Centrosomal protein of 170 kDa protein B

Overview
NameCentrosomal protein of 170 kDa protein B
Smed IDSMED30025193
Length (bp)4155
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Centrosomal protein of 170 kDa protein B (SMED30025193) t-SNE clustered cells

Violin plots show distribution of expression levels for Centrosomal protein of 170 kDa protein B (SMED30025193) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Centrosomal protein of 170 kDa protein B (SMED30025193) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Centrosomal protein of 170 kDa protein B (SMED30025193) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025193

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30025193SMESG000036418.1 dd_Smed_v4_9728_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025193SMESG000036418.1 dd_Smed_v4_9728_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025193SMESG000036418.1 dd_Smed_v4_9728_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025193SMESG000036418.1 Contig48374newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025193SMESG000036418.1 Contig48374uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30025193SMESG000036418.1 dd_Smed_v6_9728_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025193SMESG000036418.1 dd_Smed_v4_9728_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Human
Match: CEP170 (centrosomal protein 170 [Source:HGNC Symbol;Acc:HGNC:28920])

HSP 1 Score: 64.6994 bits (156), Expect = 9.373e-12
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTV 383
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++  +       +KDL + NGTF+N+ +I    +  L + D +R  YD   FTV
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYDASTDEHLVKDLGSLNGTFVNDVRIPEQTYITLKLEDKLRFGYDTNLFTV 98          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Human
Match: CEP170 (centrosomal protein 170 [Source:HGNC Symbol;Acc:HGNC:28920])

HSP 1 Score: 71.2478 bits (173), Expect = 1.471e-11
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTV 383
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++  +       +KDL + NGTF+N+ +I    +  L + D +R  YD   FTV
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYDASTDEHLVKDLGSLNGTFVNDVRIPEQTYITLKLEDKLRFGYDTNLFTV 98          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Human
Match: CEP170 (centrosomal protein 170 [Source:HGNC Symbol;Acc:HGNC:28920])

HSP 1 Score: 71.2478 bits (173), Expect = 1.471e-11
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTV 383
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++  +       +KDL + NGTF+N+ +I    +  L + D +R  YD   FTV
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYDASTDEHLVKDLGSLNGTFVNDVRIPEQTYITLKLEDKLRFGYDTNLFTV 98          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Human
Match: CEP170 (centrosomal protein 170 [Source:HGNC Symbol;Acc:HGNC:28920])

HSP 1 Score: 71.2478 bits (173), Expect = 1.572e-11
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTV 383
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++  +       +KDL + NGTF+N+ +I    +  L + D +R  YD   FTV
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYDASTDEHLVKDLGSLNGTFVNDVRIPEQTYITLKLEDKLRFGYDTNLFTV 98          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Human
Match: CEP170 (centrosomal protein 170 [Source:HGNC Symbol;Acc:HGNC:28920])

HSP 1 Score: 71.2478 bits (173), Expect = 1.572e-11
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTV 383
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++  +       +KDL + NGTF+N+ +I    +  L + D +R  YD   FTV
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYDASTDEHLVKDLGSLNGTFVNDVRIPEQTYITLKLEDKLRFGYDTNLFTV 98          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Zebrafish
Match: CEP170B (si:ch73-212j7.1 [Source:ZFIN;Acc:ZDB-GENE-081104-258])

HSP 1 Score: 68.1662 bits (165), Expect = 2.196e-13
Identity = 31/91 (34.07%), Postives = 51/91 (56.04%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITF 377
            W+L    G  +   +  I +GR+DC++ L+S SVD +H ++  N       +KDL + NGTF+N+ +I    +  L + DI+R  YD + F
Sbjct:    6 WFLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYNPATDEHLVKDLGSLNGTFVNDLRIPDQTYITLKLSDIVRFGYDILFF 96          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Zebrafish
Match: cep170ab (centrosomal protein 170Ab [Source:ZFIN;Acc:ZDB-GENE-050309-106])

HSP 1 Score: 68.1662 bits (165), Expect = 2.205e-13
Identity = 31/87 (35.63%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYD 365
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++   E     K+KDL + NGTF+N+ +I    +  L +GD +R  YD
Sbjct:    6 WFLVSGGGIRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYEEATDEHKVKDLGSLNGTFVNDVRILEQQYITLKMGDKLRFGYD 92          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Zebrafish
Match: cep170ab (centrosomal protein 170Ab [Source:ZFIN;Acc:ZDB-GENE-050309-106])

HSP 1 Score: 68.1662 bits (165), Expect = 2.205e-13
Identity = 31/87 (35.63%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYD 365
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++   E     K+KDL + NGTF+N+ +I    +  L +GD +R  YD
Sbjct:    6 WFLVSGGGIRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYEEATDEHKVKDLGSLNGTFVNDVRILEQQYITLKMGDKLRFGYD 92          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Zebrafish
Match: cep170b (centrosomal protein 170B [Source:ZFIN;Acc:ZDB-GENE-131127-515])

HSP 1 Score: 75.0998 bits (183), Expect = 5.640e-13
Identity = 30/95 (31.58%), Postives = 54/95 (56.84%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQK 389
            W+L    G  +   +  I +GR+DC++ L+S SVD +H ++  +       +KDL + NGTF+N+ +I    + IL + D+IR  YD   + +++
Sbjct:    6 WFLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYDASTDEHLVKDLGSLNGTFVNDLRIPDQTYIILKLSDVIRFGYDSHIYILER 100          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Zebrafish
Match: CEP170B (si:ch73-212j7.1 [Source:ZFIN;Acc:ZDB-GENE-081104-258])

HSP 1 Score: 75.0998 bits (183), Expect = 5.749e-13
Identity = 30/95 (31.58%), Postives = 53/95 (55.79%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQK 389
            W+L    G  +   +  I +GR+DC++ L+S SVD +H ++  N       +KDL + NGTF+N+ +I    +  L + DI+R  YD   + +++
Sbjct:    6 WFLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYNPATDEHLVKDLGSLNGTFVNDLRIPDQTYITLKLSDIVRFGYDSHVYILER 100          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Xenopus
Match: CEP170 (centrosomal protein 170kDa [Source:NCBI gene;Acc:779465])

HSP 1 Score: 71.2478 bits (173), Expect = 1.255e-11
Identity = 32/93 (34.41%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTV 383
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++  +       +KDL + NGTFIN+ +I    +  L + D +R  YD   FTV
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVVNYDSSSDVHMVKDLGSLNGTFINDVRIPEQTYITLKLDDKLRFGYDTNLFTV 98          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Xenopus
Match: colec10 (collectin subfamily member 10 [Source:Xenbase;Acc:XB-GENE-945586])

HSP 1 Score: 70.4774 bits (171), Expect = 2.023e-11
Identity = 29/87 (33.33%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYD 365
            W+L    G  +   +  I +GR+DC++ L+S SVD +H ++  +      ++KDL + NGTF+N+ +I    +  L + D IR  YD
Sbjct:    6 WFLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYDSDKDEHRVKDLGSLNGTFVNDVRIPDQKYITLKLSDNIRFGYD 92          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Xenopus
Match: colec10 (collectin subfamily member 10 [Source:Xenbase;Acc:XB-GENE-945586])

HSP 1 Score: 70.4774 bits (171), Expect = 2.202e-11
Identity = 29/87 (33.33%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYD 365
            W+L    G  +   +  I +GR+DC++ L+S SVD +H ++  +      ++KDL + NGTF+N+ +I    +  L + D IR  YD
Sbjct:    6 WFLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYDSDKDEHRVKDLGSLNGTFVNDVRIPDQKYITLKLSDNIRFGYD 92          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Xenopus
Match: colec10 (collectin subfamily member 10 [Source:Xenbase;Acc:XB-GENE-945586])

HSP 1 Score: 70.4774 bits (171), Expect = 2.238e-11
Identity = 29/87 (33.33%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYD 365
            W+L    G  +   +  I +GR+DC++ L+S SVD +H ++  +      ++KDL + NGTF+N+ +I    +  L + D IR  YD
Sbjct:    6 WFLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYDSDKDEHRVKDLGSLNGTFVNDVRIPDQKYITLKLSDNIRFGYD 92          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Xenopus
Match: colec10 (collectin subfamily member 10 [Source:Xenbase;Acc:XB-GENE-945586])

HSP 1 Score: 70.4774 bits (171), Expect = 2.260e-11
Identity = 29/87 (33.33%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYD 365
            W+L    G  +   +  I +GR+DC++ L+S SVD +H ++  +      ++KDL + NGTF+N+ +I    +  L + D IR  YD
Sbjct:    6 WFLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYDSDKDEHRVKDLGSLNGTFVNDVRIPDQKYITLKLSDNIRFGYD 92          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Mouse
Match: Cep170 (centrosomal protein 170 [Source:MGI Symbol;Acc:MGI:1918348])

HSP 1 Score: 68.1662 bits (165), Expect = 5.812e-12
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTV 383
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++  +       +KDL + NGTF+N+ +I    +  L + D +R  YD   FTV
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYDASMDEHLVKDLGSLNGTFVNDVRIPEQTYITLKLEDKLRFGYDTNLFTV 98          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Mouse
Match: Cep170b (centrosomal protein 170B [Source:MGI Symbol;Acc:MGI:2145043])

HSP 1 Score: 70.4774 bits (171), Expect = 1.074e-11
Identity = 28/95 (29.47%), Postives = 53/95 (55.79%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQK 389
            W+L    G  +   +  I +GR +C++ L+S SVD +H ++  ++      +KDL + NGTF+N+ +I    +  L + D+IR  YD   + +++
Sbjct:    6 WFLVSSSGTRHRLPRELIFVGRDECELMLQSRSVDKQHAVINYDQDRDEHWVKDLGSLNGTFVNDVRIPDQKYITLKLNDVIRFGYDSNMYVLER 100          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Mouse
Match: Cep170b (centrosomal protein 170B [Source:MGI Symbol;Acc:MGI:2145043])

HSP 1 Score: 70.4774 bits (171), Expect = 1.074e-11
Identity = 28/95 (29.47%), Postives = 53/95 (55.79%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQK 389
            W+L    G  +   +  I +GR +C++ L+S SVD +H ++  ++      +KDL + NGTF+N+ +I    +  L + D+IR  YD   + +++
Sbjct:    6 WFLVSSSGTRHRLPRELIFVGRDECELMLQSRSVDKQHAVINYDQDRDEHWVKDLGSLNGTFVNDVRIPDQKYITLKLNDVIRFGYDSNMYVLER 100          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Mouse
Match: Cep170 (centrosomal protein 170 [Source:MGI Symbol;Acc:MGI:1918348])

HSP 1 Score: 70.8626 bits (172), Expect = 1.499e-11
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTV 383
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++  +       +KDL + NGTF+N+ +I    +  L + D +R  YD   FTV
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYDASMDEHLVKDLGSLNGTFVNDVRIPEQTYITLKLEDKLRFGYDTNLFTV 98          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Mouse
Match: Cep170 (centrosomal protein 170 [Source:MGI Symbol;Acc:MGI:1918348])

HSP 1 Score: 70.8626 bits (172), Expect = 1.499e-11
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTV 383
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++  +       +KDL + NGTF+N+ +I    +  L + D +R  YD   FTV
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYDASMDEHLVKDLGSLNGTFVNDVRIPEQTYITLKLEDKLRFGYDTNLFTV 98          
BLAST of Centrosomal protein of 170 kDa protein B vs. UniProt/SwissProt
Match: sp|Q498L0|C170B_XENLA (Centrosomal protein of 170 kDa protein B OS=Xenopus laevis OX=8355 GN=cep170b PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.265e-11
Identity = 31/95 (32.63%), Postives = 54/95 (56.84%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQK 389
            W+L    G  +   +  I +GR+DC++ L+S SVD +H ++  +      ++KDL + NGTFIN+ +I    +  L + D IR  YD  T+ +++
Sbjct:    6 WFLVSSSGTRHRLPREMIFVGREDCELMLRSRSVDKQHAVINYDSDKDEHRVKDLGSLNGTFINDVRIPDQKYITLKLNDNIRFGYDINTYVLEQ 100          
BLAST of Centrosomal protein of 170 kDa protein B vs. UniProt/SwissProt
Match: sp|A0JM08|C170B_XENTR (Centrosomal protein of 170 kDa protein B OS=Xenopus tropicalis OX=8364 GN=cep170b PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.556e-11
Identity = 30/95 (31.58%), Postives = 54/95 (56.84%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQK 389
            W+L    G  +   +  I +GR+DC++ L+S SVD +H ++  +      ++KDL + NGTF+N+ +I    +  L + D IR  YD  T+ +++
Sbjct:    6 WFLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYDSDKDEHRVKDLGSLNGTFVNDVRIPDQKYITLKLSDNIRFGYDINTYVLEQ 100          
BLAST of Centrosomal protein of 170 kDa protein B vs. UniProt/SwissProt
Match: sp|Q5SW79|CE170_HUMAN (Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 7.548e-11
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTV 383
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++  +       +KDL + NGTF+N+ +I    +  L + D +R  YD   FTV
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYDASTDEHLVKDLGSLNGTFVNDVRIPEQTYITLKLEDKLRFGYDTNLFTV 98          
BLAST of Centrosomal protein of 170 kDa protein B vs. UniProt/SwissProt
Match: sp|Q6A065|CE170_MOUSE (Centrosomal protein of 170 kDa OS=Mus musculus OX=10090 GN=Cep170 PE=1 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 1.142e-10
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTV 383
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++  +       +KDL + NGTF+N+ +I    +  L + D +R  YD   FTV
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYDASMDEHLVKDLGSLNGTFVNDVRIPEQTYITLKLEDKLRFGYDTNLFTV 98          
BLAST of Centrosomal protein of 170 kDa protein B vs. UniProt/SwissProt
Match: sp|Q9Y4F5|C170B_HUMAN (Centrosomal protein of 170 kDa protein B OS=Homo sapiens OX=9606 GN=CEP170B PE=1 SV=4)

HSP 1 Score: 63.1586 bits (152), Expect = 2.350e-8
Identity = 28/95 (29.47%), Postives = 54/95 (56.84%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQK 389
            W+L    G  +   +  I +GR++C++ L+S SVD +H ++  ++      +KDL + NGTF+N+ +I    +  L + D+IR  YD   + +++
Sbjct:    6 WFLVSSSGARHRLPRELIFVGREECELMLQSRSVDKQHAVINYDQDRDEHWVKDLGSLNGTFVNDMRIPDQKYVTLKLNDVIRFGYDSNMYVLER 100          
BLAST of Centrosomal protein of 170 kDa protein B vs. TrEMBL
Match: A0A2C9LPC8 (FHA domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106065192 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 6.720e-13
Identity = 42/125 (33.60%), Postives = 69/125 (55.20%), Query Frame = 3
Query:   84 MLENHFEWYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQKKSVTCLNATESPSRNAELPSVVT 458
            +L++H  WYL D  G+ +   K  + LGR++CD+ L S SVD +H +L  +      K+KDL T+NGT++N  +I    +  L+  D IRL +D + + +++ S       + P     +PS VT
Sbjct:   43 VLQDH--WYLVDTHGQKFRLPKTMLFLGREECDVVLASQSVDKRHAVLTFDLYLNKFKVKDLSTTNGTYVNNSRIAEQEYVTLHHMDSIRLGHDTMMYHIEQGSQITNQGGQLPDPQF-VPSWVT 164          
BLAST of Centrosomal protein of 170 kDa protein B vs. TrEMBL
Match: A0A2C9LPB1 (FHA domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106065192 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 7.710e-13
Identity = 42/125 (33.60%), Postives = 69/125 (55.20%), Query Frame = 3
Query:   84 MLENHFEWYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQKKSVTCLNATESPSRNAELPSVVT 458
            +L++H  WYL D  G+ +   K  + LGR++CD+ L S SVD +H +L  +      K+KDL T+NGT++N  +I    +  L+  D IRL +D + + +++ S       + P     +PS VT
Sbjct:   43 VLQDH--WYLVDTHGQKFRLPKTMLFLGREECDVVLASQSVDKRHAVLTFDLYLNKFKVKDLSTTNGTYVNNSRIAEQEYVTLHHMDSIRLGHDTMMYHIEQGSQITNQGGQLPDPQF-VPSWVT 164          
BLAST of Centrosomal protein of 170 kDa protein B vs. TrEMBL
Match: F6S095 (FHA domain-containing protein OS=Ciona intestinalis OX=7719 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 9.901e-13
Identity = 72/240 (30.00%), Postives = 113/240 (47.08%), Query Frame = 3
Query:   99 FEWYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQKKSVTCLNATESPSRNAELPSVVTDPERFMQSVVCDLTDSTSEMNSSVEVIVKKCTEKMKEKPISPKEVEKKTSKFQGIVRNEKKIESVVIQKTKD----VQLKDETNNAPSKPA-ESFTIDFTSNE--VNDSDSL-HSASLSR 794
              WYL      ++      + +GR+DC++ LKS SVD +H ++  +   ++ +IKDL + NGTF+NE ++    +  +  GD+IR  YD  TF + KKS T        S +     ++  P++   + +   T S+SE          K +E+                 F+   ++ K I S    KT D    +  KD+TNN P KP+  SFTID   N+  VN   +L H ASL +
Sbjct:    1 MSWYLDGSDESVHRLPNEMLFIGRQDCELILKSKSVDKQHAVMNYDIIQQAFRIKDLGSLNGTFVNETRLPEQVYITMKEGDVIRFGYDTQTFIISKKSRTHREKKSDISNH-----LLKKPKKQSSTSLSTTTSSSSESTEKAPSTPSKKSEQY---------------YFEIPTKDTKSIRSA---KTDDELDKIPTKDKTNNTPPKPSPASFTIDIKGNQQVVNGVKNLQHYASLRK 217          
BLAST of Centrosomal protein of 170 kDa protein B vs. TrEMBL
Match: A0A1S3KC22 (centrosomal protein of 170 kDa protein B isoform X2 OS=Lingula unguis OX=7574 GN=LOC106180677 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.042e-12
Identity = 41/123 (33.33%), Postives = 64/123 (52.03%), Query Frame = 3
Query:   33 IYYL*NKFVNKDFCFHIMLENHFEWYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQKKSVT 401
            + YL  K++  +     M +    W L DR G  +    + + LGR +CDI L+S SVD +H ++  +   K  KIKDL + NGT++NE +I    +  L   D IR  YD + F +++   T
Sbjct:    1 MIYLMKKYMKCEMSGQEMPQ----WALVDRNGVPHKLKHSMVFLGRDECDISLQSRSVDKRHAVITFDHYSKKFKIKDLSSLNGTYVNESRIPEQTYVALENLDTIRFGYDPMVFRIEETDGT 119          
BLAST of Centrosomal protein of 170 kDa protein B vs. TrEMBL
Match: A0A1W5BJV3 (centrosomal protein of 170 kDa-like isoform X2 OS=Ciona intestinalis OX=7719 GN=LOC100175904 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.351e-12
Identity = 73/242 (30.17%), Postives = 116/242 (47.93%), Query Frame = 3
Query:   99 FEWYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQKKSVTCLNATESPSRNAELPSVVTDPERFMQSVVCD--LTDSTSEMNSSVEVIVKKCTEKMKEKPISPKEVEKKTSK--FQGIVRNEKKIESVVIQKTKD----VQLKDETNNAPSKPA-ESFTIDFTSNE--VNDSDSL-HSASL 788
              WYL      ++      + +GR+DC++ LKS SVD +H ++  +   ++ +IKDL + NGTF+NE ++    +  +  GD+IR  YD  TF + KKS T                      R  +S + +  L     + ++S+       +E  ++ P +P    KK+ +  F+   ++ K I S    KT D    +  KD+TNN P KP+  SFTID   N+  VN   +L H ASL
Sbjct:    1 MSWYLDGSDESVHRLPNEMLFIGRQDCELILKSKSVDKQHAVMNYDIIQQAFRIKDLGSLNGTFVNETRLPEQVYITMKEGDVIRFGYDTQTFIISKKSRT---------------------HREKKSDISNHLLKKPKKQSSTSLSTTTSSSSESTEKAPSTP---SKKSEQYYFEIPTKDTKSIRSA---KTDDELDKIPTKDKTNNTPPKPSPASFTIDIKGNQQVVNGVKNLQHYASL 215          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Cavefish
Match: cep170aa (centrosomal protein 170 [Source:NCBI gene;Acc:103025411])

HSP 1 Score: 76.6406 bits (187), Expect = 1.832e-13
Identity = 32/93 (34.41%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTV 383
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++         K+KDL + NGTF+N+ +I+   +  L + D +R  YD   FTV
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYEATSDEHKVKDLGSLNGTFVNDVRIQEQMYITLKIDDKLRFGYDTNLFTV 98          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Cavefish
Match: cep170aa (centrosomal protein 170 [Source:NCBI gene;Acc:103025411])

HSP 1 Score: 76.6406 bits (187), Expect = 1.876e-13
Identity = 32/93 (34.41%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTV 383
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++         K+KDL + NGTF+N+ +I+   +  L + D +R  YD   FTV
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYEATSDEHKVKDLGSLNGTFVNDVRIQEQMYITLKIDDKLRFGYDTNLFTV 98          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Cavefish
Match: cep170aa (centrosomal protein 170 [Source:NCBI gene;Acc:103025411])

HSP 1 Score: 76.6406 bits (187), Expect = 1.884e-13
Identity = 32/93 (34.41%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTV 383
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++         K+KDL + NGTF+N+ +I+   +  L + D +R  YD   FTV
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYEATSDEHKVKDLGSLNGTFVNDVRIQEQMYITLKIDDKLRFGYDTNLFTV 98          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Cavefish
Match: cep170b (centrosomal protein 170B [Source:NCBI gene;Acc:103032367])

HSP 1 Score: 73.9442 bits (180), Expect = 1.362e-12
Identity = 28/95 (29.47%), Postives = 53/95 (55.79%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQK 389
            W+L    G  +   +  I +GR+DC++ L+S SVD +H ++  +       +KDL + NGTF+N+ +I    +  L + D++R  YD   + +++
Sbjct:    6 WFLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYDPATDEHLVKDLGSLNGTFVNDLRIPDQTYITLKLSDVVRFGYDSHVYIMER 100          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Cavefish
Match: si:ch73-212j7.1 (centrosomal protein 170B [Source:HGNC Symbol;Acc:HGNC:20362])

HSP 1 Score: 73.559 bits (179), Expect = 1.491e-12
Identity = 29/89 (32.58%), Postives = 49/89 (55.06%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQI 371
            W+L    G  +   +  I +GR+DC++ L+S SVD +H ++  N       +KDL + NGTF+N+ +I    +  L + DI+R  Y  +
Sbjct:    6 WFLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYNPATDEHLVKDLGSLNGTFVNDLRIPDQTYITLKLSDIVRFGYSHV 94          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Sea Lamprey
Match: si:ch73-212j7.1 (centrosomal protein 170B [Source:ZFIN;Acc:ZDB-GENE-131127-515])

HSP 1 Score: 63.1586 bits (152), Expect = 5.250e-10
Identity = 31/87 (35.63%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYD 365
            W+L    G  +   K  I +GR +C++ L+S SVD +H ++  +      K+ DL + NGTF+NE +I  + + IL + D IR  YD
Sbjct:    6 WFLVAGSGTRHRLPKEMIFVGRDECELMLQSRSVDRQHAVVNYDPATDEHKVMDLGSLNGTFVNESRIPEHTYLILKLNDTIRFGYD 92          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Sea Lamprey
Match: cep170aa (centrosomal protein 170Aa [Source:NCBI gene;Acc:557463])

HSP 1 Score: 61.2326 bits (147), Expect = 1.592e-9
Identity = 32/95 (33.68%), Postives = 50/95 (52.63%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQK 389
            W+L    G  +   +  I  GR+DC++ L S SVD +H ++  +       +KDL + NGTF+NE  +    +  L   D+IR  YD   +TV+K
Sbjct:    6 WFLVGAGGTRHRLPRELIFAGREDCELVLHSRSVDKQHAVINYDLVHDQHMLKDLGSLNGTFVNEVPVPDQTYVSLKQSDVIRFGYDPNVYTVEK 100          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Sea Lamprey
Match: cep170aa (centrosomal protein 170Aa [Source:NCBI gene;Acc:557463])

HSP 1 Score: 60.8474 bits (146), Expect = 2.243e-9
Identity = 32/95 (33.68%), Postives = 50/95 (52.63%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQK 389
            W+L    G  +   +  I  GR+DC++ L S SVD +H ++  +       +KDL + NGTF+NE  +    +  L   D+IR  YD   +TV+K
Sbjct:    6 WFLVGAGGTRHRLPRELIFAGREDCELVLHSRSVDKQHAVINYDLVHDQHMLKDLGSLNGTFVNEVPVPDQTYVSLKQSDVIRFGYDPNVYTVEK 100          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Sea Lamprey
Match: cep170aa (centrosomal protein 170Aa [Source:NCBI gene;Acc:557463])

HSP 1 Score: 60.8474 bits (146), Expect = 2.309e-9
Identity = 32/95 (33.68%), Postives = 50/95 (52.63%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQK 389
            W+L    G  +   +  I  GR+DC++ L S SVD +H ++  +       +KDL + NGTF+NE  +    +  L   D+IR  YD   +TV+K
Sbjct:    6 WFLVGAGGTRHRLPRELIFAGREDCELVLHSRSVDKQHAVINYDLVHDQHMLKDLGSLNGTFVNEVPVPDQTYVSLKQSDVIRFGYDPNVYTVEK 100          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Medaka
Match: si:ch73-212j7.1 (centrosomal protein of 170 kDa protein B [Source:NCBI gene;Acc:101164272])

HSP 1 Score: 77.0258 bits (188), Expect = 1.544e-13
Identity = 33/95 (34.74%), Postives = 52/95 (54.74%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQK 389
            W+L    G  +   +  I +GR+DC++ L+S SVD +H +L  N       +KDL + NGTF+N+ +I    +  L   DIIR  YD   + ++K
Sbjct:    6 WFLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVLNYNPATDEHLVKDLGSLNGTFVNDLRIPDQTYITLKQSDIIRFGYDSHVYVLEK 100          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Medaka
Match: cep170aa (centrosomal protein 170 [Source:NCBI gene;Acc:101159217])

HSP 1 Score: 76.2554 bits (186), Expect = 2.353e-13
Identity = 33/100 (33.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQKKSVTC 404
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++         K+KDL + NGTF+N+ +I+   +  L + D +R  YD   FTV +  +T 
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYEAGTDEHKVKDLGSLNGTFVNDVRIQEQMYITLKLEDKLRFGYDTNLFTVVRGELTV 105          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Medaka
Match: cep170aa (centrosomal protein 170 [Source:NCBI gene;Acc:101159217])

HSP 1 Score: 76.2554 bits (186), Expect = 2.619e-13
Identity = 33/100 (33.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQKKSVTC 404
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++         K+KDL + NGTF+N+ +I+   +  L + D +R  YD   FTV +  +T 
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYEAGTDEHKVKDLGSLNGTFVNDVRIQEQMYITLKLEDKLRFGYDTNLFTVVRGELTV 105          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Medaka
Match: cep170b (centrosomal protein of 170 kDa protein B [Source:NCBI gene;Acc:101174238])

HSP 1 Score: 73.559 bits (179), Expect = 1.520e-12
Identity = 30/95 (31.58%), Postives = 52/95 (54.74%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQK 389
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++  +       +KDL + NGTF+N+ +I    +  L + D+IR  YD   + ++K
Sbjct:    6 WFLVSSSGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYSSNTDEHMVKDLGSLNGTFVNDLRIPDQTYITLKLSDVIRFGYDSHVYILEK 100          
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Medaka
Match: ENSORLT00000029382.1 (pep primary_assembly:ASM223467v1:1:29816185:29820022:-1 gene:ENSORLG00000024629.1 transcript:ENSORLT00000029382.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 1.221e-11
Identity = 29/87 (33.33%), Postives = 48/87 (55.17%), Query Frame = 3
Query:  105 WYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYD 365
            W+L    G  +   +  I +GR DC++ L+S SVD +H ++         K+KDL + NGTF+N+ +I+   +  L + D +R  YD
Sbjct:    6 WFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYEPNTDEHKVKDLGSLNGTFVNDIRIQEQVYVTLKIEDKLRFGYD 92          
BLAST of Centrosomal protein of 170 kDa protein B vs. Planmine SMEST
Match: SMESG000036418.1 (SMESG000036418.1)

HSP 1 Score: 2434.06 bits (6307), Expect = 0.000e+0
Identity = 1254/1261 (99.44%), Postives = 1257/1261 (99.68%), Query Frame = 3
Query:   84 MLENHFEWYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQKKSVTCLNATESPSRNAELPSVVTDPERFMQSVVCDLTDSTSEMNSSVEVIVKKCTEKMKEKPISPKEVEKKTSKFQGIVRNEKKIESVVIQKTKDVQLKDETNNAPSKPAESFTIDFTSNEVNDSDSLHSASLSRFVPSKLRSSFEGRDKVNRPKLQSSNSFNKSNDSPRSGIVEKKICVGKPIKTNFSIKTKPNSKPIETLTKAKTSNGSKKVLXXXXXXXXXXXXXXXXXXXXXTVGKQDKVELIKSSNNNSKIITPTLSKRNSKSYLLEKMLMGSQSNVDFVDFDECNKNEEKQPEIILPIISSENFITPNTDEPAKNNQDFNDAISEAGTYVIENETNEKTIDTEDTLEKDDISTISSTRFNCQXXXXXXXXXXXXXMPTDDGLMENDCKPKRNPNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTATYNIGDXXXXXXXXXXXXXXXSESESNKQLGSNSKINFQSHQQTPISPYAMGNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSSTQPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTRIQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPLLSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKVGVSESLGTQSSIGSRKLNSSIRNQRSCSLIEERKSNHNNNNFETLADYRNKPKLSLLAMNSGTFVNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVHRKNFNRYEYGQHSLKYNSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYPNYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQRREEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNEQRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTIDQSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGSCTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSDTKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYSSLSKRFQHRKD 3866
            MLENHFEWYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQKKSVTCLNATESPSRNAELPSVVTDPERFMQSVVCDLTDSTSEMNSSVE+IVKKCTEKMKEKPISPKEVEKKTSKFQGIVRNEKKIESVVIQKTKDVQLK+ETNNAPSKPAESFTIDFTSNEVNDSDSLHSASLSRFVPSKLRSSFEGRDKVNRPKLQSSNSFNKSNDSPRSGIVEKKICVGKPIKTNFSIKTKP SKPIETLTKAKTSNGSKKVLEKSPKIKPEPSPKFPQKPFKQTVGKQDKVELIKSSNNNSKIITPTLSKRNSKSYLLEKMLMGSQSNVDFVDFDECNKNEEKQPEIILPIISSENFITPNTDEPAKNNQDFNDAISEAGTYVIENETNEKTIDTEDTLEKDDISTISSTRFNCQELESKSSSKWLSEMPTDDGLMENDCKPKRNPNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTATYNIGDPNNNLNSEEPNNWTNSESESNKQLGSNSK+NFQSHQQTP SPYAMGNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSSTQPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTRIQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPLLSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKV VSESLGTQSSIGSRKLNSSIRNQRSCSLIEERKSNHNNNNFETLADYRNKPKLSLLAMNSGTFVNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVHRKNFNRYEYGQHSLK NSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYPNYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQRREEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNEQRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTIDQSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGSCTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSDTKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYSSLSKRFQHRKD
Sbjct:    1 MLENHFEWYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLINEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTVQKKSVTCLNATESPSRNAELPSVVTDPERFMQSVVCDLTDSTSEMNSSVEIIVKKCTEKMKEKPISPKEVEKKTSKFQGIVRNEKKIESVVIQKTKDVQLKEETNNAPSKPAESFTIDFTSNEVNDSDSLHSASLSRFVPSKLRSSFEGRDKVNRPKLQSSNSFNKSNDSPRSGIVEKKICVGKPIKTNFSIKTKPISKPIETLTKAKTSNGSKKVLEKSPKIKPEPSPKFPQKPFKQTVGKQDKVELIKSSNNNSKIITPTLSKRNSKSYLLEKMLMGSQSNVDFVDFDECNKNEEKQPEIILPIISSENFITPNTDEPAKNNQDFNDAISEAGTYVIENETNEKTIDTEDTLEKDDISTISSTRFNCQELESKSSSKWLSEMPTDDGLMENDCKPKRNPNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTATYNIGDPNNNLNSEEPNNWTNSESESNKQLGSNSKLNFQSHQQTPNSPYAMGNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSSTQPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTRIQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPLLSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKVVVSESLGTQSSIGSRKLNSSIRNQRSCSLIEERKSNHNNNNFETLADYRNKPKLSLLAMNSGTFVNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVHRKNFNRYEYGQHSLKCNSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYPNYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQRREEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNEQRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTIDQSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGSCTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSDTKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYSSLSKRFQHRKD 1261          
BLAST of Centrosomal protein of 170 kDa protein B vs. Planmine SMEST
Match: SMESG000036418.1 (SMESG000036418.1)

HSP 1 Score: 1546.95 bits (4004), Expect = 0.000e+0
Identity = 774/778 (99.49%), Postives = 775/778 (99.61%), Query Frame = 3
Query: 1533 MPTDDGLMENDCKPKRNPNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTATYNIGDXXXXXXXXXXXXXXXSESESNKQLGSNSKINFQSHQQTPISPYAMGNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSSTQPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTRIQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPLLSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKVGVSESLGTQSSIGSRKLNSSIRNQRSCSLIEERKSNHNNNNFETLADYRNKPKLSLLAMNSGTFVNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVHRKNFNRYEYGQHSLKYNSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYPNYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQRREEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNEQRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTIDQSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGSCTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSDTKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYSSLSKRFQHRKD 3866
            MPTDDGLMENDCKPKRNPNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTATYNIGDPNNNLNSEEPNNWTNSESESNKQLGSNSK+NFQSHQQTP SPYAMGNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSSTQPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTRIQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPLLSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKV VSESLGTQSSIGSRKLNSSIRNQRSCSLIEERKSNHNNNNFETLADYRNKPKLSLLAMNSGTFVNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVHRKNFNRYEYGQHSLK NSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYPNYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQRREEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNEQRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTIDQSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGSCTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSDTKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYSSLSKRFQHRKD
Sbjct:   26 MPTDDGLMENDCKPKRNPNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTATYNIGDPNNNLNSEEPNNWTNSESESNKQLGSNSKLNFQSHQQTPNSPYAMGNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSSTQPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTRIQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPLLSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKVVVSESLGTQSSIGSRKLNSSIRNQRSCSLIEERKSNHNNNNFETLADYRNKPKLSLLAMNSGTFVNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVHRKNFNRYEYGQHSLKCNSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYPNYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQRREEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNEQRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTIDQSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGSCTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSDTKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYSSLSKRFQHRKD 803          
BLAST of Centrosomal protein of 170 kDa protein B vs. Planmine SMEST
Match: SMESG000036418.1 (SMESG000036418.1)

HSP 1 Score: 1545.41 bits (4000), Expect = 0.000e+0
Identity = 774/778 (99.49%), Postives = 775/778 (99.61%), Query Frame = 3
Query: 1533 MPTDDGLMENDCKPKRNPNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTATYNIGDXXXXXXXXXXXXXXXSESESNKQLGSNSKINFQSHQQTPISPYAMGNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSSTQPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTRIQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPLLSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKVGVSESLGTQSSIGSRKLNSSIRNQRSCSLIEERKSNHNNNNFETLADYRNKPKLSLLAMNSGTFVNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVHRKNFNRYEYGQHSLKYNSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYPNYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQRREEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNEQRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTIDQSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGSCTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSDTKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYSSLSKRFQHRKD 3866
            MPTDDGLMENDCKPKRNPNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTATYNIGDPNNNLNSEEPNNWTNSESESNKQLGSNSK+NFQSHQQTP SPYAMGNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSSTQPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTRIQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPLLSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKV VSESLGTQSSIGSRKLNSSIRNQRSCSLIEERKSNHNNNNFETLADYRNKPKLSLLAMNSGTFVNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVHRKNFNRYEYGQHSLK NSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYPNYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQRREEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNEQRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTIDQSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGSCTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSDTKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYSSLSKRFQHRKD
Sbjct:   25 MPTDDGLMENDCKPKRNPNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTATYNIGDPNNNLNSEEPNNWTNSESESNKQLGSNSKLNFQSHQQTPNSPYAMGNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSSTQPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTRIQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPLLSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKVVVSESLGTQSSIGSRKLNSSIRNQRSCSLIEERKSNHNNNNFETLADYRNKPKLSLLAMNSGTFVNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVHRKNFNRYEYGQHSLKCNSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYPNYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQRREEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNEQRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTIDQSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGSCTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSDTKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYSSLSKRFQHRKD 802          
BLAST of Centrosomal protein of 170 kDa protein B vs. Planmine SMEST
Match: SMESG000036418.1 (SMESG000036418.1)

HSP 1 Score: 1499.18 bits (3880), Expect = 0.000e+0
Identity = 756/778 (97.17%), Postives = 757/778 (97.30%), Query Frame = 3
Query: 1533 MPTDDGLMENDCKPKRNPNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTATYNIGDXXXXXXXXXXXXXXXSESESNKQLGSNSKINFQSHQQTPISPYAMGNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSSTQPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTRIQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPLLSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKVGVSESLGTQSSIGSRKLNSSIRNQRSCSLIEERKSNHNNNNFETLADYRNKPKLSLLAMNSGTFVNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVHRKNFNRYEYGQHSLKYNSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYPNYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQRREEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNEQRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTIDQSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGSCTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSDTKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYSSLSKRFQHRKD 3866
            MPTDDGLMENDCKPKRNPNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTATYNIGDPNNNLNSEEPNNWTNSESESNKQLGSNSK+NFQSHQQTP SPYAMGNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSSTQPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTRIQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPLLSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKV VSESLGTQSSI                  EERKSNHNNNNFETLADYRNKPKLSLLAMNSGTFVNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVHRKNFNRYEYGQHSLK NSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYPNYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQRREEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNEQRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTIDQSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGSCTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSDTKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYSSLSKRFQHRKD
Sbjct:   26 MPTDDGLMENDCKPKRNPNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTATYNIGDPNNNLNSEEPNNWTNSESESNKQLGSNSKLNFQSHQQTPNSPYAMGNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSSTQPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTRIQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPLLSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKVVVSESLGTQSSI------------------EERKSNHNNNNFETLADYRNKPKLSLLAMNSGTFVNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVHRKNFNRYEYGQHSLKCNSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYPNYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQRREEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNEQRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTIDQSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGSCTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSDTKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYSSLSKRFQHRKD 785          
BLAST of Centrosomal protein of 170 kDa protein B vs. Planmine SMEST
Match: SMESG000036418.1 (SMESG000036418.1)

HSP 1 Score: 1499.18 bits (3880), Expect = 0.000e+0
Identity = 756/778 (97.17%), Postives = 757/778 (97.30%), Query Frame = 3
Query: 1533 MPTDDGLMENDCKPKRNPNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTATYNIGDXXXXXXXXXXXXXXXSESESNKQLGSNSKINFQSHQQTPISPYAMGNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSSTQPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTRIQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPLLSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKVGVSESLGTQSSIGSRKLNSSIRNQRSCSLIEERKSNHNNNNFETLADYRNKPKLSLLAMNSGTFVNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVHRKNFNRYEYGQHSLKYNSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYPNYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQRREEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNEQRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTIDQSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGSCTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSDTKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYSSLSKRFQHRKD 3866
            MPTDDGLMENDCKPKRNPNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTATYNIGDPNNNLNSEEPNNWTNSESESNKQLGSNSK+NFQSHQQTP SPYAMGNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSSTQPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTRIQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPLLSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKV VSESLGTQSSI                  EERKSNHNNNNFETLADYRNKPKLSLLAMNSGTFVNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVHRKNFNRYEYGQHSLK NSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYPNYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQRREEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNEQRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTIDQSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGSCTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSDTKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYSSLSKRFQHRKD
Sbjct:   25 MPTDDGLMENDCKPKRNPNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTATYNIGDPNNNLNSEEPNNWTNSESESNKQLGSNSKLNFQSHQQTPNSPYAMGNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSSTQPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTRIQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPLLSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKVVVSESLGTQSSI------------------EERKSNHNNNNFETLADYRNKPKLSLLAMNSGTFVNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVHRKNFNRYEYGQHSLKCNSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYPNYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQRREEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNEQRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTIDQSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGSCTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSDTKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYSSLSKRFQHRKD 784          
The following BLAST results are available for this feature:
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP1709.373e-1233.33centrosomal protein 170 [Source:HGNC Symbol;Acc:HG... [more]
CEP1701.471e-1133.33centrosomal protein 170 [Source:HGNC Symbol;Acc:HG... [more]
CEP1701.471e-1133.33centrosomal protein 170 [Source:HGNC Symbol;Acc:HG... [more]
CEP1701.572e-1133.33centrosomal protein 170 [Source:HGNC Symbol;Acc:HG... [more]
CEP1701.572e-1133.33centrosomal protein 170 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP170B2.196e-1334.07si:ch73-212j7.1 [Source:ZFIN;Acc:ZDB-GENE-081104-2... [more]
cep170ab2.205e-1335.63centrosomal protein 170Ab [Source:ZFIN;Acc:ZDB-GEN... [more]
cep170ab2.205e-1335.63centrosomal protein 170Ab [Source:ZFIN;Acc:ZDB-GEN... [more]
cep170b5.640e-1331.58centrosomal protein 170B [Source:ZFIN;Acc:ZDB-GENE... [more]
CEP170B5.749e-1331.58si:ch73-212j7.1 [Source:ZFIN;Acc:ZDB-GENE-081104-2... [more]
back to top
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP1701.255e-1134.41centrosomal protein 170kDa [Source:NCBI gene;Acc:7... [more]
colec102.023e-1133.33collectin subfamily member 10 [Source:Xenbase;Acc:... [more]
colec102.202e-1133.33collectin subfamily member 10 [Source:Xenbase;Acc:... [more]
colec102.238e-1133.33collectin subfamily member 10 [Source:Xenbase;Acc:... [more]
colec102.260e-1133.33collectin subfamily member 10 [Source:Xenbase;Acc:... [more]
back to top
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cep1705.812e-1233.33centrosomal protein 170 [Source:MGI Symbol;Acc:MGI... [more]
Cep170b1.074e-1129.47centrosomal protein 170B [Source:MGI Symbol;Acc:MG... [more]
Cep170b1.074e-1129.47centrosomal protein 170B [Source:MGI Symbol;Acc:MG... [more]
Cep1701.499e-1133.33centrosomal protein 170 [Source:MGI Symbol;Acc:MGI... [more]
Cep1701.499e-1133.33centrosomal protein 170 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Centrosomal protein of 170 kDa protein B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q498L0|C170B_XENLA1.265e-1132.63Centrosomal protein of 170 kDa protein B OS=Xenopu... [more]
sp|A0JM08|C170B_XENTR2.556e-1131.58Centrosomal protein of 170 kDa protein B OS=Xenopu... [more]
sp|Q5SW79|CE170_HUMAN7.548e-1133.33Centrosomal protein of 170 kDa OS=Homo sapiens OX=... [more]
sp|Q6A065|CE170_MOUSE1.142e-1033.33Centrosomal protein of 170 kDa OS=Mus musculus OX=... [more]
sp|Q9Y4F5|C170B_HUMAN2.350e-829.47Centrosomal protein of 170 kDa protein B OS=Homo s... [more]
back to top
BLAST of Centrosomal protein of 170 kDa protein B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9LPC86.720e-1333.60FHA domain-containing protein OS=Biomphalaria glab... [more]
A0A2C9LPB17.710e-1333.60FHA domain-containing protein OS=Biomphalaria glab... [more]
F6S0959.901e-1330.00FHA domain-containing protein OS=Ciona intestinali... [more]
A0A1S3KC221.042e-1233.33centrosomal protein of 170 kDa protein B isoform X... [more]
A0A1W5BJV31.351e-1230.17centrosomal protein of 170 kDa-like isoform X2 OS=... [more]
back to top
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep170aa1.832e-1334.41centrosomal protein 170 [Source:NCBI gene;Acc:1030... [more]
cep170aa1.876e-1334.41centrosomal protein 170 [Source:NCBI gene;Acc:1030... [more]
cep170aa1.884e-1334.41centrosomal protein 170 [Source:NCBI gene;Acc:1030... [more]
cep170b1.362e-1229.47centrosomal protein 170B [Source:NCBI gene;Acc:103... [more]
si:ch73-212j7.11.491e-1232.58centrosomal protein 170B [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:ch73-212j7.15.250e-1035.63centrosomal protein 170B [Source:ZFIN;Acc:ZDB-GENE... [more]
cep170aa1.592e-933.68centrosomal protein 170Aa [Source:NCBI gene;Acc:55... [more]
cep170aa2.243e-933.68centrosomal protein 170Aa [Source:NCBI gene;Acc:55... [more]
cep170aa2.309e-933.68centrosomal protein 170Aa [Source:NCBI gene;Acc:55... [more]
back to top
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 170 kDa protein B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-212j7.11.544e-1334.74centrosomal protein of 170 kDa protein B [Source:N... [more]
cep170aa2.353e-1333.00centrosomal protein 170 [Source:NCBI gene;Acc:1011... [more]
cep170aa2.619e-1333.00centrosomal protein 170 [Source:NCBI gene;Acc:1011... [more]
cep170b1.520e-1231.58centrosomal protein of 170 kDa protein B [Source:N... [more]
ENSORLT00000029382.11.221e-1133.33pep primary_assembly:ASM223467v1:1:29816185:298200... [more]
back to top
BLAST of Centrosomal protein of 170 kDa protein B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036418.10.000e+099.44SMESG000036418.1[more]
SMESG000036418.10.000e+099.49SMESG000036418.1[more]
SMESG000036418.10.000e+099.49SMESG000036418.1[more]
SMESG000036418.10.000e+097.17SMESG000036418.1[more]
SMESG000036418.10.000e+097.17SMESG000036418.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025193 ID=SMED30025193|Name=Centrosomal protein of 170 kDa protein B|organism=Schmidtea mediterranea sexual|type=transcript|length=4155bp
TGCAAAACTCACGTTTATTTTTTGAATTAAATATTTATTATTTGTAAAAT
AAATTTGTGAATAAAGATTTTTGTTTTCACATAATGTTGGAAAACCACTT
TGAATGGTATTTAACTGATAGATTTGGGAAATTATATTATTTTGATAAGA
ATAAAATAATTCTGGGAAGAAAGGATTGCGATATTCAACTGAAATCAAAC
AGTGTGGATTATAAGCACTGTATTTTATTAATAAACGAAAAAGATAAAAG
TCTTAAAATTAAAGACCTCGAAACATCGAATGGAACTTTTATAAATGAAA
AACAAATCAAAGCAAATCATTTTAAAATTTTAAACGTTGGCGACATAATC
CGTTTAGCATATGACCAGATAACATTTACAGTTCAGAAAAAATCAGTCAC
CTGTTTGAATGCAACAGAAAGTCCAAGTAGGAATGCCGAATTACCGTCTG
TCGTTACTGACCCTGAGAGGTTTATGCAATCTGTGGTATGTGATTTGACG
GACTCCACGAGTGAAATGAATAGTTCTGTTGAAGTAATCGTTAAAAAATG
CACAGAAAAAATGAAAGAGAAACCCATTTCTCCAAAGGAAGTAGAAAAGA
AAACATCAAAATTTCAAGGTATCGTTCGAAATGAAAAAAAGATTGAAAGC
GTAGTTATTCAGAAAACAAAAGACGTACAACTAAAAGACGAAACCAATAA
TGCACCTTCTAAGCCGGCCGAGTCATTTACCATTGATTTCACGAGTAATG
AAGTAAATGATAGCGATTCTCTACATTCTGCCAGTTTGAGTCGGTTTGTA
CCTAGCAAATTGCGATCTAGTTTTGAAGGTAGAGACAAAGTCAATCGGCC
AAAATTGCAATCATCCAATTCATTTAATAAATCAAACGATTCTCCTCGTT
CGGGAATAGTTGAAAAAAAAATCTGTGTTGGAAAACCAATAAAAACCAAT
TTTTCTATTAAAACAAAACCGAATTCGAAACCCATTGAAACTTTAACAAA
AGCAAAGACTTCTAATGGATCGAAAAAGGTTCTAGAAAAAAGCCCGAAAA
TTAAACCAGAACCTTCGCCAAAGTTTCCTCAAAAGCCATTCAAGCAAACT
GTTGGAAAACAGGATAAAGTTGAATTGATAAAATCATCAAACAATAATTC
CAAAATTATTACTCCAACATTGAGTAAAAGAAATTCAAAATCATATTTGC
TGGAGAAAATGTTAATGGGGAGTCAATCTAATGTTGATTTTGTTGACTTC
GATGAGTGCAACAAAAATGAGGAAAAACAACCGGAAATTATTCTTCCTAT
AATATCTAGTGAGAATTTTATTACACCGAACACTGATGAACCAGCTAAGA
ATAATCAAGATTTCAATGATGCGATCAGCGAAGCCGGAACGTATGTTATC
GAAAATGAAACAAATGAAAAAACTATTGATACCGAAGATACTTTAGAAAA
AGATGACATTAGTACTATTTCCAGTACACGATTCAATTGTCAGGAATTAG
AATCGAAATCTTCATCGAAATGGTTATCTGAAATGCCTACAGATGATGGT
TTAATGGAGAACGATTGCAAACCCAAACGCAATCCGAATGCGAAATTCAC
AGGGTGTAGTATGCCTCACATTCCTTCAAATATGCCTTTGGATAGTGAGA
AAAGTTATCGAGAAGAGAGTTCTAAAATAACTACCAATATTCTTGTAAAT
GATTCAAGAACTAGAAATCCAAGAACAGCGACTTATAATATAGGAGATCC
TAATAATAATCTTAATTCCGAAGAGCCAAATAATTGGACAAACAGTGAAT
CGGAGTCTAATAAACAACTTGGAAGCAATTCTAAAATTAATTTCCAATCT
CATCAACAAACTCCAATTTCACCATATGCTATGGGAAACCAATCGTTATT
AGTCGCTGAAGACGTCTATGTGGCAGATGTTATTACGAATTCCACTGTTC
CTTCAAGCTATTCAAGAATTCCGAACTTGCCTCAAAAATCAAAAGAGATA
GATCTGTTTTCTACTCTAAATTTTAGCTCAACTCAGCCCAATACAAATTT
CCATCCTCGTTCAACATATAGTGTGGCAAGTCTCGATACTGCACTTTTGC
TGCAAGATACTGAGGCATTATTGAATGATATGGAGAAAAGAGTTTATTCC
AGACGAGAAATTAAAACAGAAGAATTTACAAGAATCCAACCATTTTCGAC
TTCCTTTCCTCAATCTGAAAAAATACCTTTTGTAGATGATGGAGAAGAAA
GAGAAGAAGATACTAGTTTATTCAATTATTCTACTGAAGTGGAAGATGGA
ATTAGAATAACTTCAATTAAACAGCAGCCGTTATTATCAACTCACAGTGA
CTCCGTAAATTTAGAAGATAAAAATCGGTCTTACAATTTAAGGTCACCGA
TTTCCTCAGGGATTATTCGTAGGAACAATTCATGCAAAGTTGGAGTGTCT
GAATCACTTGGAACACAATCCAGCATAGGTAGTAGAAAATTAAATTCATC
CATTCGAAATCAGCGTTCTTGTTCTTTGATAGAGGAACGAAAGTCAAATC
ATAATAATAATAACTTCGAAACATTGGCGGATTATCGTAATAAACCAAAA
TTGTCTCTTCTTGCCATGAATTCTGGAACTTTTGTAAATCGTCGGGGTAG
TGGGGGTTATTCCTCTGCTCTCAATAGTCCAATTGCTAAATTTGAACCAA
TAACGGCTTTCAATTCTTCGTTTTCAAATCAAAAATCAAAAGAACCTTTT
TCATATTTATCTAATAATATGTTATCGGTGCACAGAAAAAATTTTAACAG
ATATGAATATGGACAACATTCTTTGAAATACAACTCCAATTCTACAACAA
TGCTGTATAATAAATATAATAATATCTCGCCTCCCTGGAATGGAGACGAT
GTAAATAATATGAACCATAACTCCATTTATCCTAACTATGATACAGATTA
TTATTCATACAATACAATGCCGGAACCTTTTGAAGCTTCGATGTTATTTT
TAAAGCATGAACCGAATATCATTGAAAACATGAGCCAAATGTCAGCAAAT
ATGGATTCAAATGTAGATTGTGATTTGCAGAGAAGAGAAGAGATCGTTGA
ATACACTCAGCCGGGTAACATCAGTGGAAGGTCATCGGCGTTCTCCCCAG
TTAATTCTCTACACCAATCTAATGAATCTGTCAATAACTTCCAAATTGCC
ACAAAGTCAAGATCTACATTGGGACTTAATGAACAGCGACTTTACAGTTA
TGACTTTTTATTGGTCTCATCTATACATCTTTATTCGGCTCGACTTTGTC
GGTTTTCTGAAGAAATAGTCCATCGGTTACGGCGTGAAGATCCAGAATAT
AAAGTTAGCTCTCCCATCGATTCAACAATTGACCAATCAGATTCATTCGG
TCAGCTAAAATCAGCCAATCGAGAGCTGCAAGAAACCCTGAATAATATGC
GATCATTAGAAAAACAATTACAGAAAATAGAAAAAGCAGTTTTTCCACCA
GAAAAGAGTGGCCGCAATTCGACATTAGGCAGTTGTACTGAAGATTCTTA
TTTGAATCAATTGGAAAGAATCAACAAAGAATTGGAAGACTTTGTGCCTA
TAGATGATGATAAAGACAACAGAAATACTTGTCTAACAAAACCTTCCATC
AGACAAGAATATTCATTTCTGAAAACGAGTGACACGAAGCCAACCACGCA
AAACAGTATTTCCAAATCACAGCCATCGGGTGAAAAAACCAAAACCAAAG
CGAGAACAAATCCAAAACTCGACCAAACGAAAAACTCATTTTCATCATCT
GAAATTTGCTCACCGACAAAATCCAAGTACTCTTCCTTATCAAAACGATT
TCAGCACCGAAAAGATTAATTTTCAAATCCGTGTAAATGATCTTTCTATT
TTTGCATTTAAATCTTTCCAAAATTATACAAATTTTTCAAAGCCGTTAAA
GGAGTTCCATAGATAATATTTCCGTTTTTTTTTCTACTATTTAGATGAGT
GGATTTGATTTTTCACCGGTGTCACAACCGGACTGTTGAAATCTTCTTTA
CCAAAATGATCAAAGACCTAACGACGTTCCAGCGTTATAATTCAATTCAT
TACTCGAGATTATATTTTACTGATATCGTTTAGTTTTCAGTAAAAACCTC
TGCGC
back to top

protein sequence of SMED30025193-orf-1

>SMED30025193-orf-1 ID=SMED30025193-orf-1|Name=SMED30025193-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1262bp
MLENHFEWYLTDRFGKLYYFDKNKIILGRKDCDIQLKSNSVDYKHCILLI
NEKDKSLKIKDLETSNGTFINEKQIKANHFKILNVGDIIRLAYDQITFTV
QKKSVTCLNATESPSRNAELPSVVTDPERFMQSVVCDLTDSTSEMNSSVE
VIVKKCTEKMKEKPISPKEVEKKTSKFQGIVRNEKKIESVVIQKTKDVQL
KDETNNAPSKPAESFTIDFTSNEVNDSDSLHSASLSRFVPSKLRSSFEGR
DKVNRPKLQSSNSFNKSNDSPRSGIVEKKICVGKPIKTNFSIKTKPNSKP
IETLTKAKTSNGSKKVLEKSPKIKPEPSPKFPQKPFKQTVGKQDKVELIK
SSNNNSKIITPTLSKRNSKSYLLEKMLMGSQSNVDFVDFDECNKNEEKQP
EIILPIISSENFITPNTDEPAKNNQDFNDAISEAGTYVIENETNEKTIDT
EDTLEKDDISTISSTRFNCQELESKSSSKWLSEMPTDDGLMENDCKPKRN
PNAKFTGCSMPHIPSNMPLDSEKSYREESSKITTNILVNDSRTRNPRTAT
YNIGDPNNNLNSEEPNNWTNSESESNKQLGSNSKINFQSHQQTPISPYAM
GNQSLLVAEDVYVADVITNSTVPSSYSRIPNLPQKSKEIDLFSTLNFSST
QPNTNFHPRSTYSVASLDTALLLQDTEALLNDMEKRVYSRREIKTEEFTR
IQPFSTSFPQSEKIPFVDDGEEREEDTSLFNYSTEVEDGIRITSIKQQPL
LSTHSDSVNLEDKNRSYNLRSPISSGIIRRNNSCKVGVSESLGTQSSIGS
RKLNSSIRNQRSCSLIEERKSNHNNNNFETLADYRNKPKLSLLAMNSGTF
VNRRGSGGYSSALNSPIAKFEPITAFNSSFSNQKSKEPFSYLSNNMLSVH
RKNFNRYEYGQHSLKYNSNSTTMLYNKYNNISPPWNGDDVNNMNHNSIYP
NYDTDYYSYNTMPEPFEASMLFLKHEPNIIENMSQMSANMDSNVDCDLQR
REEIVEYTQPGNISGRSSAFSPVNSLHQSNESVNNFQIATKSRSTLGLNE
QRLYSYDFLLVSSIHLYSARLCRFSEEIVHRLRREDPEYKVSSPIDSTID
QSDSFGQLKSANRELQETLNNMRSLEKQLQKIEKAVFPPEKSGRNSTLGS
CTEDSYLNQLERINKELEDFVPIDDDKDNRNTCLTKPSIRQEYSFLKTSD
TKPTTQNSISKSQPSGEKTKTKARTNPKLDQTKNSFSSSEICSPTKSKYS
SLSKRFQHRKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000253FHA_dom
IPR008984SMAD_FHA_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1108..1135
NoneNo IPR availableGENE3DG3DSA:2.60.200.20coord: 4..119
e-value: 1.9E-22
score: 81.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1194..1261
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 256..271
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 520..581
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 246..276
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 530..581
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 308..341
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1228..1251
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1194..1216
NoneNo IPR availablePANTHERPTHR15715CENTROSOMAL PROTEIN OF 170 KDAcoord: 1028..1139
NoneNo IPR availablePANTHERPTHR15715CENTROSOMAL PROTEIN OF 170 KDAcoord: 22..107
NoneNo IPR availablePANTHERPTHR15715:SF40coord: 22..107
coord: 1028..1139
IPR000253Forkhead-associated (FHA) domainSMARTSM00240FHA_2coord: 24..75
e-value: 1.5E-6
score: 37.8
IPR000253Forkhead-associated (FHA) domainPFAMPF00498FHAcoord: 26..91
e-value: 5.9E-14
score: 52.2
IPR000253Forkhead-associated (FHA) domainPROSITEPS50006FHA_DOMAINcoord: 25..75
score: 11.918
IPR000253Forkhead-associated (FHA) domainCDDcd00060FHAcoord: 7..102
e-value: 2.39481E-15
score: 70.8782
IPR008984SMAD/FHA domain superfamilySUPERFAMILYSSF49879SMAD/FHA domaincoord: 9..103