Innexin

Overview
NameInnexin
Smed IDSMED30025205
Length (bp)3011
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30025205) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30025205) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30025205) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30025205) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025205

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30025205SMESG000060499.1 AY067167smed_ncbi_20200123PMID:17670787
Oviedo et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30025205SMESG000060499.1 SmedASXL_013843SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30025205SMESG000078684.1 SMESG000060499.1 dd_Smed_v4_6114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025205SMESG000078684.1 SMESG000060499.1 dd_Smed_v4_6114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30025205SMESG000078684.1 SMESG000060499.1 dd_Smed_v4_6114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025205SMESG000078684.1 SMESG000060499.1 dd_Smed_v6_6114_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30025205SMESG000060499.1 OX_Smed_1.0.16537ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025205SMESG000078684.1 SMESG000060499.1 dd_Smed_v4_6114_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Human
Match: MEIS3 (Meis homeobox 3 [Source:HGNC Symbol;Acc:HGNC:29537])

HSP 1 Score: 160.229 bits (404), Expect = 1.491e-43
Identity = 81/113 (71.68%), Postives = 88/113 (77.88%), Query Frame = 3
Query: 2139 DIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAG------PHGYP 2459
            D  SD GDG++ S  S  +  E +  ++  +R KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR G      P G P
Sbjct:  106 DNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQP 218          
BLAST of Innexin vs. Ensembl Human
Match: MEIS3 (Meis homeobox 3 [Source:HGNC Symbol;Acc:HGNC:29537])

HSP 1 Score: 161.384 bits (407), Expect = 1.123e-42
Identity = 81/113 (71.68%), Postives = 88/113 (77.88%), Query Frame = 3
Query: 2139 DIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAG------PHGYP 2459
            D  SD GDG++ S  S  +  E +  ++  +R KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR G      P G P
Sbjct:  214 DNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQP 326          
BLAST of Innexin vs. Ensembl Human
Match: MEIS3 (Meis homeobox 3 [Source:HGNC Symbol;Acc:HGNC:29537])

HSP 1 Score: 160.614 bits (405), Expect = 2.873e-42
Identity = 81/113 (71.68%), Postives = 88/113 (77.88%), Query Frame = 3
Query: 2139 DIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAG------PHGYP 2459
            D  SD GDG++ S  S  +  E +  ++  +R KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR G      P G P
Sbjct:  231 DNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQP 343          
BLAST of Innexin vs. Ensembl Human
Match: MEIS3 (Meis homeobox 3 [Source:HGNC Symbol;Acc:HGNC:29537])

HSP 1 Score: 160.999 bits (406), Expect = 1.323e-41
Identity = 81/113 (71.68%), Postives = 88/113 (77.88%), Query Frame = 3
Query: 2139 DIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAG------PHGYP 2459
            D  SD GDG++ S  S  +  E +  ++  +R KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR G      P G P
Sbjct:  319 DNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQP 431          
BLAST of Innexin vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 150.984 bits (380), Expect = 1.581e-40
Identity = 88/144 (61.11%), Postives = 98/144 (68.06%), Query Frame = 3
Query: 2043 NPRDKECHNTSPSAHCVDISSNKTNMGGGSQVDIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAG 2474
            NP     H+ + S H        +        D  S+ GDG++NS  S     + D  +K+ KRQKKRGIFPKVATNIMRAWLFQHL+HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA   G    P G
Sbjct:   73 NPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVAS-PGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEG 215          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 276.174 bits (705), Expect = 8.289e-84
Identity = 158/409 (38.63%), Postives = 236/409 (57.70%), Query Frame = 3
Query:  756 RFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDA-RKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSP-QSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVESRLPSLMLNNTSNLN 1976
            R DDDFVD+LNY +T  ++F F  ++  +QYVG PIQCW+P +FT  WE+YTENYCWV NTY+  + +  P +   R+ + I YYQW P +L L++L FYIPC++WR +    SG NV+ + Q+A DA   +  +    ++  IA HM+  L                     I R +  +  + C+ K   N++T+LY+ IK+LYL N++ Q++++  F+GT   FYG  +L DL+ G EW  SGNFPRVT CD E + LG  H +++QCVL +NMF EKI++FLWFW+ +V   +  S+F WI     P   +K IR YLR  ++   TD+   +KF   +L  DG F +++I+ + GD++A +LI  +W                   N   R+  +  N+T +LN
Sbjct:   16 RVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDAR-MMDADARAATVQTIAGHMEDAL--------------------EIQREVTDVSGM-CVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH------------------NFNDRVRKIQFNSTESLN 382          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 276.174 bits (705), Expect = 8.289e-84
Identity = 158/409 (38.63%), Postives = 236/409 (57.70%), Query Frame = 3
Query:  756 RFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDA-RKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSP-QSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVESRLPSLMLNNTSNLN 1976
            R DDDFVD+LNY +T  ++F F  ++  +QYVG PIQCW+P +FT  WE+YTENYCWV NTY+  + +  P +   R+ + I YYQW P +L L++L FYIPC++WR +    SG NV+ + Q+A DA   +  +    ++  IA HM+  L                     I R +  +  + C+ K   N++T+LY+ IK+LYL N++ Q++++  F+GT   FYG  +L DL+ G EW  SGNFPRVT CD E + LG  H +++QCVL +NMF EKI++FLWFW+ +V   +  S+F WI     P   +K IR YLR  ++   TD+   +KF   +L  DG F +++I+ + GD++A +LI  +W                   N   R+  +  N+T +LN
Sbjct:   16 RVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDAR-MMDADARAATVQTIAGHMEDAL--------------------EIQREVTDVSGM-CVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH------------------NFNDRVRKIQFNSTESLN 382          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 276.559 bits (706), Expect = 2.744e-83
Identity = 161/422 (38.15%), Postives = 245/422 (58.06%), Query Frame = 3
Query:  756 RFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDA-RKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSP-QSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIY----RHKRIQEFE-ELKFTSLNVESRLPSLMLNNTSNLNDYDKSGAT 2000
            R DDDFVD+LNY +T  ++F F  ++  +QYVG PIQCW+P +FT  WE+YTENYCWV NTY+  + +  P +   R+ + I YYQW P +L L++L FYIPC++WR +    SG NV+ + Q+A DA   +  +    ++  IA HM+  L                     I R +  +  + C+ K   N++T+LY+ IK+LYL N++ Q++++  F+GT   FYG  +L DL+ G EW  SGNFPRVT CD E + LG  H +++QCVL +NMF EKI++FLWFW+ +V   +  S+F WI     P   +K IR YLR  ++   TD+   +KF   +L  DG F +++I+ + GD++A +LI  +W  +    R   I+ FE  +  +   +++   + +L  T     +D S  T
Sbjct:   16 RVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARM-MDADARAATVQTIAGHMEDAL--------------------EIQREVTDVSGM-CVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKSPIEMFEGGVTQSPSKLDANFKTWLLGQTRGKPPFDGSNPT 413          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 268.855 bits (686), Expect = 4.444e-81
Identity = 157/381 (41.21%), Postives = 235/381 (61.68%), Query Frame = 3
Query:  738 IGSNKLRFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKE-QMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLY-RHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIY 1874
            + S +   DDD +D+LNY +T  ++ +F  L+  +QYVG PIQCW+P  FT   E+YTENYCWV NTYF  + + +P   A +E + IGYYQW P +L L++LLFY+P ++WR +S QSG +V+ ++Q+A D+   L  E   +++  IA +++  L+ +H++          +G R      L  L  I C  +  G  +T LYIS+KILY +NI+GQ++L+  F+G +  +YG++VL DLM G EW  SG+FPRVT CD E K LG  H +++QCVL +NMF EKI++FLWFW+ ++  ATL SLF WI     P  ++  +  YL  +      D    R+F   +LR DG FL++++A + G+L   +L   +W  Y
Sbjct:   12 VKSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRL-LDLESRNRALQTIATNVEEALHVKHQV---------MSGNR------LKLLNLIIC-TRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 261.536 bits (667), Expect = 4.167e-78
Identity = 153/380 (40.26%), Postives = 227/380 (59.74%), Query Frame = 3
Query:  756 RFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKD-ARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSP-QSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISR-CLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHD------TDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQ 1868
            R DDDFVD+LNY +T  +L  F  L+  +QYVG PIQCW+P  FT   E+YTENYCWV NTY+  +Q  +P +  +R+ + IGYYQW P +L +++LLFY+PC++WR +    SG N++ ++Q+A DA   +  E   +++  +ARHM                  TN  R   SR C + L+     G+  G ++T+LYI IK+LY  N++ Q +L+   +G+    YG  +L DLM   EW  +G FPRVT CD E + LG  H +++QCVL +NMF EKI++FLWFW +  GI T+ +   WI  +  P   +  +R YLR   +L D       D    RKF  ++LR DG F++++I+ + G+L++ +LI  +WQ
Sbjct:   16 RLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARL-MDSEIKTRTVYTMARHM------------QDEVQLTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLR---VLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 379          
BLAST of Innexin vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0082256)

HSP 1 Score: 175.637 bits (444), Expect = 7.037e-47
Identity = 94/143 (65.73%), Postives = 101/143 (70.63%), Query Frame = 3
Query: 2145 ISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA------GPHGYPNDPAGYLPYMDNQQLAYARA---TGFHQAIPN 2546
             S SGD    S  SGE   E D D    K QKKRGIFPKVATNI+RAWLFQHL+HPYPSE+QKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA      GP GY +D  GY+  MD+Q     R     GFHQ  P+
Sbjct:  321 TSASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVYTPHPGPSGYGHDAMGYM--MDSQAHMMHRPPGDPGFHQGYPH 461          
BLAST of Innexin vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0082255)

HSP 1 Score: 176.022 bits (445), Expect = 8.058e-47
Identity = 94/143 (65.73%), Postives = 101/143 (70.63%), Query Frame = 3
Query: 2145 ISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA------GPHGYPNDPAGYLPYMDNQQLAYARA---TGFHQAIPN 2546
             S SGD    S  SGE   E D D    K QKKRGIFPKVATNI+RAWLFQHL+HPYPSE+QKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA      GP GY +D  GY+  MD+Q     R     GFHQ  P+
Sbjct:  336 TSASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVYTPHPGPSGYGHDAMGYM--MDSQAHMMHRPPGDPGFHQGYPH 476          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 83.5741 bits (205), Expect = 1.129e-16
Identity = 89/343 (25.95%), Postives = 147/343 (42.86%), Query Frame = 3
Query:  765 DDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIG---------------YYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKS-ISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWH-------YSGNFPRVTFCDL-EAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRL 1721
            D+ V R++Y+ T ++L  F  L+  RQY+G PI C I  E   G     + YCW+ +T+  ++  R+     R     G               YYQW   +L  Q++LFY+P  +W+  S + G    R+  +  D N  ++ ++ +      +  +    L RH   Y  + F+           C A             NF+ V+             GQ+Y ++ F+  +++ YG     D+++  E          +  FP+VT C   +    G    +   CVLP+N+  EKIY+FLWFW +I+ I +  SL   I  +  P  R  ++R   RL
Sbjct:   20 DNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDC-IVDEIPLG---VMDTYCWIYSTF--TVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK--SWEGG----RLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNLNRHNF-YAFRFFV-----------CEAL------------NFVNVI-------------GQIYFVDFFLDGEFSTYGS----DVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRL 309          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 83.5741 bits (205), Expect = 1.129e-16
Identity = 89/343 (25.95%), Postives = 147/343 (42.86%), Query Frame = 3
Query:  765 DDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIG---------------YYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKS-ISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWH-------YSGNFPRVTFCDL-EAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRL 1721
            D+ V R++Y+ T ++L  F  L+  RQY+G PI C I  E   G     + YCW+ +T+  ++  R+     R     G               YYQW   +L  Q++LFY+P  +W+  S + G    R+  +  D N  ++ ++ +      +  +    L RH   Y  + F+           C A             NF+ V+             GQ+Y ++ F+  +++ YG     D+++  E          +  FP+VT C   +    G    +   CVLP+N+  EKIY+FLWFW +I+ I +  SL   I  +  P  R  ++R   RL
Sbjct:   20 DNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDC-IVDEIPLG---VMDTYCWIYSTF--TVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK--SWEGG----RLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNLNRHNF-YAFRFFV-----------CEAL------------NFVNVI-------------GQIYFVDFFLDGEFSTYGS----DVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRL 309          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 83.5741 bits (205), Expect = 1.129e-16
Identity = 89/343 (25.95%), Postives = 147/343 (42.86%), Query Frame = 3
Query:  765 DDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIG---------------YYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKS-ISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWH-------YSGNFPRVTFCDL-EAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRL 1721
            D+ V R++Y+ T ++L  F  L+  RQY+G PI C I  E   G     + YCW+ +T+  ++  R+     R     G               YYQW   +L  Q++LFY+P  +W+  S + G    R+  +  D N  ++ ++ +      +  +    L RH   Y  + F+           C A             NF+ V+             GQ+Y ++ F+  +++ YG     D+++  E          +  FP+VT C   +    G    +   CVLP+N+  EKIY+FLWFW +I+ I +  SL   I  +  P  R  ++R   RL
Sbjct:   20 DNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDC-IVDEIPLG---VMDTYCWIYSTF--TVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK--SWEGG----RLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNLNRHNF-YAFRFFV-----------CEAL------------NFVNVI-------------GQIYFVDFFLDGEFSTYGS----DVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRL 309          
BLAST of Innexin vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 167.548 bits (423), Expect = 1.363e-44
Identity = 94/147 (63.95%), Postives = 106/147 (72.11%), Query Frame = 3
Query: 2037 PINPRDKECHNTSPSAHCVDISSNKTNMGGGSQV-DIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAG 2474
            P + RD +  +++PS      SS     G  SQ  D  S+ GDG++NS  S    DE   D+++ KRQKKRGIFPKVATNIMRAWLFQHL+HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA   G    P G
Sbjct:  216 PASWRDMDDAHSTPSVGTPGPSSG----GHASQSGDNSSELGDGLDNSLASPGTGDE---DDQDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTAYSPDG 355          
BLAST of Innexin vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 167.548 bits (423), Expect = 1.363e-44
Identity = 94/147 (63.95%), Postives = 106/147 (72.11%), Query Frame = 3
Query: 2037 PINPRDKECHNTSPSAHCVDISSNKTNMGGGSQV-DIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAG 2474
            P + RD +  +++PS      SS     G  SQ  D  S+ GDG++NS  S    DE   D+++ KRQKKRGIFPKVATNIMRAWLFQHL+HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA   G    P G
Sbjct:  216 PASWRDMDDAHSTPSVGTPGPSSG----GHASQSGDNSSELGDGLDNSLASPGTGDE---DDQDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTAYSPDG 355          
BLAST of Innexin vs. Ensembl Zebrafish
Match: meis3 (myeloid ecotropic viral integration site 3 [Source:ZFIN;Acc:ZDB-GENE-010406-2])

HSP 1 Score: 163.696 bits (413), Expect = 3.929e-43
Identity = 101/204 (49.51%), Postives = 122/204 (59.80%), Query Frame = 3
Query: 2088 CVDISSNKTNMGGG---SQVDIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAGYLP---YMDNQQLAYARATGFHQAIPNMDQLYNAAVP-----SHLSP--HPPIGCHYGL----PPSYHSTNS 2648
            CV   S   +   G     V+  SD+GDG++ S  S    +E D  +++ +  KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQL+QDTGLTILQVNNWFINARRRIVQPMIDQ+NR+G    P  P G       +D Q     R  G  Q +P++   Y  A+      SH  P  HP  G H  +    PP  H + +
Sbjct:  204 CVSTPSGTPSASCGLNSHSVENCSDAGDGLDGSVASPSTGEE-DESDRDRRNNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLSQDTGLTILQVNNWFINARRRIVQPMIDQTNRSG-QSAPYSPEGAALGGYGLDAQSHLGLRTAGL-QGLPSLPTDYPGALLPQPGYSHAGPSLHPYPGPHTAMLLHPPPHSHPSET 404          
BLAST of Innexin vs. Ensembl Zebrafish
Match: meis1b (Meis homeobox 1 b [Source:ZFIN;Acc:ZDB-GENE-020122-1])

HSP 1 Score: 160.999 bits (406), Expect = 9.160e-42
Identity = 91/140 (65.00%), Postives = 103/140 (73.57%), Query Frame = 3
Query: 2139 DIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDP-----AGYLPYMDNQQLAYARATGFHQAIP 2543
            D  S+ GDG++NS  S  +  + D  +K  KR KKRGIFPKVATNIMRAWLFQHL+HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA   G P +P      G++  MD QQ    R  G  Q++P
Sbjct:  240 DNSSEQGDGLDNSVAS-PSTGDDDDPDKEKKRNKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAPYNPDGQPMGGFV--MDGQQHMGIRPPGL-QSMP 375          
BLAST of Innexin vs. Ensembl Zebrafish
Match: meis1b (Meis homeobox 1 b [Source:ZFIN;Acc:ZDB-GENE-020122-1])

HSP 1 Score: 158.303 bits (399), Expect = 1.530e-41
Identity = 83/112 (74.11%), Postives = 91/112 (81.25%), Query Frame = 3
Query: 2139 DIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAG 2474
            D  S+ GDG++NS  S  +  + D  +K  KR KKRGIFPKVATNIMRAWLFQHL+HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA   G P +P G
Sbjct:  240 DNSSEQGDGLDNSVAS-PSTGDDDDPDKEKKRNKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAPYNPDG 350          
BLAST of Innexin vs. Ensembl Xenopus
Match: meis3 (Meis homeobox 3 [Source:NCBI gene;Acc:448474])

HSP 1 Score: 165.622 bits (418), Expect = 2.326e-43
Identity = 104/192 (54.17%), Postives = 112/192 (58.33%), Query Frame = 3
Query: 2094 DISSNKTNMGGGSQVDIISDSGDGIENSTCSGENMDELDIDEKNGKR---------QKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDP-----AGYLPYMDNQQLAYARATGFHQAIPNMDQLYNAAVPSHLSPHPPIGCHYGLPP 2627
            +  S  +   G S   + S SGD   NS+  G+ MD        G            KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR G  G P  P      GY+  MD QQ    R  GF Q IP     Y AA  +     PP G    +PP
Sbjct:  210 ETGSTHSGTPGPSSGGLASQSGD---NSSEQGDCMDNSVASPSTGDDDDLDRDKKRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGGAPYSPDGQNMGGYV--MDGQQHMGIRPPGF-QGIPGD---YTAAPSTMPMGFPPAGYTPAIPP 392          
BLAST of Innexin vs. Ensembl Xenopus
Match: meis3 (Meis homeobox 3 [Source:NCBI gene;Acc:448474])

HSP 1 Score: 165.236 bits (417), Expect = 2.499e-43
Identity = 104/192 (54.17%), Postives = 112/192 (58.33%), Query Frame = 3
Query: 2094 DISSNKTNMGGGSQVDIISDSGDGIENSTCSGENMDELDIDEKNGKR---------QKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDP-----AGYLPYMDNQQLAYARATGFHQAIPNMDQLYNAAVPSHLSPHPPIGCHYGLPP 2627
            +  S  +   G S   + S SGD   NS+  G+ MD        G            KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR G  G P  P      GY+  MD QQ    R  GF Q IP     Y AA  +     PP G    +PP
Sbjct:  200 ETGSTHSGTPGPSSGGLASQSGD---NSSEQGDCMDNSVASPSTGDDDDLDRDKKRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGGAPYSPDGQNMGGYV--MDGQQHMGIRPPGF-QGIPGD---YTAAPSTMPMGFPPAGYTPAIPP 382          
BLAST of Innexin vs. Ensembl Xenopus
Match: meis3 (Meis homeobox 3 [Source:NCBI gene;Acc:448474])

HSP 1 Score: 165.622 bits (418), Expect = 2.618e-43
Identity = 104/192 (54.17%), Postives = 112/192 (58.33%), Query Frame = 3
Query: 2094 DISSNKTNMGGGSQVDIISDSGDGIENSTCSGENMDELDIDEKNGKR---------QKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDP-----AGYLPYMDNQQLAYARATGFHQAIPNMDQLYNAAVPSHLSPHPPIGCHYGLPP 2627
            +  S  +   G S   + S SGD   NS+  G+ MD        G            KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR G  G P  P      GY+  MD QQ    R  GF Q IP     Y AA  +     PP G    +PP
Sbjct:  215 ETGSTHSGTPGPSSGGLASQSGD---NSSEQGDCMDNSVASPSTGDDDDLDRDKKRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGGAPYSPDGQNMGGYV--MDGQQHMGIRPPGF-QGIPGD---YTAAPSTMPMGFPPAGYTPAIPP 397          
BLAST of Innexin vs. Ensembl Xenopus
Match: meis3 (Meis homeobox 3 [Source:NCBI gene;Acc:448474])

HSP 1 Score: 165.236 bits (417), Expect = 4.195e-43
Identity = 104/192 (54.17%), Postives = 112/192 (58.33%), Query Frame = 3
Query: 2094 DISSNKTNMGGGSQVDIISDSGDGIENSTCSGENMDELDIDEKNGKR---------QKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDP-----AGYLPYMDNQQLAYARATGFHQAIPNMDQLYNAAVPSHLSPHPPIGCHYGLPP 2627
            +  S  +   G S   + S SGD   NS+  G+ MD        G            KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR G  G P  P      GY+  MD QQ    R  GF Q IP     Y AA  +     PP G    +PP
Sbjct:  215 ETGSTHSGTPGPSSGGLASQSGD---NSSEQGDCMDNSVASPSTGDDDDLDRDKKRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGGAPYSPDGQNMGGYV--MDGQQHMGIRPPGF-QGIPGD---YTAAPSTMPMGFPPAGYTPAIPP 397          
BLAST of Innexin vs. Ensembl Xenopus
Match: meis3 (Meis homeobox 3 [Source:NCBI gene;Acc:448474])

HSP 1 Score: 165.236 bits (417), Expect = 4.475e-43
Identity = 104/192 (54.17%), Postives = 112/192 (58.33%), Query Frame = 3
Query: 2094 DISSNKTNMGGGSQVDIISDSGDGIENSTCSGENMDELDIDEKNGKR---------QKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDP-----AGYLPYMDNQQLAYARATGFHQAIPNMDQLYNAAVPSHLSPHPPIGCHYGLPP 2627
            +  S  +   G S   + S SGD   NS+  G+ MD        G            KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR G  G P  P      GY+  MD QQ    R  GF Q IP     Y AA  +     PP G    +PP
Sbjct:  232 ETGSTHSGTPGPSSGGLASQSGD---NSSEQGDCMDNSVASPSTGDDDDLDRDKKRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGGAPYSPDGQNMGGYV--MDGQQHMGIRPPGF-QGIPGD---YTAAPSTMPMGFPPAGYTPAIPP 414          
BLAST of Innexin vs. Ensembl Mouse
Match: Meis3 (Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519])

HSP 1 Score: 161.77 bits (408), Expect = 6.713e-43
Identity = 85/117 (72.65%), Postives = 91/117 (77.78%), Query Frame = 3
Query: 2139 DIISDSGDGIENSTCS----GENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAG------PHGYP 2459
            D  SD GDG++ S  S    GE+ D LD++ +   R KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR G      P G P
Sbjct:  217 DNSSDQGDGLDTSVASPSSAGEDED-LDLERR---RNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQP 329          
BLAST of Innexin vs. Ensembl Mouse
Match: Meis3 (Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519])

HSP 1 Score: 160.999 bits (406), Expect = 1.665e-42
Identity = 85/117 (72.65%), Postives = 91/117 (77.78%), Query Frame = 3
Query: 2139 DIISDSGDGIENSTCS----GENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAG------PHGYP 2459
            D  SD GDG++ S  S    GE+ D LD++ +   R KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR G      P G P
Sbjct:  234 DNSSDQGDGLDTSVASPSSAGEDED-LDLERR---RNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQP 346          
BLAST of Innexin vs. Ensembl Mouse
Match: Meis1 (Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717])

HSP 1 Score: 154.451 bits (389), Expect = 3.632e-40
Identity = 90/132 (68.18%), Postives = 99/132 (75.00%), Query Frame = 3
Query: 2139 DIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAGYLP---YMDNQQLAYARATG 2525
            D  S+ GDG++NS  S  +  + D  +K+ KR KKRGIFPKVATNIMRAWLFQHL+HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA   G P +P G       MD QQ    RA G
Sbjct:  242 DNSSEQGDGLDNSVAS-PSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPG 372          
BLAST of Innexin vs. Ensembl Mouse
Match: Meis1 (Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717])

HSP 1 Score: 155.992 bits (393), Expect = 4.973e-40
Identity = 92/140 (65.71%), Postives = 105/140 (75.00%), Query Frame = 3
Query: 2139 DIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDP-----AGYLPYMDNQQLAYARATGFHQAIP 2543
            D  S+ GDG++NS  S  +  + D  +K+ KR KKRGIFPKVATNIMRAWLFQHL+HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA   G P +P      G++  MD QQ    RA G  Q++P
Sbjct:  242 DNSSEQGDGLDNSVAS-PSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFV--MDGQQHMGIRAPGL-QSMP 377          
BLAST of Innexin vs. Ensembl Mouse
Match: Meis2 (Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564])

HSP 1 Score: 154.451 bits (389), Expect = 1.564e-39
Identity = 100/198 (50.51%), Postives = 116/198 (58.59%), Query Frame = 3
Query: 2043 NPRDKECHNTSPSAHCVDISSNKTNMGGGSQVDIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAGYLP---YMDNQQLAYARATGFHQAIP----------NMDQLYNAAVPSHLSPHP 2597
            NP     H+ + S H        +        D  S+ GDG++NS  S     + D  +K+ KRQKKRGIFPKVATNIMRAWLFQHL+HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA   G    P G       +D QQ    R  G  Q++P           M     +  P  ++PHP
Sbjct:  214 NPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVAS-PGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGL-QSMPGDYVSQGGPMGMGMAQPSYTPPQMTPHP 409          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 5.653e-80
Identity = 157/381 (41.21%), Postives = 235/381 (61.68%), Query Frame = 3
Query:  738 IGSNKLRFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKE-QMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLY-RHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIY 1874
            + S +   DDD +D+LNY +T  ++ +F  L+  +QYVG PIQCW+P  FT   E+YTENYCWV NTYF  + + +P   A +E + IGYYQW P +L L++LLFY+P ++WR +S QSG +V+ ++Q+A D+   L  E   +++  IA +++  L+ +H++          +G R      L  L  I C  +  G  +T LYIS+KILY +NI+GQ++L+  F+G +  +YG++VL DLM G EW  SG+FPRVT CD E K LG  H +++QCVL +NMF EKI++FLWFW+ ++  ATL SLF WI     P  ++  +  YL  +      D    R+F   +LR DG FL++++A + G+L   +L   +W  Y
Sbjct:   12 VKSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRL-LDLESRNRALQTIATNVEEALHVKHQV---------MSGNR------LKLLNLIIC-TRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 1.399e-76
Identity = 153/380 (40.26%), Postives = 227/380 (59.74%), Query Frame = 3
Query:  756 RFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKD-ARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSP-QSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISR-CLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPS------RKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQ 1868
            R DDDFVD+LNY +T  +L  F  L+  +QYVG PIQCW+P  FT   E+YTENYCWV NTY+  +Q  +P +  +R+ + IGYYQW P +L +++LLFY+PC++WR +    SG N++ ++Q+A DA   +  E   +++  +ARHM                  TN  R   SR C + L+     G+  G ++T+LYI IK+LY  N++ Q +L+   +G+    YG  +L DLM   EW  +G FPRVT CD E + LG  H +++QCVL +NMF EKI++FLWFW +  GI T+ +   WI  +  P   +  +R YLR   +L D    P       RKF  ++LR DG F++++I+ + G+L++ +LI  +WQ
Sbjct:  136 RLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARL-MDSEIKTRTVYTMARHM------------QDEVQLTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLR---VLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 499          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q27295|EAT5_CAEEL (Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN=eat-5 PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.127e-62
Identity = 132/398 (33.17%), Postives = 222/398 (55.78%), Query Frame = 3
Query:  720 LSKLGRIGSN-KLRFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMP-SKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPS-----RKFAESYLRSDGCF---------LIQLIAINIGDLVAGDLICEMW 1865
            ++ LG + S  K R DD   DRLNY ++ L++      I  RQYVG P+QCW+P +FT+ WE+Y E+YC+V NTY+    +++P + + R  Q + YYQWAP ++ +++  FY+P + W  +S +SG N+ ++++ A  A  +   E+ +K I  I RH+   L + R           N + +T    +AK++ I   G   G ++T +Y+  K++Y+ N   Q Y   KF+G    ++G+R+L D+++G +W +SGNFPR+  CD + + LG    YS+QCVL +NMF EKI++FL+ W ++V   TLF        + S    ++ ++ +L   +   + +K P      RK   S L S+ C          L+++I  + GD+V  +++  MW
Sbjct:    1 MNMLGSMFSMVKPRLDDLGTDRLNYYYSTLIIMGMSLTITARQYVGSPLQCWVPAQFTKAWEQYAEDYCFVYNTYWVKPNDKVPLTVEERVSQQLIYYQWAPFIMAIEAAFFYLPVIFWSMLSTKSGINIIKLVETAQKAEGAE-SEERKKQIDIICRHISNNLRKRR-----------NEEETT---KMAKIQRI--FGMQHGKYITNVYLVTKLIYMTNSFLQFYSTNKFLGQNDPYWGMRILDDILKGTDWEHSGNFPRIAMCDFQVRVLGNLQRYSIQCVLTLNMFNEKIFLFLYIWFLLVFFVTLFDSIFLCYNMFSSHKLVEFLQQFLDNQDQDENDEKKPEERKVYRKEQHSILLSEFCLHKFTPDIIILLKMINNHTGDIVCTEIVGRMW 381          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|A8WVX4|INX19_CAEBR (Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=inx-19 PE=3 SV=3)

HSP 1 Score: 205.682 bits (522), Expect = 1.828e-56
Identity = 131/414 (31.64%), Postives = 219/414 (52.90%), Query Frame = 3
Query:  738 IGSNKLRFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSK-DARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGK---RSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFI-GTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNI-----LHDTDKGPSRK---------------FAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEE 1904
            I +  +R DDD VDRLNY +T L+L +   +I  +QY G PI+CW+        EEY E+YCW+ NTY+  +   +P    AR+E+ IGYYQW P +L  ++L+F +PC+ WR  S QSG N++ ++  A DA   L     QK++  I     TC +      ++      NG+   R  I+R       I     L G  ++++Y   K+LY +N++ Q +++   +  +++ F+G +VL D+  G  W  +G+FPRVT CD E + L   + Y++QC L +N+  EK++ FLW W++I+ I T  S   WI        ++  +  ++++        L   +K  + +               F   +L+SDG  ++++I+ + GD++   L+  +WQ YR +  +EFEE
Sbjct:   12 ISALSVRGDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREEKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAI-----TCNF-----VDNLDLQSPNGRIRARGWIAR-------IKFSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRERNWREFEE 408          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 202.986 bits (515), Expect = 7.556e-56
Identity = 134/370 (36.22%), Postives = 197/370 (53.24%), Query Frame = 3
Query:  765 DDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSK-DARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVAS---DANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLR-LMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICE 1859
            DD VDRL+Y  T  LL  F  ++  +QYVG  IQCW+P EF  GWE+Y E+YC++ NT+F   ++ +P   + R++  IGYYQW PI+L +Q+ +FY+P  IW ++  Q G +   ++  A      +     + + K + FI   +DT   R +  Y   +  R                     GK  G+  ++LYI IK++YL N+  Q  ++ KF+G +   +G     DL  G EW  SG FPRVT CD   +KL   H Y++QCVL +NMF EKIY+F+WFW V V I T  +    I R+    +R   IR+ L   +N   D +K     FA + L+ DG  L++ I  + G +V  + ICE
Sbjct:   21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGGWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSLYKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDT---RSKNEYGRFYCYR--------------------FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKD-EKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKE-ICE 365          
BLAST of Innexin vs. TrEMBL
Match: Q2L6N1 (Innexin OS=Dugesia japonica OX=6161 GN=inx3 PE=2 SV=1)

HSP 1 Score: 896.73 bits (2316), Expect = 0.000e+0
Identity = 460/473 (97.25%), Postives = 465/473 (98.31%), Query Frame = 3
Query:  582 MSRGQIRDILSAGEVRRPSFSHIVQSGSPVPGGDCGGDMDATFFWRLSKLGRIGSNKLRFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVESRLPSLMLNNTSNLNDYDKSGAT 2000
            MSRGQIRDILSAGEVRRPSFSHIVQSGSPVPGGDC GDMDATFFWRLSKLGRIGSNKLRFDDDFVDRLNYQFTGLLLFMFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKD R EQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMR+NGKRS  SRCLAKLRCICCLGKLQGNFLTVLYISIK LYLINIIGQLYLMEKFIGTKY FYGIRVLWDLMRGHEWH+SGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATL SLFSWI+RIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVESRLPSLMLNNTSNLNDYDK+GA+
Sbjct:    1 MSRGQIRDILSAGEVRRPSFSHIVQSGSPVPGGDCSGDMDATFFWRLSKLGRIGSNKLRFDDDFVDRLNYQFTGLLLFMFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDTRNEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRSNGKRSKFSRCLAKLRCICCLGKLQGNFLTVLYISIKFLYLINIIGQLYLMEKFIGTKYTFYGIRVLWDLMRGHEWHHSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLCSLFSWIRRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVESRLPSLMLNNTSNLNDYDKNGAS 473          
BLAST of Innexin vs. TrEMBL
Match: A0A1I8GCN3 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 499.59 bits (1285), Expect = 8.768e-165
Identity = 259/409 (63.33%), Postives = 323/409 (78.97%), Query Frame = 3
Query:  696 MDATFFWRLSKLGRIGSNKLRFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASI-QNRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTS 1919
            MDATF W+LSKLGRIGS+KLRFDDDF DRLNYQFTG++LF+FIGLIGIRQYVGKPIQCWIPQEFTRGWEEY ENYCWV+NTY+AS+ +  +P++  R+++MI YYQWAPI+L +Q+L+FY+PCLIWR     SGFNVR+ILQ+A+DAN  +IPE L K+I F+AR+M+ C+YR R       + R  G R  +  CLAK  C+CC GK  GNFL VLY  IK+LYL+N+ GQLY+MEKF+GT Y F+G +VL DL  G +W+ S NFPRVTFCDL+AKKLG N+ Y+LQCVLP+NMFLEKIY+FLWFWHV+V I TL S  +W  R+     R+  +R YL++MN+L DTDK  SRKF E+YLR DG F+ +LIA+N GD+VAGDL CE+W IYRHKR+QE ++ K  +
Sbjct:    1 MDATFMWKLSKLGRIGSSKLRFDDDFADRLNYQFTGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASVPEEHLPAEHLRRKRMITYYQWAPIVLAVQALMFYLPCLIWRLFMNYSGFNVRKILQMATDANV-VIPEALNKNIRFMARYMEGCIYRQR------EYRRGVGVR--VKHCLAKCSCLCC-GKRYGNFLVVLYFFIKVLYLLNVFGQLYIMEKFVGTTYTFFGFQVLRDLFNGIQWYQSSNFPRVTFCDLQAKKLGVNYHYTLQCVLPLNMFLEKIYVFLWFWHVLVSIVTLGSFVNWFFRMAFARRRLIFVRKYLKIMNVLKDTDKTTSRKFVENYLRIDGVFIFRLIAMNCGDIVAGDLACELWSIYRHKRLQELDDTKLET 399          
BLAST of Innexin vs. TrEMBL
Match: A0A267EEW5 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 484.182 bits (1245), Expect = 9.829e-159
Identity = 260/431 (60.32%), Postives = 324/431 (75.17%), Query Frame = 3
Query:  696 MDATFFWRLSKLGRIGSNKLRFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQ-NRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVESRLPSLMLNNTSNLNDYD 1985
            MDATF W+LSKLGRIGS+KLRFDDDF DRLNYQFTG++LF+FIGLIGIRQYVGKPIQCWIPQEFTRGWEEY ENYCWV+NTY+AS+Q + +P +  R E MI YYQWAPI+L +Q+L+FY+PCLIWR     SGFN+R+ILQ+A+DAN  +IPE L K++ F+AR+M+ C+YR R       + R  G R    +         C GK  GNFL VLY  IK+LYL+N+ GQLY+MEKFIGT Y F+G RVL D++ G +W+ S NFPRVTFCDL+AKK G+N+ Y+LQCVLP+NMFLEKIY+FLWFWHV+V I TL S  +W  R+     R+  IR YL++MN+L DTDK  SRKF E+YLR DG F+ +LIA+N GD+VAGDL CE+W IYRHKR+QE ++   T L  + R  +    N +N N+ D
Sbjct:    1 MDATFMWKLSKLGRIGSSKLRFDDDFADRLNYQFTGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASVQADHLPPQHIRNELMITYYQWAPIVLAVQALMFYLPCLIWRLFMNYSGFNLRKILQMATDANV-VIPEALNKNVRFMARYMEGCIYRQR------EYRRGVGVRL---KHCLSKCSCLCCGKRYGNFLVVLYFFIKVLYLLNVFGQLYIMEKFIGTTYTFFGFRVLLDIVHGIKWYQSSNFPRVTFCDLQAKKEGQNYHYTLQCVLPLNMFLEKIYVFLWFWHVLVSIVTLTSFVNWFFRMAFARRRLNFIRKYLKIMNVLKDTDKTTSRKFVENYLRVDGVFIFRLIAMNCGDIVAGDLACELWSIYRHKRLQELDD---TKLEPDHRHTAFAGMNATNGNNGD 418          
BLAST of Innexin vs. TrEMBL
Match: A0A1I8GJJ5 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 479.945 bits (1234), Expect = 2.057e-155
Identity = 248/409 (60.64%), Postives = 316/409 (77.26%), Query Frame = 3
Query:  696 MDATFFWRLSKLGRIGSNKLRFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQ-NRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTS 1919
            MDATF W+LSKLGRIGS++ R DDDF DRLNYQF+G++LF+FIGLIGIRQYVGKPIQCWIPQEFTRGWEEY ENYCWV+NTY+AS++ + +P + +R    I YYQWAPI+L +Q+L+FYIPCLIWR     SGFNVRR+LQ+A+DAN  +IPE L K++ F+AR+M+ C+YR R   E+K   R  G R  + RCL+   CICC GK  GNFL VLY  +K+LYL+N  GQLYLMEKF+GT + F+G RVL D+++G  W+ S NFPRVTFCDL+A+K+G N+ Y+LQCVLP+NMFLEKIY+FLWFW  +V + T+ S  SW  R+     R   +R YL++MN L DTD+  SRKF E+YLR DG F+++L++ N GD+VAGDL CE+W IYRHKR+QE E+ K  +
Sbjct:   91 MDATFMWKLSKLGRIGSSRQRVDDDFADRLNYQFSGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASLEADHLPEEQSRSRLTITYYQWAPIVLAVQALMFYIPCLIWRLFMNYSGFNVRRLLQMAADANV-VIPEALNKNVRFMARYMEGCIYRQR---EYK---RGLGVR--VRRCLSACSCICC-GKRHGNFLVVLYFFVKLLYLLNAFGQLYLMEKFVGTTHTFFGFRVLLDILQGVHWYRSSNFPRVTFCDLQARKIGVNYRYTLQCVLPLNMFLEKIYVFLWFWVALVSVITMSSFVSWFCRMAFARRRTGFVRKYLKIMNALKDTDRLTSRKFVENYLRVDGVFILRLVSANCGDIVAGDLACELWSIYRHKRLQELEDTKLDA 489          

HSP 2 Score: 80.1073 bits (196), Expect = 1.193e-11
Identity = 34/81 (41.98%), Postives = 54/81 (66.67%), Query Frame = 3
Query: 1566 LPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQ 1808
            LP+N F+EK+Y+FLWFW++I+G+ TL S   W+ RI  P  R+  I+ YLR M ++ +T+    ++F  + L  DG F++Q
Sbjct:    7 LPINHFVEKVYVFLWFWYIILGVLTLLSTIIWMLRILIPGGRVAYIKQYLRAMKLISNTEDRDCKRFVANSLGPDGGFILQ 87          
BLAST of Innexin vs. TrEMBL
Match: A0A1I8GHL0 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 489.189 bits (1258), Expect = 2.987e-153
Identity = 264/440 (60.00%), Postives = 329/440 (74.77%), Query Frame = 3
Query:  669 VPGGDCGGDMDATFFWRLSKLGRIGSNKLRFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQ-NRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVESRLPSLMLNNTSNLNDYD 1985
            V GG  G +MDATF W+LSKLGRIGS+KLRFDDDF DRLNYQFTG++LF+FIGLIGIRQYVGKPIQCWIPQEFTRGWEEY ENYCWV+NTY+AS+Q + +P +  R E MI YYQWAPI+L +Q+L+FY+PCLIWR     SGFN+R+ILQ+A+DAN  +IPE L K++ F+AR+M+ C+YR R       + R  G R    +         C GK  GNFL VLY  IK+LYL+N+ GQLY+MEKFIGT Y F+G RVL D++ G +W+ S NFPRVTFCDL+AKK G+N+ Y+LQCVLP+NMFLEKIY+FLWFWHV+V I TL S  +W  R+     R+  IR YL++MN+L DTDK  SRKF E+YLR DG F+ +LIA+N GD+VAGDL CE+W IYRHKR+QE ++   T L  + R  +    N +N N+ D
Sbjct:  559 VQGGH-GSEMDATFMWKLSKLGRIGSSKLRFDDDFADRLNYQFTGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASVQADHLPPQHIRNELMITYYQWAPIVLAVQALMFYLPCLIWRLFMNYSGFNLRKILQMATDANV-VIPEALNKNVRFMARYMEGCIYRQR------EYRRGVGVRL---KHCLSKCSCLCCGKRYGNFLVVLYFFIKVLYLLNVFGQLYIMEKFIGTTYTFFGFRVLLDIVHGIKWYQSSNFPRVTFCDLQAKKEGQNYHYTLQCVLPLNMFLEKIYVFLWFWHVLVSIVTLTSFVNWFFRMAFARRRLNFIRKYLKIMNVLKDTDKTTSRKFVENYLRVDGVFIFRLIAMNCGDIVAGDLACELWSIYRHKRLQELDD---TKLEPDHRHTAFAGMNATNGNNGD 984          

HSP 2 Score: 139.813 bits (351), Expect = 7.284e-30
Identity = 86/229 (37.55%), Postives = 130/229 (56.77%), Query Frame = 3
Query:  855 KPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQM--IGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLG 1535
            KPIQCW+PQEF++ WE++ ENYCWVSNTYF   +  +P K  + +QM  I YYQW  I+L  Q+++ +IP L+WR          RR+  +  +A  + IP+      + + R    CL         +     + + S +   + K   +CCL       LT+L++ ++IL++ N IGQ+YLM +F+GT   F+G  VL  L  G EW  +G+FPRVT+C L  +K+G
Sbjct:    1 KPIQCWVPQEFSKAWEDFAENYCWVSNTYFLMPEQDIPVKTEQLKQMTFITYYQWVAIVLAGQAIITWIPHLLWR-------VGARRLPVLIKNARGASIPD------TDLRRKAVQCL-----VAALEEQAEASRRYSRMKNVVEKF--LCCLSPSMR--LTMLFLIVRILFIGNSIGQIYLMRQFLGTNDTFFGYEVLKSLTLGREWRETGHFPRVTYCHLVVRKVG 207          

HSP 3 Score: 105.531 bits (262), Expect = 3.609e-19
Identity = 46/119 (38.66%), Postives = 74/119 (62.18%), Query Frame = 3
Query: 1548 YSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEE 1904
            + LQCVLP+N F+EK+Y+FLWFW +I+G+ T  S   W+ +   P  R+  I+ YL+ M IL +T++    +F    L +DG F++Q+++    DL+A D+   +W+ YR  +I   EE
Sbjct:  390 FDLQCVLPINHFVEKVYVFLWFWFIILGVLTFASTLLWVFKTLIPYRRVAFIKQYLKAMRILSNTEERDCNRFVNINLGADGVFILQVVSNLASDLIALDVASTLWKNYRQAKITGTEE 508          
BLAST of Innexin vs. Ensembl Cavefish
Match: meis2a (homeobox protein Meis1-like [Source:NCBI gene;Acc:103032373])

HSP 1 Score: 166.777 bits (421), Expect = 1.333e-44
Identity = 94/146 (64.38%), Postives = 104/146 (71.23%), Query Frame = 3
Query: 2037 PINPRDKECHNTSPSAHCVDISSNKTNMGGGSQVDIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAG 2474
            P + RD +  +++PS      SS       G   D  S+ GDG+EN+  S    DE D D+K   RQKKRGIFPKVATNIMRAWLFQHL+HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA   G P  P G
Sbjct:  204 PASWRDLDDAHSTPSVGTPGPSSGGLASQSG---DNSSELGDGLENNLAS-PGTDEDDPDKK---RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYSPDG 342          
BLAST of Innexin vs. Ensembl Cavefish
Match: meis3 (homeobox protein meis3 [Source:NCBI gene;Acc:103039420])

HSP 1 Score: 164.081 bits (414), Expect = 2.530e-43
Identity = 87/144 (60.42%), Postives = 101/144 (70.14%), Query Frame = 3
Query: 2148 SDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAGYL--PYMDNQQLAYARATGFHQAIPNMDQLYNAAV 2573
            SD+GDG++ +  S    +E D  +++ +  KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR+G  G P  P G     Y    Q      T   Q +P++   Y  A+
Sbjct:  227 SDAGDGLDGAVASPSTGEE-DESDRDRRSNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRSG-QGAPYSPEGATLGGYGLEGQAHLGLRTAGLQGMPSLSADYPGAL 368          
BLAST of Innexin vs. Ensembl Cavefish
Match: meis3 (homeobox protein meis3 [Source:NCBI gene;Acc:103039420])

HSP 1 Score: 164.081 bits (414), Expect = 2.530e-43
Identity = 87/144 (60.42%), Postives = 101/144 (70.14%), Query Frame = 3
Query: 2148 SDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAGYL--PYMDNQQLAYARATGFHQAIPNMDQLYNAAV 2573
            SD+GDG++ +  S    +E D  +++ +  KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR+G  G P  P G     Y    Q      T   Q +P++   Y  A+
Sbjct:  227 SDAGDGLDGAVASPSTGEE-DESDRDRRSNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRSG-QGAPYSPEGATLGGYGLEGQAHLGLRTAGLQGMPSLSADYPGAL 368          
BLAST of Innexin vs. Ensembl Cavefish
Match: meis1b (Meis homeobox 1 [Source:NCBI gene;Acc:103042376])

HSP 1 Score: 158.303 bits (399), Expect = 1.321e-41
Identity = 83/112 (74.11%), Postives = 91/112 (81.25%), Query Frame = 3
Query: 2139 DIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAG 2474
            D  S+ GDG++NS  S  +  + D  +K  KR KKRGIFPKVATNIMRAWLFQHL+HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA   G P +P G
Sbjct:  240 DNSSEQGDGLDNSVAS-PSTGDDDDPDKEKKRNKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAPYNPDG 350          
BLAST of Innexin vs. Ensembl Cavefish
Match: meis1b (Meis homeobox 1 [Source:NCBI gene;Acc:103042376])

HSP 1 Score: 160.229 bits (404), Expect = 1.754e-41
Identity = 91/141 (64.54%), Postives = 102/141 (72.34%), Query Frame = 3
Query: 2139 DIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDP-----AGYLPYMDNQQLAYARATGFHQAIPN 2546
            D  S+ GDG++NS  S  +  + D  +K  KR KKRGIFPKVATNIMRAWLFQHL+HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA   G P +P      G++  MD QQ    R  G  Q +P 
Sbjct:  259 DNSSEQGDGLDNSVAS-PSTGDDDDPDKEKKRNKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAPYNPDGQPMGGFV--MDGQQHMGIRPPGL-QGMPG 395          
BLAST of Innexin vs. Ensembl Sea Lamprey
Match: pknox2 (pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-031118-112])

HSP 1 Score: 114.005 bits (284), Expect = 2.343e-27
Identity = 50/84 (59.52%), Postives = 66/84 (78.57%), Query Frame = 3
Query: 2184 SGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSN 2435
            SG ++   D D+K  +   KRG+ PK AT +MR+WLFQH+ HPYP+E++K+Q+A  T LT+LQVNNWFINARRRI+QPM+D SN
Sbjct:  244 SGVDISACDPDDKRARL--KRGVLPKHATTVMRSWLFQHIVHPYPTEDEKRQIANQTNLTLLQVNNWFINARRRILQPMLDASN 325          
BLAST of Innexin vs. Ensembl Sea Lamprey
Match: pknox2 (pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-031118-112])

HSP 1 Score: 85.5001 bits (210), Expect = 3.008e-18
Identity = 36/62 (58.06%), Postives = 49/62 (79.03%), Query Frame = 3
Query: 2202 ELDIDEKNGKRQK-KRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNW 2384
            E D+ E + ++ K KRG+ PK AT IMR+WLFQH+ HPYP+E++K+Q+A  T LT+LQVNNW
Sbjct:  241 ECDLSESDDRKMKSKRGVLPKHATGIMRSWLFQHIVHPYPTEDEKRQIAAQTNLTLLQVNNW 302          
BLAST of Innexin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002620.1 (pep scaffold:Pmarinus_7.0:GL484724:8057:10194:-1 gene:ENSPMAG00000002391.1 transcript:ENSPMAT00000002620.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 4.093e-9
Identity = 23/50 (46.00%), Postives = 35/50 (70.00%), Query Frame = 3
Query: 2265 ATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQ 2414
            AT  ++AWL +H  +PYP++ +K  LA  T +T+ QV+ WF NARRR+ +
Sbjct:   48 ATATLKAWLNEHRKNPYPTKGEKIMLAIITRMTLTQVSTWFANARRRLKK 97          
BLAST of Innexin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011157.1 (pep scaffold:Pmarinus_7.0:GL488016:7246:7434:-1 gene:ENSPMAG00000010130.1 transcript:ENSPMAT00000011157.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 3.486e-8
Identity = 24/55 (43.64%), Postives = 34/55 (61.82%), Query Frame = 3
Query: 2235 QKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINAR 2399
            ++K   F +   N++R W   +L  PYP+  +K++LAQ TGLT  QV NWF N R
Sbjct:   12 EQKTHCFKERTRNLLREW---YLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRR 63          
BLAST of Innexin vs. Ensembl Sea Lamprey
Match: mkxb (mohawk homeobox b [Source:ZFIN;Acc:ZDB-GENE-080513-2])

HSP 1 Score: 52.373 bits (124), Expect = 1.356e-7
Identity = 20/44 (45.45%), Postives = 34/44 (77.27%), Query Frame = 3
Query: 2277 MRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRI 2408
            ++ WL++H  +PYP++ +K  LA  + +T++QV+NWF NARRR+
Sbjct:   16 LKHWLYKHRHNPYPTKTEKILLALGSHMTLVQVSNWFANARRRL 59          
BLAST of Innexin vs. Ensembl Yeast
Match: TOS8 (Homeodomain-containing protein and putative transcription factor; found associated with chromatin; target of SBF transcription factor; induced during meiosis and under cell-damaging conditions; TOS8 has a paralog, CUP9, that arose from the whole genome duplication [Source:SGD;Acc:S000003064])

HSP 1 Score: 73.9442 bits (180), Expect = 1.011e-14
Identity = 34/82 (41.46%), Postives = 51/82 (62.20%), Query Frame = 3
Query: 2166 IENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIV 2411
            I  ++  G N +     EK  K   KR   PK   +I+  WL +H+++PYP+ ++K++L   TGLT LQ++NWFINARRR +
Sbjct:  173 ISTNSVRGSN-NGYSAKEKKHKAHGKRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRRKI 253          
BLAST of Innexin vs. Ensembl Yeast
Match: CUP9 (Homeodomain-containing transcriptional repressor; regulates expression of PTR2, which encodes a major peptide transporter; imported peptides activate ubiquitin-dependent proteolysis, resulting in degradation of Cup9p and de-repression of PTR2 transcription; CUP9 has a paralog, TOS8, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000006098])

HSP 1 Score: 69.707 bits (169), Expect = 3.786e-13
Identity = 29/71 (40.85%), Postives = 46/71 (64.79%), Query Frame = 3
Query: 2208 DIDEKNGKRQK---KRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIV 2411
            D  E   +R++   +R   PK    I+  WL  HL++PYP++++K++L   TGLT +Q++NWFIN RRR +
Sbjct:  151 DFVESKSRRKQNSGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRKI 221          
BLAST of Innexin vs. Ensembl Nematostella
Match: EDO36439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIN3])

HSP 1 Score: 147.517 bits (371), Expect = 4.028e-39
Identity = 70/101 (69.31%), Postives = 81/101 (80.20%), Query Frame = 3
Query: 2145 ISDSGDGIENSTCSGENMDELDIDEKNGKR-QKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAG 2444
            ++  G  +  S  S +   E   D++ GK+ QKKRGIFPK ATNIM+AWLFQHL+HPYPSEEQK+ LAQ+TGLTILQVNNWFINARRRIVQPMID SNRAG
Sbjct:  208 VTPEGQSLNASIGSDDGGSETADDDQGGKKSQKKRGIFPKAATNIMKAWLFQHLTHPYPSEEQKRSLAQETGLTILQVNNWFINARRRIVQPMIDASNRAG 308          
BLAST of Innexin vs. Ensembl Nematostella
Match: EDO39375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC9])

HSP 1 Score: 109.383 bits (272), Expect = 2.793e-26
Identity = 45/73 (61.64%), Postives = 60/73 (82.19%), Query Frame = 3
Query: 2217 EKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSN 2435
            +++   + KRG+ PK AT+IM+ WLFQH+ HPYP+E++K+ +AQ T LTILQVNNWFINARRRI+QPM+D  N
Sbjct:  192 QQSATVKSKRGVLPKQATSIMKTWLFQHIMHPYPTEDEKRSIAQQTNLTILQVNNWFINARRRILQPMLDAGN 264          
BLAST of Innexin vs. Ensembl Nematostella
Match: EDO41178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S544])

HSP 1 Score: 75.0998 bits (183), Expect = 1.594e-16
Identity = 35/81 (43.21%), Postives = 53/81 (65.43%), Query Frame = 3
Query: 2235 QKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAGY 2477
            +++RG  PK + N++R WL++H  + YPSE +K+ L++   L++LQV NWFINARRRI+  MI +  R        DP+ Y
Sbjct:   17 KRRRGNLPKDSVNVLRLWLWEHRFNAYPSEAEKQYLSKAANLSVLQVCNWFINARRRILPDMIRREGR--------DPSNY 89          
BLAST of Innexin vs. Ensembl Nematostella
Match: EDO41982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2T4])

HSP 1 Score: 57.3806 bits (137), Expect = 1.603e-10
Identity = 23/47 (48.94%), Postives = 35/47 (74.47%), Query Frame = 3
Query: 2268 TNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRI 2408
            T+ ++AWLF+H  +PYP++ +K  LA  T +T+ QV+ WF NARRR+
Sbjct:   11 TSTLKAWLFEHRKNPYPTKGEKIMLAILTKMTLTQVSTWFANARRRL 57          
BLAST of Innexin vs. Ensembl Nematostella
Match: EDO43361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYQ8])

HSP 1 Score: 61.2326 bits (147), Expect = 6.001e-10
Identity = 26/57 (45.61%), Postives = 40/57 (70.18%), Query Frame = 3
Query: 2235 QKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 2405
            ++KR  F K AT I+  + + HLS+PYPSEE K++LA+   +++ Q++NWF N R R
Sbjct:  199 RRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELARKCNISVAQISNWFGNKRIR 255          
BLAST of Innexin vs. Ensembl Medaka
Match: meis2a (homeobox protein Meis1 [Source:NCBI gene;Acc:101171546])

HSP 1 Score: 172.94 bits (437), Expect = 6.975e-47
Identity = 96/146 (65.75%), Postives = 105/146 (71.92%), Query Frame = 3
Query: 2037 PINPRDKECHNTSPSAHCVDISSNKTNMGGGSQVDIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAG 2474
            P + RD +  +++PS      SS     G  SQ D  SD GDG++NS  S    DE   DE + KRQKKRGIFPKVATNIMRAWLFQHL+HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA   G    P G
Sbjct:  187 PASWRDMDDVHSAPSVGTPGPSSG----GHISQGDSTSDLGDGLDNSLASPGTGDE---DEHDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPDG 325          
BLAST of Innexin vs. Ensembl Medaka
Match: meis2a (homeobox protein Meis1 [Source:NCBI gene;Acc:101171546])

HSP 1 Score: 173.326 bits (438), Expect = 7.536e-47
Identity = 96/146 (65.75%), Postives = 105/146 (71.92%), Query Frame = 3
Query: 2037 PINPRDKECHNTSPSAHCVDISSNKTNMGGGSQVDIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAG 2474
            P + RD +  +++PS      SS     G  SQ D  SD GDG++NS  S    DE   DE + KRQKKRGIFPKVATNIMRAWLFQHL+HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA   G    P G
Sbjct:  202 PASWRDMDDVHSAPSVGTPGPSSG----GHISQGDSTSDLGDGLDNSLASPGTGDE---DEHDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPDG 340          
BLAST of Innexin vs. Ensembl Medaka
Match: meis3 (homeobox protein meis3-B [Source:NCBI gene;Acc:101154966])

HSP 1 Score: 167.162 bits (422), Expect = 4.264e-44
Identity = 99/169 (58.58%), Postives = 111/169 (65.68%), Query Frame = 3
Query: 2130 SQVDIISDSGDGIENSTCS---GENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAGYLP---YMDNQQLAYARATGFHQAIPNMDQLYNAAVPSHLS--PHPPIGCH 2612
            S  D  SD+GDG++    S   GE  DE D D +N    KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQL+QDTGLTILQVNNWFINARRRIVQPMIDQSNR+G  G P  P G       +D Q     R  G  Q + ++   Y AA+ S  +  PHP    H
Sbjct:  251 STADNCSDAGDGLDGGVASPSTGEE-DESDRDRRN---NKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLSQDTGLTILQVNNWFINARRRIVQPMIDQSNRSG-QGGPYSPEGAALGGYGLDGQAHLGLRTAGL-QGVSSLQSDYPAALLSQSAYPPHPGQSIH 413          
BLAST of Innexin vs. Ensembl Medaka
Match: meis1b (Meis homeobox 1 [Source:NCBI gene;Acc:101167316])

HSP 1 Score: 155.992 bits (393), Expect = 8.106e-41
Identity = 82/112 (73.21%), Postives = 90/112 (80.36%), Query Frame = 3
Query: 2139 DIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAG 2474
            D  S+ GDG++NS  S  +  + D  +K  K  KKRGIFPKVATNIMRAWLFQHL+HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA   G P +P G
Sbjct:  240 DNSSEQGDGLDNSVAS-PSTGDDDDPDKEKKHNKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAPYNPDG 350          
BLAST of Innexin vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 151.369 bits (381), Expect = 2.727e-39
Identity = 88/144 (61.11%), Postives = 98/144 (68.06%), Query Frame = 3
Query: 2043 NPRDKECHNTSPSAHCVDISSNKTNMGGGSQVDIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAG 2474
            NP     H+ + S H        +        D  S+ GDG++NS  S     + D  +K+ KRQKKRGIFPKVATNIMRAWLFQHL+HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRA   G    P G
Sbjct:  198 NPASWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVAS-PGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEG 340          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000060499.1 (SMESG000060499.1)

HSP 1 Score: 892.493 bits (2305), Expect = 0.000e+0
Identity = 472/473 (99.79%), Postives = 472/473 (99.79%), Query Frame = 3
Query:  582 MSRGQIRDILSAGEVRRPSFSHIVQSGSPVPGGDCGGDMDATFFWRLSKLGRIGSNKLRFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVESRLPSLMLNNTSNLNDYDKSGAT 2000
            MSRGQIRDILSAGEVRRPSFSHIVQSGSPVPGGDCGGDMD TFFWRLSKLGRIGSNKLRFDDDFVDRLNYQFTGLLLFMFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVLYISIKILYLINIIGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVESRLPSLMLNNTSNLNDYDKSGAT
Sbjct:    1 MSRGQIRDILSAGEVRRPSFSHIVQSGSPVPGGDCGGDMDGTFFWRLSKLGRIGSNKLRFDDDFVDRLNYQFTGLLLFMFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVLYISIKILYLINIIGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVESRLPSLMLNNTSNLNDYDKSGAT 473          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000078684.1 (SMESG000078684.1)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 293/293 (100.00%), Postives = 293/293 (100.00%), Query Frame = 3
Query: 2028 LPCPINPRDKECHNTSPSAHCVDISSNKTNMGGGSQVDIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAGYLPYMDNQQLAYARATGFHQAIPNMDQLYNAAVPSHLSPHPPIGCHYGLPPSYHSTNSSNGLFNTAGSPHTXXXXXXXXXXXXXXXXHPGYAAAVAMGYAPXXXXXXXXXXXXXXFTTTPSLFDSRTTLDSDFKSSSLQDIHAG 2906
            LPCPINPRDKECHNTSPSAHCVDISSNKTNMGGGSQVDIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAGYLPYMDNQQLAYARATGFHQAIPNMDQLYNAAVPSHLSPHPPIGCHYGLPPSYHSTNSSNGLFNTAGSPHTQSAVSQQAAMAAMMGSHPGYAAAVAMGYAPNLSHHSNHQSNVSSFTTTPSLFDSRTTLDSDFKSSSLQDIHAG
Sbjct:  406 LPCPINPRDKECHNTSPSAHCVDISSNKTNMGGGSQVDIISDSGDGIENSTCSGENMDELDIDEKNGKRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGPHGYPNDPAGYLPYMDNQQLAYARATGFHQAIPNMDQLYNAAVPSHLSPHPPIGCHYGLPPSYHSTNSSNGLFNTAGSPHTQSAVSQQAAMAAMMGSHPGYAAAVAMGYAPNLSHHSNHQSNVSSFTTTPSLFDSRTTLDSDFKSSSLQDIHAG 698          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000045304.1 (SMESG000045304.1)

HSP 1 Score: 453.751 bits (1166), Expect = 1.182e-149
Identity = 250/461 (54.23%), Postives = 326/461 (70.72%), Query Frame = 3
Query:  696 MDATFFWRLSKLGRIGSNKLRFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVAS--------DANCSLIP-EQLQKSISFIARHMDTCLYRHRI----CYEHKHFMRTNGKRSTI--------SRCLAKLRCI-CCLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVESRLPS-------LMLNNTSNLNDYDKS 1991
            MDATF W+L KLGR+GSN+LR+DDDFVDRLNYQFTG++LF+FIGL+ IRQY+GKPIQCWIPQEFTRGWEEY ENYCW++NTYFA+I+ + P K  RKE+MIGYYQWAPI + LQ+L+FY+PCLIWR ++ +SGFNVRR++Q+AS        + NC   P      +  F+ R++  C+ R ++      +  H  +     S +        SRC A   C   C G+  GN+L  LYI++K LYLINII QLY+ME FIG  Y+FYG+R+L DL++G  W+ SG+FPRVTFCDLEAKKLGKN+LY+LQCVLPMNMFLEKI+IFLWFWHV++GI    S+ SW ++I S   RIK IR  LR+  +L DTD   SR+F   YL+ D  F+++LI  NIG+++  DL  E+W IYRHKR+ E +++K T++ + S   S       L+ NNT + N  DKS
Sbjct:    1 MDATFVWKLGKLGRLGSNRLRYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQVRSRGLLKSGHSCKKGENESLLFPISNSCCSRCCANHGCFESCCGRRNGNYLISLYITVKFLYLINIIIQLYIMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIVNFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDIKNTTIMMRSSFESEMKSPRNLIGNNTLSNNTVDKS 461          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000048374.1 (SMESG000048374.1)

HSP 1 Score: 426.787 bits (1096), Expect = 7.544e-140
Identity = 227/446 (50.90%), Postives = 324/446 (72.65%), Query Frame = 3
Query:  696 MDATFFWRLSKLGRIGSNKLRFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYR-HRICYEHKHFMRTNGKRSTISRCLAKLRCIC----CLGKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNV-ESRLPSLMLN--NTS-----NLNDYDKSG 1994
            MDAT  W+++KLGR+GS+ LRFDDD+VDRLNYQ T  L F+FIG++G+R Y+GKPIQCW PQEF + WE+Y+EN+CWVSNT++A I N +P +  +  ++IGYYQW PI+L +Q+L+FYIPCLIWR +   SGFNVRRI+Q+A D N SL+P+   K+I FIAR++DTC+ R +R C  ++  +  +GK+    +     +C C    C     G FL  LY  +K+LY+IN++ Q+YLM++F+GT   F+G++VL DL+ G EW++SGNFPRVTFC+++ KKLG+N++Y+LQCVLP+NMFLEKIYIFLWF++VI+GI T  S  SW+ R+G   +R K IR YL+++N + +TD   + KF E+ LR DG F+I L+ IN+G +VAGDL  E+W IYRHK  Q+ + +++  ++   S +P + L+  NTS     N N+++KS 
Sbjct:    1 MDATLVWKIAKLGRVGSSHLRFDDDWVDRLNYQITCFLHFLFIGVLGLRSYIGKPIQCWAPQEFNKAWEDYSENFCWVSNTFYAPINNNLPLRMDKTSKLIGYYQWTPIVLAVQALMFYIPCLIWRLLMNYSGFNVRRIIQMAGDTN-SLVPDINSKNIKFIARYIDTCIDRNYRDCKRNQ--ISVDGKQLNYRK-----KCNCFSRHCCHTNHGRFLFFLYGIVKVLYVINVLLQMYLMKRFLGTDSNFFGVKVLVDLINGFEWNHSGNFPRVTFCEVQTKKLGENNIYNLQCVLPLNMFLEKIYIFLWFYYVILGIITTASFCSWLLRMGYVKSRWKFIRKYLKILNAMRETDNTATLKFTENNLRPDGVFIIYLVTINVGHIVAGDLTVELWNIYRHKSWQDNDNVRYLDMDCRRSVVPGVALHHYNTSRLDSVNTNNHEKSN 438          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000048827.1 (SMESG000048827.1)

HSP 1 Score: 417.157 bits (1071), Expect = 7.904e-136
Identity = 222/442 (50.23%), Postives = 302/442 (68.33%), Query Frame = 3
Query:  609 LSAGEVRRPSFSHIVQSGSPVPG-------GDCGGDMDATFFWRLSKLGRIGSNKLRFDDDFVDRLNYQXXXXXXXXXXXXXXXRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHR-ICYEHKHFMRTNGKRSTISRCLAKLRCICCL----GKLQGNFLTVXXXXXXXXXXXXXXGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEF 1898
            ++ GEVR  + +   Q G  +         G   GD+D  F W  +KLGR GS  LR DDD  DRLNY+ + LL+F FI LIG+RQYVGKPIQCWIPQEFTRGWEEY+ENYCW+++TYFA +  ++PSK  R++++IGYYQWAPI+L LQ  LFY+P LIW++ S  S +N+ +++ V  D     +  +  K+I F AR++D C+ R + +       ++T   +S    C     C+  L    G++ GNFL  LY  +KILY+ N+IGQLYLMEK  G+  +F+G+R+L DL+RG EW  SGNFPRVTFCD+E KKLGKN+LY++QCVLPMN+FLEKIY+FLWFWHVI+ I T  SLF W  RIG+   R+K IR YL+  N + DTDK  +RKF   YL+ DG FL+ ++A++ G++VA  ++ E+W IYRHK ++ +
Sbjct:    1 MAKGEVRNTNLNS--QRGGNIDNIFVSTGQGKSDGDLDCNFLWNFNKLGRWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKVDRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDT----LDTEASKTIVFAARYIDLCIQRQKKLKRSSTQCIKTACYKSF--SCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQFQNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWNIYRHKGVESY 434          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MEIS31.491e-4371.68Meis homeobox 3 [Source:HGNC Symbol;Acc:HGNC:29537... [more]
MEIS31.123e-4271.68Meis homeobox 3 [Source:HGNC Symbol;Acc:HGNC:29537... [more]
MEIS32.873e-4271.68Meis homeobox 3 [Source:HGNC Symbol;Acc:HGNC:29537... [more]
MEIS31.323e-4171.68Meis homeobox 3 [Source:HGNC Symbol;Acc:HGNC:29537... [more]
MEIS21.581e-4061.11Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-18.289e-8438.63Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-18.289e-8438.63Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-12.744e-8338.15Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-94.444e-8141.21Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
unc-74.167e-7840.26Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hth7.037e-4765.73gene:FBgn0001235 transcript:FBtr0082256[more]
hth8.058e-4765.73gene:FBgn0001235 transcript:FBtr0082255[more]
Inx21.129e-1625.95gene:FBgn0027108 transcript:FBtr0301860[more]
Inx21.129e-1625.95gene:FBgn0027108 transcript:FBtr0071005[more]
Inx21.129e-1625.95gene:FBgn0027108 transcript:FBtr0332314[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis2a1.363e-4463.95Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
meis2a1.363e-4463.95Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
meis33.929e-4349.51myeloid ecotropic viral integration site 3 [Source... [more]
meis1b9.160e-4265.00Meis homeobox 1 b [Source:ZFIN;Acc:ZDB-GENE-020122... [more]
meis1b1.530e-4174.11Meis homeobox 1 b [Source:ZFIN;Acc:ZDB-GENE-020122... [more]
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis32.326e-4354.17Meis homeobox 3 [Source:NCBI gene;Acc:448474][more]
meis32.499e-4354.17Meis homeobox 3 [Source:NCBI gene;Acc:448474][more]
meis32.618e-4354.17Meis homeobox 3 [Source:NCBI gene;Acc:448474][more]
meis34.195e-4354.17Meis homeobox 3 [Source:NCBI gene;Acc:448474][more]
meis34.475e-4354.17Meis homeobox 3 [Source:NCBI gene;Acc:448474][more]
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Meis36.713e-4372.65Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519][more]
Meis31.665e-4272.65Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519][more]
Meis13.632e-4068.18Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717][more]
Meis14.973e-4065.71Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717][more]
Meis21.564e-3950.51Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564][more]
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL5.653e-8041.21Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL1.399e-7640.26Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q27295|EAT5_CAEEL1.127e-6233.17Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|A8WVX4|INX19_CAEBR1.828e-5631.64Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=i... [more]
sp|Q19746|INX3_CAEEL7.556e-5636.22Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q2L6N10.000e+097.25Innexin OS=Dugesia japonica OX=6161 GN=inx3 PE=2 S... [more]
A0A1I8GCN38.768e-16563.33Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
A0A267EEW59.829e-15960.32Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
A0A1I8GJJ52.057e-15560.64Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
A0A1I8GHL02.987e-15360.00Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis2a1.333e-4464.38homeobox protein Meis1-like [Source:NCBI gene;Acc:... [more]
meis32.530e-4360.42homeobox protein meis3 [Source:NCBI gene;Acc:10303... [more]
meis32.530e-4360.42homeobox protein meis3 [Source:NCBI gene;Acc:10303... [more]
meis1b1.321e-4174.11Meis homeobox 1 [Source:NCBI gene;Acc:103042376][more]
meis1b1.754e-4164.54Meis homeobox 1 [Source:NCBI gene;Acc:103042376][more]
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pknox22.343e-2759.52pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
pknox23.008e-1858.06pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000002620.14.093e-946.00pep scaffold:Pmarinus_7.0:GL484724:8057:10194:-1 g... [more]
ENSPMAT00000011157.13.486e-843.64pep scaffold:Pmarinus_7.0:GL488016:7246:7434:-1 ge... [more]
mkxb1.356e-745.45mohawk homeobox b [Source:ZFIN;Acc:ZDB-GENE-080513... [more]
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
TOS81.011e-1441.46Homeodomain-containing protein and putative transc... [more]
CUP93.786e-1340.85Homeodomain-containing transcriptional repressor; ... [more]
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO364394.028e-3969.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393752.793e-2661.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411781.594e-1643.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419821.603e-1048.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433616.001e-1045.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis2a6.975e-4765.75homeobox protein Meis1 [Source:NCBI gene;Acc:10117... [more]
meis2a7.536e-4765.75homeobox protein Meis1 [Source:NCBI gene;Acc:10117... [more]
meis34.264e-4458.58homeobox protein meis3-B [Source:NCBI gene;Acc:101... [more]
meis1b8.106e-4173.21Meis homeobox 1 [Source:NCBI gene;Acc:101167316][more]
meis2a2.727e-3961.11Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060499.10.000e+099.79SMESG000060499.1[more]
SMESG000078684.10.000e+0100.00SMESG000078684.1[more]
SMESG000045304.11.182e-14954.23SMESG000045304.1[more]
SMESG000048374.17.544e-14050.90SMESG000048374.1[more]
SMESG000048827.17.904e-13650.23SMESG000048827.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025205 ID=SMED30025205|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=3011bp
GAATAACGCAAATGATAACATAATTTCCCTCCGTACAATGGCAGCGCGTA
TTGATCGAGTGAACAATGATTTTCTAATATTCTGTAATTTACACCTATTG
TTCACCAATGACACACCTCAGCGCACGGGCGTTGTGTTTGTGTGTATATC
GTGTTCATGTGTATGTCGAATTGTACATCAGCATTGGCTTCATTTCCAGC
AGTGGCGGCACACCGATGGAGACGACTCATACCGACGCAAACCGATGCAC
ACAAACACGAATGGAGTGGCTCGTGCAGTATGTCATTCTCAGTTAGTCGA
TACTCCATTGATTCATAAACAGTGGCTAAACCAAGGAGCAGAGACTAATG
GAAATTACTACTACATTTTCCCAGTGAGATATAAAGCTGCAACTCCTCAA
TTTCTCTCCATTGTATCGTCGTTGGTTCTCGTTAGTTCAGATTGTATTAT
CGCGTTTTTGGTGCGTGATTTCAATTATCAAAATTGCAAATTTACAAACG
ATGAATCTGCGATAATAATTGTTCCATTTCTCAGACTGAAATCGAATTTT
CATGGTGCTGCACTCATAGAATGTTTTACAGATGAGCAGAGGTCAAATTC
GAGATATTCTCTCTGCTGGTGAAGTACGTAGGCCATCTTTTTCGCATATT
GTTCAATCAGGTTCTCCTGTTCCTGGAGGCGATTGTGGTGGTGATATGGA
CGCTACTTTTTTCTGGAGGCTCAGCAAGTTAGGGAGAATTGGTTCAAATA
AATTGCGTTTCGATGACGATTTTGTTGATCGCTTAAACTATCAATTTACC
GGGCTATTATTGTTCATGTTTATCGGTCTGATTGGGATTCGACAATATGT
CGGTAAGCCTATACAATGTTGGATTCCACAGGAGTTTACTCGGGGGTGGG
AGGAATATACTGAAAACTACTGCTGGGTTTCAAATACATATTTTGCCTCA
ATTCAAAATAGAATGCCCTCAAAAGACGCTCGCAAAGAACAAATGATTGG
ATATTATCAATGGGCTCCAATTTTACTTGGTCTACAATCTCTTCTGTTTT
ACATTCCCTGCCTGATTTGGAGAAATGTCAGTCCTCAATCAGGGTTCAAT
GTTAGACGTATTTTGCAAGTTGCCAGTGACGCAAACTGCTCTCTTATCCC
AGAACAATTGCAAAAAAGTATCAGCTTTATTGCTCGTCACATGGACACGT
GTTTATATCGACATAGAATTTGCTATGAACATAAACATTTCATGAGAACC
AATGGGAAACGCTCGACGATTTCCAGATGTCTTGCAAAGTTGCGTTGTAT
TTGCTGTCTTGGTAAATTACAGGGAAACTTTTTGACCGTCCTCTACATTT
CGATAAAAATTCTATATTTGATTAACATTATTGGTCAACTATATCTAATG
GAAAAATTTATCGGTACTAAATATGCGTTCTACGGTATCAGAGTTCTTTG
GGATCTTATGCGGGGTCATGAATGGCATTACTCTGGAAACTTTCCTCGAG
TAACATTCTGTGACCTTGAAGCAAAGAAACTTGGAAAAAATCATTTATAT
TCCCTCCAATGTGTTCTCCCTATGAATATGTTTCTGGAAAAGATTTATAT
TTTTCTATGGTTTTGGCATGTCATTGTTGGAATTGCCACTCTGTTCAGTC
TCTTCAGTTGGATCAAGCGAATAGGTTCCCCAGTCAACAGGATCAAAATG
ATTCGAAATTATCTCAGATTAATGAACATTCTCCACGACACCGACAAAGG
ACCAAGTAGAAAATTTGCAGAAAGCTACCTCAGATCCGATGGTTGTTTTC
TGATCCAACTAATTGCGATCAATATCGGTGATCTCGTAGCGGGAGATCTG
ATTTGTGAGATGTGGCAGATTTACCGACATAAACGAATTCAGGAATTCGA
GGAATTGAAATTCACCTCCCTCAATGTTGAGTCCCGTCTACCAAGCCTGA
TGCTGAATAATACGAGTAATCTGAACGATTATGACAAAAGCGGAGCCACT
AACAACAATAACAACAACAATAACAACCTACCTTGCCCAATAAACCCTCG
TGACAAAGAGTGCCATAATACAAGCCCTTCAGCGCATTGCGTGGACATAT
CCTCGAACAAAACAAATATGGGAGGTGGAAGTCAAGTCGACATAATCAGT
GATTCCGGAGATGGAATCGAAAACTCGACGTGTTCCGGTGAAAATATGGA
TGAATTGGACATCGATGAAAAGAATGGTAAACGCCAAAAGAAAAGAGGAA
TTTTCCCGAAAGTAGCTACTAACATAATGAGAGCTTGGCTTTTTCAACAT
TTATCACATCCATATCCATCAGAAGAACAAAAAAAACAGCTCGCTCAGGA
CACTGGCTTGACGATTCTTCAAGTGAATAATTGGTTTATTAATGCTCGCC
GAAGGATCGTTCAGCCAATGATTGACCAATCGAACAGAGCTGGACCCCAC
GGCTACCCAAATGATCCTGCCGGCTATTTGCCATATATGGACAATCAACA
ACTAGCATACGCTCGAGCTACAGGCTTTCATCAAGCAATCCCAAACATGG
ACCAACTTTATAATGCAGCAGTACCGAGCCATTTGTCTCCACATCCTCCT
ATCGGTTGTCATTATGGCCTTCCACCATCATACCATTCAACAAACTCTTC
CAATGGGCTGTTTAATACTGCCGGATCCCCACACACCCAGTCTGCTGTTA
GTCAACAAGCCGCAATGGCTGCTATGATGGGATCACATCCTGGATATGCG
GCTGCTGTTGCGATGGGATACGCACCGAATCTTTCTCACCATTCGAATCA
TCAGTCAAACGTTTCTTCATTTACAACCACCCCATCACTATTCGATTCAA
GAACGACTTTAGATTCTGATTTCAAATCATCGTCTCTCCAAGACATCCAT
GCTGGATGAGAAAATTTTCTGAAATAAACTTGTACCTCACTGTCCCTGAA
AACTGTGTATTGATAATATTAAACCCATAAAGAAAATTTTTTTTTGTATA
AACAAAACAAC
back to top

protein sequence of SMED30025205-orf-1

>SMED30025205-orf-1 ID=SMED30025205-orf-1|Name=SMED30025205-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=207bp
NNANDNIISLRTMAARIDRVNNDFLIFCNLHLLFTNDTPQRTGVVFVCIS
CSCVCRIVHQHWLHFQQWRHTDGDDSYRRKPMHTNTNGVARAVCHSQLVD
TPLIHKQWLNQGAETNGNYYYIFPVRYKAATPQFLSIVSSLVLVSSDCII
AFLVRDFNYQNCKFTNDESAIIIVPFLRLKSNFHGAALIECFTDEQRSNS
RYSLCW*
back to top

protein sequence of SMED30025205-orf-2

>SMED30025205-orf-2 ID=SMED30025205-orf-2|Name=SMED30025205-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=776bp
MSRGQIRDILSAGEVRRPSFSHIVQSGSPVPGGDCGGDMDATFFWRLSKL
GRIGSNKLRFDDDFVDRLNYQFTGLLLFMFIGLIGIRQYVGKPIQCWIPQ
EFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIGYYQWAPILLG
LQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFI
ARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNF
LTVLYISIKILYLINIIGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHY
SGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVG
IATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYL
RSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFTSLNVE
SRLPSLMLNNTSNLNDYDKSGATNNNNNNNNNLPCPINPRDKECHNTSPS
AHCVDISSNKTNMGGGSQVDIISDSGDGIENSTCSGENMDELDIDEKNGK
RQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNN
WFINARRRIVQPMIDQSNRAGPHGYPNDPAGYLPYMDNQQLAYARATGFH
QAIPNMDQLYNAAVPSHLSPHPPIGCHYGLPPSYHSTNSSNGLFNTAGSP
HTQSAVSQQAAMAAMMGSHPGYAAAVAMGYAPNLSHHSNHQSNVSSFTTT
PSLFDSRTTLDSDFKSSSLQDIHAG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR008422Homeobox_KN_domain
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 72..137
e-value: 4.7E-12
score: 56.0
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 70..133
score: 13.362
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 74..129
e-value: 5.8339E-15
score: 66.1128
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 75..141
e-value: 6.6E-40
score: 136.5
NoneNo IPR availablePANTHERPTHR11850HOMEOBOX PROTEIN TRANSCRIPTION FACTORScoord: 39..181
NoneNo IPR availablePANTHERPTHR11850:SF266HOMEOBOX PROTEIN HOMOTHORAXcoord: 39..181
NoneNo IPR availablePANTHERPTHR11893:SF36INNEXIN-5coord: 57..438
NoneNo IPR availableTMHMMTMhelixcoord: 339..361
NoneNo IPR availableTMHMMTMhelixcoord: 144..166
NoneNo IPR availableTMHMMTMhelixcoord: 251..273
NoneNo IPR availableTMHMMTMhelixcoord: 68..90
IPR008422Homeobox KN domainPFAMPF05920Homeobox_KNcoord: 90..129
e-value: 1.1E-20
score: 73.2
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 71..145
IPR000990InnexinPRINTSPR01262INNEXINcoord: 141..163
score: 51.65
coord: 113..122
score: 56.8
coord: 85..96
score: 52.67
coord: 303..312
score: 64.8
coord: 255..269
score: 48.27
coord: 327..343
score: 62.59
IPR000990InnexinPFAMPF00876Innexincoord: 62..431
e-value: 2.0E-126
score: 422.0
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 57..438
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 57..437
score: 35.443