Selenoprotein W

Overview
NameSelenoprotein W
Smed IDSMED30025174
Length (bp)517
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Selenoprotein W (SMED30025174) t-SNE clustered cells

Violin plots show distribution of expression levels for Selenoprotein W (SMED30025174) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Selenoprotein W (SMED30025174) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Selenoprotein W (SMED30025174) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025174

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Category 3 cellSMED30025174 dd_Smed_v6_1908_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30025174 dd_Smed_v6_1908_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30025174 dd_Smed_v6_1908_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30025174 dd_Smed_v6_1908_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025174 dd_Smed_v4_1908_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
head regionSMED30025174 SmedASXL_050756SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30025174SMESG000032005.1 Contig4614uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025174SMESG000032005.1 Contig4614newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025174 Contig47055newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025174 Contig47055uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30025174 dd_Smed_v4_1908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025174 dd_Smed_v4_1908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025174 dd_Smed_v4_1908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30025174 dd_Smed_v4_1908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30025174 dd_Smed_v4_1908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30025174 dd_Smed_v4_1908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025174 dd_Smed_v4_1908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30025174 dd_Smed_v6_1908_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025174 dd_Smed_v6_1908_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Selenoprotein W vs. Ensembl Human
Match: SELENOW (selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752])

HSP 1 Score: 54.6842 bits (130), Expect = 1.112e-14
Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 1
Query:  220 TPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            TP+ TG+FEV V GKL+HSKK GDG+VD + K  K+  AI  A
Sbjct:   41 TPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAA 83          

HSP 2 Score: 43.5134 bits (101), Expect = 1.112e-14
Identity = 19/39 (48.72%), Postives = 26/39 (66.67%), Query Frame = 2
Query:   50 MSVKINVVYCGA*GYSSKFQSFKKDLELKFPQKLTFVGD 166
            M++ + VVYCGA GY SK+   KK LE +FP +L   G+
Sbjct:    1 MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGE 39          
BLAST of Selenoprotein W vs. Ensembl Human
Match: SELENOW (selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752])

HSP 1 Score: 54.6842 bits (130), Expect = 1.112e-14
Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 1
Query:  220 TPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            TP+ TG+FEV V GKL+HSKK GDG+VD + K  K+  AI  A
Sbjct:   41 TPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAA 83          

HSP 2 Score: 43.5134 bits (101), Expect = 1.112e-14
Identity = 19/39 (48.72%), Postives = 26/39 (66.67%), Query Frame = 2
Query:   50 MSVKINVVYCGA*GYSSKFQSFKKDLELKFPQKLTFVGD 166
            M++ + VVYCGA GY SK+   KK LE +FP +L   G+
Sbjct:    1 MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGE 39          
BLAST of Selenoprotein W vs. Ensembl Human
Match: SELENOW (selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752])

HSP 1 Score: 54.6842 bits (130), Expect = 1.112e-14
Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 1
Query:  220 TPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            TP+ TG+FEV V GKL+HSKK GDG+VD + K  K+  AI  A
Sbjct:   41 TPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAA 83          

HSP 2 Score: 43.5134 bits (101), Expect = 1.112e-14
Identity = 19/39 (48.72%), Postives = 26/39 (66.67%), Query Frame = 2
Query:   50 MSVKINVVYCGA*GYSSKFQSFKKDLELKFPQKLTFVGD 166
            M++ + VVYCGA GY SK+   KK LE +FP +L   G+
Sbjct:    1 MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGE 39          
BLAST of Selenoprotein W vs. Ensembl Human
Match: SELENOW (selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752])

HSP 1 Score: 54.6842 bits (130), Expect = 2.754e-13
Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 1
Query:  220 TPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            TP+ TG+FEV V GKL+HSKK GDG+VD + K  K+  AI  A
Sbjct:   42 TPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAA 84          

HSP 2 Score: 38.891 bits (89), Expect = 2.754e-13
Identity = 19/40 (47.50%), Postives = 26/40 (65.00%), Query Frame = 2
Query:   50 MSVKINVVYC-GA*GYSSKFQSFKKDLELKFPQKLTFVGD 166
            M++ + VVYC GA GY SK+   KK LE +FP +L   G+
Sbjct:    1 MALAVRVVYCCGAGGYKSKYLQLKKKLEDEFPGRLDICGE 40          
BLAST of Selenoprotein W vs. Ensembl Human
Match: SELENOV (selenoprotein V [Source:HGNC Symbol;Acc:HGNC:30399])

HSP 1 Score: 49.6766 bits (117), Expect = 6.877e-11
Identity = 24/40 (60.00%), Postives = 29/40 (72.50%), Query Frame = 1
Query:  226 KKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITE 345
            + TG FEV VNG+LVHSKK GDGFV N+ + +KI   I E
Sbjct:  303 QATGEFEVFVNGRLVHSKKRGDGFV-NESRLQKIVSVIDE 341          

HSP 2 Score: 35.4242 bits (80), Expect = 6.877e-11
Identity = 18/40 (45.00%), Postives = 22/40 (55.00%), Query Frame = 2
Query:   56 VKINVVYCGA*GYSSKFQSFKKDLELKFPQKLTFVGDFSA 175
            V I V YCG   YS ++   KK LE +FP  L F  D +A
Sbjct:  263 VLIRVTYCGLUSYSLRYILLKKSLEQQFPNHLLFEEDRAA 302          
BLAST of Selenoprotein W vs. Ensembl Zebrafish
Match: selenow1 (selenoprotein W, 1 [Source:NCBI gene;Acc:352915])

HSP 1 Score: 70.4774 bits (171), Expect = 3.363e-19
Identity = 33/47 (70.21%), Postives = 36/47 (76.60%), Query Frame = 1
Query:  208 TSSATPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            T   TP  TGW EVEVNGKLVHSKKNGDGFVD+D K +KI  AI +A
Sbjct:   37 TGEGTPSTTGWLEVEVNGKLVHSKKNGDGFVDSDSKMQKIVTAIEQA 83          

HSP 2 Score: 42.3578 bits (98), Expect = 3.363e-19
Identity = 19/39 (48.72%), Postives = 25/39 (64.10%), Query Frame = 2
Query:   50 MSVKINVVYCGA*GYSSKFQSFKKDLELKFPQKLTFVGD 166
            M+VK++VVYCG  GY  KF   K  LE +FP +L   G+
Sbjct:    1 MTVKVHVVYCGGUGYRPKFIKLKTLLEDEFPNELEITGE 39          
BLAST of Selenoprotein W vs. Ensembl Mouse
Match: Selenow (selenoprotein W [Source:MGI Symbol;Acc:MGI:1100878])

HSP 1 Score: 55.4546 bits (132), Expect = 9.088e-14
Identity = 26/43 (60.47%), Postives = 31/43 (72.09%), Query Frame = 1
Query:  220 TPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            TP+ TG+FEV V GKLVHSKK GDG+VD + K  K+  AI  A
Sbjct:   41 TPQVTGFFEVTVAGKLVHSKKRGDGYVDTESKFRKLVTAIKAA 83          

HSP 2 Score: 38.891 bits (89), Expect = 9.088e-14
Identity = 17/39 (43.59%), Postives = 24/39 (61.54%), Query Frame = 2
Query:   50 MSVKINVVYCGA*GYSSKFQSFKKDLELKFPQKLTFVGD 166
            M++ + VVYCGA GY  K+   K+ LE +FP  L   G+
Sbjct:    1 MALAVRVVYCGAUGYKPKYLQLKEKLEHEFPGCLDICGE 39          
BLAST of Selenoprotein W vs. Ensembl Mouse
Match: Selenov (selenoprotein V [Source:MGI Symbol;Acc:MGI:3608324])

HSP 1 Score: 45.8246 bits (107), Expect = 9.009e-8
Identity = 24/38 (63.16%), Postives = 27/38 (71.05%), Query Frame = 1
Query:  232 TGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITE 345
            TG FEV V+GKL+HSKK GDGFVD    K K+  AI E
Sbjct:  287 TGEFEVFVDGKLIHSKKKGDGFVDESGLK-KLVGAIDE 323          

HSP 2 Score: 28.1054 bits (61), Expect = 9.009e-8
Identity = 13/32 (40.62%), Postives = 18/32 (56.25%), Query Frame = 2
Query:   62 INVVYCGA*GYSSKFQSFKKDLELKFPQKLTF 157
            I V+YCG   Y  ++   K+ LE +FP  L F
Sbjct:  247 IRVMYCGLUSYGLRYIILKRTLEHQFPNLLEF 278          
BLAST of Selenoprotein W vs. UniProt/SwissProt
Match: sp|Q568W0|SELW_DANRE (Selenoprotein W OS=Danio rerio OX=7955 GN=selenow PE=3 SV=3)

HSP 1 Score: 70.8626 bits (172), Expect = 1.465e-18
Identity = 33/47 (70.21%), Postives = 36/47 (76.60%), Query Frame = 1
Query:  208 TSSATPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            T   TP  TGW EVEVNGKLVHSKKNGDGFVD+D K +KI  AI +A
Sbjct:   37 TGEGTPSTTGWLEVEVNGKLVHSKKNGDGFVDSDSKMQKIMTAIEQA 83          

HSP 2 Score: 42.3578 bits (98), Expect = 1.465e-18
Identity = 19/39 (48.72%), Postives = 25/39 (64.10%), Query Frame = 2
Query:   50 MSVKINVVYCGA*GYSSKFQSFKKDLELKFPQKLTFVGD 166
            M+VK++VVYCG  GY  KF   K  LE +FP +L   G+
Sbjct:    1 MTVKVHVVYCGGUGYRPKFIKLKTLLEDEFPNELEITGE 39          
BLAST of Selenoprotein W vs. UniProt/SwissProt
Match: sp|D0EYG3|SELW_CHICK (Selenoprotein W OS=Gallus gallus OX=9031 GN=SELENOW PE=2 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 2.131e-14
Identity = 27/43 (62.79%), Postives = 31/43 (72.09%), Query Frame = 1
Query:  220 TPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            T + TGWFEV V  +LVHSKKNGDGFVD D K ++I  AI  A
Sbjct:   41 TQEVTGWFEVTVGSRLVHSKKNGDGFVDTDAKLQRIVAAIQAA 83          

HSP 2 Score: 40.4318 bits (93), Expect = 2.131e-14
Identity = 15/38 (39.47%), Postives = 24/38 (63.16%), Query Frame = 2
Query:   50 MSVKINVVYCGA*GYSSKFQSFKKDLELKFPQKLTFVG 163
            M +++ V+YCGA GY  K++  + +LE +FP  L   G
Sbjct:    1 MPLRVTVLYCGAUGYKPKYERLRAELEKRFPGALEMRG 38          
BLAST of Selenoprotein W vs. UniProt/SwissProt
Match: sp|Q95KL4|SELW_PIG (Selenoprotein W OS=Sus scrofa OX=9823 GN=SELENOW PE=3 SV=4)

HSP 1 Score: 54.299 bits (129), Expect = 3.690e-14
Identity = 26/43 (60.47%), Postives = 31/43 (72.09%), Query Frame = 1
Query:  220 TPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            TP+ TG+FEV V GKLVHSKK GDG+VD + K  K+  AI  A
Sbjct:   41 TPQVTGFFEVLVAGKLVHSKKGGDGYVDTESKFLKLVAAIKAA 83          

HSP 2 Score: 43.8986 bits (102), Expect = 3.690e-14
Identity = 20/39 (51.28%), Postives = 25/39 (64.10%), Query Frame = 2
Query:   50 MSVKINVVYCGA*GYSSKFQSFKKDLELKFPQKLTFVGD 166
            M V + VVYCGA GY SK+   KK LE +FP +L   G+
Sbjct:    1 MGVAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGE 39          
BLAST of Selenoprotein W vs. UniProt/SwissProt
Match: sp|Q5NVB2|SELW_PONAB (Selenoprotein W OS=Pongo abelii OX=9601 GN=SELENOW PE=3 SV=4)

HSP 1 Score: 54.6842 bits (130), Expect = 4.347e-14
Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 1
Query:  220 TPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            TP+ TG+FEV V GKL+HSKK GDG+VD + K  K+  AI  A
Sbjct:   41 TPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAA 83          

HSP 2 Score: 43.5134 bits (101), Expect = 4.347e-14
Identity = 19/39 (48.72%), Postives = 26/39 (66.67%), Query Frame = 2
Query:   50 MSVKINVVYCGA*GYSSKFQSFKKDLELKFPQKLTFVGD 166
            M++ + VVYCGA GY SK+   KK LE +FP +L   G+
Sbjct:    1 MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGE 39          
BLAST of Selenoprotein W vs. UniProt/SwissProt
Match: sp|P63303|SELW_MACMU (Selenoprotein W OS=Macaca mulatta OX=9544 GN=SELENOW PE=1 SV=3)

HSP 1 Score: 54.6842 bits (130), Expect = 4.347e-14
Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 1
Query:  220 TPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            TP+ TG+FEV V GKL+HSKK GDG+VD + K  K+  AI  A
Sbjct:   41 TPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAA 83          

HSP 2 Score: 43.5134 bits (101), Expect = 4.347e-14
Identity = 19/39 (48.72%), Postives = 26/39 (66.67%), Query Frame = 2
Query:   50 MSVKINVVYCGA*GYSSKFQSFKKDLELKFPQKLTFVGD 166
            M++ + VVYCGA GY SK+   KK LE +FP +L   G+
Sbjct:    1 MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGE 39          
BLAST of Selenoprotein W vs. TrEMBL
Match: F6NSR1 (Selenoprotein W, 1 OS=Danio rerio OX=7955 GN=selenow1 PE=1 SV=3)

HSP 1 Score: 70.4774 bits (171), Expect = 3.178e-16
Identity = 33/47 (70.21%), Postives = 36/47 (76.60%), Query Frame = 1
Query:  208 TSSATPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            T   TP  TGW EVEVNGKLVHSKKNGDGFVD+D K +KI  AI +A
Sbjct:   37 TGEGTPSTTGWLEVEVNGKLVHSKKNGDGFVDSDSKMQKIVTAIEQA 83          

HSP 2 Score: 42.3578 bits (98), Expect = 3.178e-16
Identity = 19/39 (48.72%), Postives = 25/39 (64.10%), Query Frame = 2
Query:   50 MSVKINVVYCGA*GYSSKFQSFKKDLELKFPQKLTFVGD 166
            M+VK++VVYCG  GY  KF   K  LE +FP +L   G+
Sbjct:    1 MTVKVHVVYCGGCGYRPKFIKLKTLLEDEFPNELEITGE 39          
BLAST of Selenoprotein W vs. TrEMBL
Match: Q802G9 (Selenoprotein W, 1 OS=Danio rerio OX=7955 GN=selenow1 PE=2 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 3.205e-16
Identity = 33/47 (70.21%), Postives = 36/47 (76.60%), Query Frame = 1
Query:  208 TSSATPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            T   TP  TGW EVEVNGKLVHSKKNGDGFVD+D K +KI  AI +A
Sbjct:   37 TGEGTPSTTGWLEVEVNGKLVHSKKNGDGFVDSDSKMQKIVTAIEQA 83          

HSP 2 Score: 42.3578 bits (98), Expect = 3.205e-16
Identity = 19/39 (48.72%), Postives = 25/39 (64.10%), Query Frame = 2
Query:   50 MSVKINVVYCGA*GYSSKFQSFKKDLELKFPQKLTFVGD 166
            M+VK++VVYCG  GY  KF   K  LE +FP +L   G+
Sbjct:    1 MTVKVHVVYCGGUGYRPKFIKLKTLLEDEFPNELEITGE 39          
BLAST of Selenoprotein W vs. TrEMBL
Match: A0A1B2LPW5 (Selenoprotein W OS=Chanodichthys ilishaeformis OX=291482 GN=SelW PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 5.276e-15
Identity = 32/47 (68.09%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  208 TSSATPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            T   TP  TGW EVEVNGKLVHSKKNGDGFVD D K   I  AI +A
Sbjct:   37 TGEGTPSTTGWLEVEVNGKLVHSKKNGDGFVDTDSKFRAIVTAIEQA 83          

HSP 2 Score: 42.3578 bits (98), Expect = 5.276e-15
Identity = 18/39 (46.15%), Postives = 25/39 (64.10%), Query Frame = 2
Query:   50 MSVKINVVYCGA*GYSSKFQSFKKDLELKFPQKLTFVGD 166
            M+VK+++VYCG  GY  KF   K  LE +FP +L   G+
Sbjct:    1 MTVKVHIVYCGGUGYRPKFTKLKTLLEDEFPGELEITGE 39          
BLAST of Selenoprotein W vs. TrEMBL
Match: A0A4W4EEZ4 (Uncharacterized protein OS=Electrophorus electricus OX=8005 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 9.472e-15
Identity = 35/47 (74.47%), Postives = 38/47 (80.85%), Query Frame = 1
Query:  208 TSSATPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            T  ATP  +GWFEVEVNGKLVHSKKNGDGFVDND+K  K+  AI EA
Sbjct:   16 TGEATPTMSGWFEVEVNGKLVHSKKNGDGFVDNDQKMAKLVKAIKEA 62          
BLAST of Selenoprotein W vs. TrEMBL
Match: A0A2D0QC22 (selenoprotein W-like OS=Ictalurus punctatus OX=7998 GN=LOC108260245 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 3.903e-14
Identity = 34/47 (72.34%), Postives = 37/47 (78.72%), Query Frame = 1
Query:  208 TSSATPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            TS  TP  TGWFEV+VNG LVHSKKNGDGFVDND+K  KI  AI +A
Sbjct:   90 TSEGTPTTTGWFEVQVNGTLVHSKKNGDGFVDNDQKLAKIVSAIEKA 136          

HSP 2 Score: 32.3426 bits (72), Expect = 3.903e-14
Identity = 14/32 (43.75%), Postives = 19/32 (59.38%), Query Frame = 2
Query:   47 NMSVKINVVYCGA*GYSSKFQSFKKDLELKFP 142
             M+VKI+++YCG  GY  K       LE +FP
Sbjct:   53 EMAVKIHIIYCGGUGYRPKAIKLTTLLEDEFP 84          
BLAST of Selenoprotein W vs. Ensembl Cavefish
Match: selenow1 (selenoprotein W, 1 [Source:NCBI gene;Acc:352915])

HSP 1 Score: 69.707 bits (169), Expect = 4.489e-16
Identity = 31/41 (75.61%), Postives = 36/41 (87.80%), Query Frame = 1
Query:  217 ATPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAI 339
            +TP+ +GWFEVEVNGKLVHSKKNGDGFVD+D+K  KI  AI
Sbjct:   28 STPRTSGWFEVEVNGKLVHSKKNGDGFVDSDQKMAKIVSAI 68          
BLAST of Selenoprotein W vs. Ensembl Cavefish
Match: selenow1 (selenoprotein W, 1 [Source:NCBI gene;Acc:352915])

HSP 1 Score: 69.707 bits (169), Expect = 4.560e-16
Identity = 31/41 (75.61%), Postives = 36/41 (87.80%), Query Frame = 1
Query:  217 ATPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAI 339
            +TP+ +GWFEVEVNGKLVHSKKNGDGFVD+D+K  KI  AI
Sbjct:   24 STPRTSGWFEVEVNGKLVHSKKNGDGFVDSDQKMAKIVSAI 64          
BLAST of Selenoprotein W vs. Ensembl Cavefish
Match: selenow1 (selenoprotein W, 1 [Source:NCBI gene;Acc:352915])

HSP 1 Score: 69.3218 bits (168), Expect = 7.148e-16
Identity = 31/44 (70.45%), Postives = 37/44 (84.09%), Query Frame = 1
Query:  208 TSSATPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAI 339
            +  +TP+ +GWFEVEVNGKLVHSKKNGDGFVD+D+K  KI  AI
Sbjct:   26 SGESTPRTSGWFEVEVNGKLVHSKKNGDGFVDSDQKMAKIVSAI 69          
BLAST of Selenoprotein W vs. Ensembl Nematostella
Match: EDO35675 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKT9])

HSP 1 Score: 65.0846 bits (157), Expect = 9.093e-15
Identity = 30/47 (63.83%), Postives = 39/47 (82.98%), Query Frame = 1
Query:  208 TSSATPKKTGWFEVEVNGKLVHSKKNGDGFVDNDEKKEKIYHAITEA 348
            TS ATP  TG+FEV VN +LVHSKKNGDG+VD+++K  KI+ +IT+A
Sbjct:   18 TSYATPNVTGYFEVSVNDQLVHSKKNGDGYVDSEKKLAKIFDSITKA 64          
The following BLAST results are available for this feature:
BLAST of Selenoprotein W vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SELENOW1.112e-1458.14selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752... [more]
SELENOW1.112e-1458.14selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752... [more]
SELENOW1.112e-1458.14selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752... [more]
SELENOW2.754e-1358.14selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752... [more]
SELENOV6.877e-1160.00selenoprotein V [Source:HGNC Symbol;Acc:HGNC:30399... [more]
back to top
BLAST of Selenoprotein W vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein W vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein W vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
selenow13.363e-1970.21selenoprotein W, 1 [Source:NCBI gene;Acc:352915][more]
back to top
BLAST of Selenoprotein W vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein W vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Selenow9.088e-1460.47selenoprotein W [Source:MGI Symbol;Acc:MGI:1100878... [more]
Selenov9.009e-863.16selenoprotein V [Source:MGI Symbol;Acc:MGI:3608324... [more]
back to top
BLAST of Selenoprotein W vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q568W0|SELW_DANRE1.465e-1870.21Selenoprotein W OS=Danio rerio OX=7955 GN=selenow ... [more]
sp|D0EYG3|SELW_CHICK2.131e-1462.79Selenoprotein W OS=Gallus gallus OX=9031 GN=SELENO... [more]
sp|Q95KL4|SELW_PIG3.690e-1460.47Selenoprotein W OS=Sus scrofa OX=9823 GN=SELENOW P... [more]
sp|Q5NVB2|SELW_PONAB4.347e-1458.14Selenoprotein W OS=Pongo abelii OX=9601 GN=SELENOW... [more]
sp|P63303|SELW_MACMU4.347e-1458.14Selenoprotein W OS=Macaca mulatta OX=9544 GN=SELEN... [more]
back to top
BLAST of Selenoprotein W vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F6NSR13.178e-1670.21Selenoprotein W, 1 OS=Danio rerio OX=7955 GN=selen... [more]
Q802G93.205e-1670.21Selenoprotein W, 1 OS=Danio rerio OX=7955 GN=selen... [more]
A0A1B2LPW55.276e-1568.09Selenoprotein W OS=Chanodichthys ilishaeformis OX=... [more]
A0A4W4EEZ49.472e-1574.47Uncharacterized protein OS=Electrophorus electricu... [more]
A0A2D0QC223.903e-1472.34selenoprotein W-like OS=Ictalurus punctatus OX=799... [more]
back to top
BLAST of Selenoprotein W vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
selenow14.489e-1675.61selenoprotein W, 1 [Source:NCBI gene;Acc:352915][more]
selenow14.560e-1675.61selenoprotein W, 1 [Source:NCBI gene;Acc:352915][more]
selenow17.148e-1670.45selenoprotein W, 1 [Source:NCBI gene;Acc:352915][more]
back to top
BLAST of Selenoprotein W vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein W vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein W vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO356759.093e-1563.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Selenoprotein W vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein W vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025174 ID=SMED30025174|Name=Selenoprotein W|organism=Schmidtea mediterranea sexual|type=transcript|length=517bp
AATTAGTTTAAATTTTGTATTTTTATTGTAAAATATTTGCTAATATAACA
TGTCTGTGAAAATAAACGTAGTTTACTGTGGCGCCTGAGGATACTCGTCT
AAGTTTCAGAGTTTTAAAAAGGACCTGGAACTTAAATTTCCTCAGAAATT
AACTTTTGTGGGTGATTTTTCAGCATGTAAAATCTTAATTTGAGGGTAAA
ATTTCAGACATCGAGTGCCACTCCAAAAAAAACCGGATGGTTCGAGGTTG
AAGTTAATGGAAAACTTGTTCATTCAAAAAAGAACGGCGATGGCTTCGTT
GACAATGATGAGAAGAAGGAAAAAATCTACCATGCCATTACAGAAGCCTT
AAAATAAACAATTTTACTTCTCTAAAATTTTAATCTTTTAGTTATAGAAT
TGATAGCCAATTCTGTGATGGTTATTGATAAAAATCTTTTTTTTGATTTT
CAATAATTTGATGTTATTTGGCTACCAATAAATAGTTTTCATGATTTAAA
AAAAAAAAAAAAAAAAT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0016209antioxidant activity
Vocabulary: biological process
TermDefinition
GO:0098869cellular oxidant detoxification
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR011893Selenoprotein_Rdx-typ
IPR012336Thioredoxin-like_fold
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20