score: 30.497
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 269..350
e-value: 1.6E-31
score: 120.7
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 242..350
e-value: 2.2E-30
score: 105.2
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 245..389
score: 25.751
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 41..204
e-value: 3.3E-45
score: 154.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 5..224
e-value: 9.2E-72
score: 242.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 225..389
e-value: 4.1E-58
score: 197.3
NoneNo IPR availablePANTHERPTHR24031:SF698coord: 5..380
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 5..380
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 229..344
e-value: 8.78325E-44
score: 146.498
NoneNo IPR availableCDDcd18046DEADc_EIF4AII_EIF4AI_DDX2coord: 18..218
e-value: 1.56453E-128
score: 366.001
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 163..171
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 16..44
score: 11.001
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 84..370