Protein NDRG4

Overview
NameProtein NDRG4
Smed IDSMED30025164
Length (bp)1506
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein NDRG4 (SMED30025164) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein NDRG4 (SMED30025164) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein NDRG4 (SMED30025164) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein NDRG4 (SMED30025164) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025164

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30025164SMESG000065324.1 dd_Smed_v4_2911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025164SMESG000065324.1 dd_Smed_v4_2911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025164SMESG000065324.1 dd_Smed_v4_2911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30025164SMESG000065324.1 dd_Smed_v4_2911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30025164SMESG000065324.1 dd_Smed_v4_2911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025164SMESG000065324.1 dd_Smed_v4_2911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30025164SMESG000065324.1 dd_Smed_v4_2911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025164SMESG000065324.1 dd_Smed_v4_2911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025164SMESG000065324.1 Contig48789newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025164SMESG000065324.1 Contig48789uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30025164SMESG000065324.1 OX_Smed_1.0.03975ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30025164SMESG000065324.1 dd_Smed_v4_2911_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30025164SMESG000065324.1 dd_Smed_v4_2911_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein NDRG4 vs. Ensembl Human
Match: NDRG1 (N-myc downstream regulated 1 [Source:HGNC Symbol;Acc:HGNC:7679])

HSP 1 Score: 122.865 bits (307), Expect = 4.126e-30
Identity = 84/302 (27.81%), Postives = 142/302 (47.02%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL-------GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLS 1072
            G+++V + GT      +ILT HD+G NH   Y    +   M  ++Q F   HVD PGQ DG       +  PSM+ +A  L  +  Q  L +++  G GAGA IL RFA+N+  +V G +LI+        +    +  ++W  + I G        +V H FG + ++  N E       V+ +++ ++ N +NP NL+ FIN++ +RR+L       G     L  P L + G ++     V      L  TK        ++    G+  +    P K+  + +YF+QG+G + +  ++
Sbjct:   42 GSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLIN--------VNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQ-SNVE-------VVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTK----TTLLKMADCGGLPQI--SQPAKLAEAFKYFVQGMGYMPSASMT 321          
BLAST of Protein NDRG4 vs. Ensembl Human
Match: NDRG1 (N-myc downstream regulated 1 [Source:HGNC Symbol;Acc:HGNC:7679])

HSP 1 Score: 122.865 bits (307), Expect = 4.126e-30
Identity = 84/302 (27.81%), Postives = 142/302 (47.02%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL-------GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLS 1072
            G+++V + GT      +ILT HD+G NH   Y    +   M  ++Q F   HVD PGQ DG       +  PSM+ +A  L  +  Q  L +++  G GAGA IL RFA+N+  +V G +LI+        +    +  ++W  + I G        +V H FG + ++  N E       V+ +++ ++ N +NP NL+ FIN++ +RR+L       G     L  P L + G ++     V      L  TK        ++    G+  +    P K+  + +YF+QG+G + +  ++
Sbjct:   42 GSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLIN--------VNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQ-SNVE-------VVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTK----TTLLKMADCGGLPQI--SQPAKLAEAFKYFVQGMGYMPSASMT 321          
BLAST of Protein NDRG4 vs. Ensembl Human
Match: NDRG3 (NDRG family member 3 [Source:HGNC Symbol;Acc:HGNC:14462])

HSP 1 Score: 115.161 bits (287), Expect = 2.031e-27
Identity = 86/313 (27.48%), Postives = 150/313 (47.92%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRN-------LGERIAK---LNTPTLFITG------AAAIHCKN-VHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSN 1075
            G ++V I+G       +ILT HD+G NH   +  F +   M  ++Q F   HVD PGQ +G     T +  P+M+++A  L  +   + L +++  G GAGA IL+RFA+N   LV G +LI+        ++      I+W  + + G+       ++ H FG + ++           ++I++++ ++   IN  NL  F+NS+  RR+       LG+   K   L   TL + G       A + C + ++ +  TLLK           +    G+  V+   P K+  + +YFLQG+G +  ++LS+
Sbjct:   40 GVVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNAFFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAGAYILSRFALNHPELVEGLVLIN--------VDPCAKGWIDWAASKLSGLTTNVVDIILAHHFGQEELQAN--------LDLIQTYRMHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVECNSRLNPINTTLLK-----------MADCGGLPQVV--QPGKLTEAFKYFLQGMGYIPYVQLSH 323          
BLAST of Protein NDRG4 vs. Ensembl Human
Match: NDRG3 (NDRG family member 3 [Source:HGNC Symbol;Acc:HGNC:14462])

HSP 1 Score: 112.464 bits (280), Expect = 1.197e-26
Identity = 82/312 (26.28%), Postives = 146/312 (46.79%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL----------GERIAKLNTPTLFITG------AAAIHCKN-VHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLS 1072
            G ++V I+G       +ILT HD+G NH   +  F +   M  ++Q F   HVD PGQ +G     T +  P+M+++A  L  +   + L +++  G GAGA IL+RFA+N   LV G +LI+        ++      I+W  + + G+       ++ H FG + ++           ++I++++ ++   IN  NL  F+NS+  RR+L            +   L   TL + G       A + C + ++ +  TLLK           +    G+  V+   P K+  + +YFLQG+G + +  ++
Sbjct:   28 GVVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNAFFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAGAYILSRFALNHPELVEGLVLIN--------VDPCAKGWIDWAASKLSGLTTNVVDIILAHHFGQEELQAN--------LDLIQTYRMHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVECNSRLNPINTTLLK-----------MADCGGLPQVV--QPGKLTEAFKYFLQGMGYIPSASMT 310          
BLAST of Protein NDRG4 vs. Ensembl Human
Match: NDRG3 (NDRG family member 3 [Source:HGNC Symbol;Acc:HGNC:14462])

HSP 1 Score: 112.079 bits (279), Expect = 1.690e-26
Identity = 82/312 (26.28%), Postives = 146/312 (46.79%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL----------GERIAKLNTPTLFITG------AAAIHCKN-VHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLS 1072
            G ++V I+G       +ILT HD+G NH   +  F +   M  ++Q F   HVD PGQ +G     T +  P+M+++A  L  +   + L +++  G GAGA IL+RFA+N   LV G +LI+        ++      I+W  + + G+       ++ H FG + ++           ++I++++ ++   IN  NL  F+NS+  RR+L            +   L   TL + G       A + C + ++ +  TLLK           +    G+  V+   P K+  + +YFLQG+G + +  ++
Sbjct:   40 GVVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNAFFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAGAYILSRFALNHPELVEGLVLIN--------VDPCAKGWIDWAASKLSGLTTNVVDIILAHHFGQEELQAN--------LDLIQTYRMHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVECNSRLNPINTTLLK-----------MADCGGLPQVV--QPGKLTEAFKYFLQGMGYIPSASMT 322          
BLAST of Protein NDRG4 vs. Ensembl Celegans
Match: ZK1073.1 (pep chromosome:WBcel235:X:16124151:16128865:-1 gene:WBGene00014213.1 transcript:ZK1073.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK1073.1)

HSP 1 Score: 197.978 bits (502), Expect = 6.160e-59
Identity = 114/327 (34.86%), Postives = 186/327 (56.88%), Query Frame = 2
Query:  164 NEQKVALKLPKMGAINVYIQGT---RGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNFPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIA-KLNT-PTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPR 1129
            N Q V ++    G ++VY+QG    RG K  IILTVHD+G NH  +  F+++P M+ + +K +++HV +PGQ D   D   +FP+++ I  DL  +  + ++ + + FGEG GANI+ RFA+   + ++G +L+HC  +TA +IE  K+KV+N +L +  M+  A  YL+ H+FG +S   K+ +   E           L+ ++NPKNL K++ +F  R +L   I  KL T   L +TG+ A H   V+   +++        K K  L+ +D VA+V+ EAP+K+  SL    +G G++S + +     +     SME+ DRPR
Sbjct:    5 NLQMVVVQAQNCGVLHVYVQGNLEERGGK-TIILTVHDIGTNHKSFVRFVNHPSMATVKEKAIFLHVCVPGQEDNSADFFGDFPTLDGIGDDLSAVLDKFEVKSAIAFGEGVGANIICRFAMGHPNRIMGIVLVHCTSTTAGIIEYCKEKVMNMRLENSIMSDGAWDYLLAHKFGGES---KSRQEYLE----------ELKATLNPKNLSKYLVAFTKRTDLSSTIGTKLETVDALLVTGSKASHLHTVYTTHKSM-------NKKKTTLLVVDNVADVMQEAPDKLARSLILLCKGCGVLSGVAIPGMERQRTLSSSMEEADRPR 310          
BLAST of Protein NDRG4 vs. Ensembl Celegans
Match: ZK1073.1 (pep chromosome:WBcel235:X:16123942:16128815:-1 gene:WBGene00014213.1 transcript:ZK1073.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK1073.1)

HSP 1 Score: 197.978 bits (502), Expect = 6.160e-59
Identity = 114/327 (34.86%), Postives = 186/327 (56.88%), Query Frame = 2
Query:  164 NEQKVALKLPKMGAINVYIQGT---RGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNFPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIA-KLNT-PTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPR 1129
            N Q V ++    G ++VY+QG    RG K  IILTVHD+G NH  +  F+++P M+ + +K +++HV +PGQ D   D   +FP+++ I  DL  +  + ++ + + FGEG GANI+ RFA+   + ++G +L+HC  +TA +IE  K+KV+N +L +  M+  A  YL+ H+FG +S   K+ +   E           L+ ++NPKNL K++ +F  R +L   I  KL T   L +TG+ A H   V+   +++        K K  L+ +D VA+V+ EAP+K+  SL    +G G++S + +     +     SME+ DRPR
Sbjct:    5 NLQMVVVQAQNCGVLHVYVQGNLEERGGK-TIILTVHDIGTNHKSFVRFVNHPSMATVKEKAIFLHVCVPGQEDNSADFFGDFPTLDGIGDDLSAVLDKFEVKSAIAFGEGVGANIICRFAMGHPNRIMGIVLVHCTSTTAGIIEYCKEKVMNMRLENSIMSDGAWDYLLAHKFGGES---KSRQEYLE----------ELKATLNPKNLSKYLVAFTKRTDLSSTIGTKLETVDALLVTGSKASHLHTVYTTHKSM-------NKKKTTLLVVDNVADVMQEAPDKLARSLILLCKGCGVLSGVAIPGMERQRTLSSSMEEADRPR 310          
BLAST of Protein NDRG4 vs. Ensembl Celegans
Match: Y48G10A.3 (pep chromosome:WBcel235:I:13471683:13474185:-1 gene:WBGene00013020.1 transcript:Y48G10A.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y48G10A.3)

HSP 1 Score: 119.013 bits (297), Expect = 1.606e-29
Identity = 88/312 (28.21%), Postives = 151/312 (48.40%), Query Frame = 2
Query:  197 MGAINVYIQGTRG-PKEQIILTVHDLGCN-HYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL-----GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQI-DGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRM 1102
             GAI V I G R  PK+  ++T HDLG +    ++ F     ++  + KF   +V+ PGQ    + L  NF  P+M+ IA  ++ +    KL+  + FG G GAN+L R+A  +++ V+  +L++C    +  +E   +K     L  +GM      YL+ H FG      +N +  +   +++  ++   ++  NP +L +FI S++ R  L     G    +L  P L + GA + H ++     E   K  PA      + ++I D    VL + P+ V  S+  FLQGLG    L +    +K+ ++M
Sbjct:   33 FGAIKVSIYGDRNDPKKVPMVTFHDLGLDSESNFQNFFQFVSIAEFADKFCIYNVNAPGQEMDAQPLPENFTYPTMDGIAKTIESVADHFKLNQFIGFGVGVGANVLLRYAAQNQNRVIALVLVNCCSGKSGWVEWGYEKWNTSYLRKVGMTKFTVDYLMWHHFG------RNYDRCS--PDIVRQYRVFFQHLPNPNSLAEFIESYIQRTPLPISRDGTTGVQLKVPVLQLVGAGSAHVEDT---VEVNTKLDPAHA----DWIKISDSCGLVLDDRPDAVTESMMLFLQGLGYFPTLNV----MKMTKKM 325          
BLAST of Protein NDRG4 vs. Ensembl Fly
Match: CG2082 (gene:FBgn0027608 transcript:FBtr0078672)

HSP 1 Score: 192.2 bits (487), Expect = 3.164e-56
Identity = 115/343 (33.53%), Postives = 191/343 (55.69%), Query Frame = 2
Query:  167 EQKVALKLPKMGAINVYIQG--TRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNFP--SMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVS-------------------NLRLSNEPIKINRRMSMEDYDRP 1126
            E+K  +   K G + V +QG  ++  K  + +TVHDLGCNH  ++EF+S+P M+ + ++  +IHVD+PG  D  E L   FP  S++ +  DL  +   + +  V+  GEGAGAN+LARF +     VLG ILI+  GS AS+++S K+K I+WK + +    +AES+L+ H+FG Q +     EN  + K V E ++  L  S+N KN+  ++ +FM R++L  +  K++   + ITG  + +   V  L   +       +K +  +++I+   +VL +AP KV  S+  F +G GL++                   +L  +N   +++R +SMEDYD+P
Sbjct:   19 ERKYNISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEVAQ--SAESFLMYHKFGHQIV----GENPDKEKIVAE-YQKRLHRSLNSKNIGLYVKAFMNRKDLTLKGCKVD--VILITGMLSPYASMVEKLHRDV-------EKERVTILKIERAGDVLADAPGKVAQSILLFCKGQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLSRGISMEDYDKP 345          
BLAST of Protein NDRG4 vs. Ensembl Fly
Match: CG2082 (gene:FBgn0027608 transcript:FBtr0300909)

HSP 1 Score: 192.2 bits (487), Expect = 3.164e-56
Identity = 115/343 (33.53%), Postives = 191/343 (55.69%), Query Frame = 2
Query:  167 EQKVALKLPKMGAINVYIQG--TRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNFP--SMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVS-------------------NLRLSNEPIKINRRMSMEDYDRP 1126
            E+K  +   K G + V +QG  ++  K  + +TVHDLGCNH  ++EF+S+P M+ + ++  +IHVD+PG  D  E L   FP  S++ +  DL  +   + +  V+  GEGAGAN+LARF +     VLG ILI+  GS AS+++S K+K I+WK + +    +AES+L+ H+FG Q +     EN  + K V E ++  L  S+N KN+  ++ +FM R++L  +  K++   + ITG  + +   V  L   +       +K +  +++I+   +VL +AP KV  S+  F +G GL++                   +L  +N   +++R +SMEDYD+P
Sbjct:   19 ERKYNISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEVAQ--SAESFLMYHKFGHQIV----GENPDKEKIVAE-YQKRLHRSLNSKNIGLYVKAFMNRKDLTLKGCKVD--VILITGMLSPYASMVEKLHRDV-------EKERVTILKIERAGDVLADAPGKVAQSILLFCKGQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLSRGISMEDYDKP 345          
BLAST of Protein NDRG4 vs. Ensembl Fly
Match: CG2082 (gene:FBgn0027608 transcript:FBtr0078674)

HSP 1 Score: 189.889 bits (481), Expect = 2.699e-55
Identity = 112/345 (32.46%), Postives = 191/345 (55.36%), Query Frame = 2
Query:  167 EQKVALKLPKMGAINVYIQG--TRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNFP--SMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFG--TQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVS-------------------NLRLSNEPIKINRRMSMEDYDRP 1126
            E+K  +   K G + V +QG  ++  K  + +TVHDLGCNH  ++EF+S+P M+ + ++  +IHVD+PG  D  E L   FP  S++ +  DL  +   + +  V+  GEGAGAN+LARF +     VLG ILI+  GS AS+++S K+K I+WK + +    +AES+L+ H+FG   + I  +N + E     ++  ++  L  S+N KN+  ++ +FM R++L  +  K++   + ITG  + +   V  L   +       +K +  +++I+   +VL +AP KV  S+  F +G GL++                   +L  +N   +++R +SMEDYD+P
Sbjct:   19 ERKYNISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEVAQ--SAESFLMYHKFGHVMEQIVGENPDKE----KIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTLKGCKVD--VILITGMLSPYASMVEKLHRDV-------EKERVTILKIERAGDVLADAPGKVAQSILLFCKGQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLSRGISMEDYDKP 348          
BLAST of Protein NDRG4 vs. Ensembl Fly
Match: CG2082 (gene:FBgn0027608 transcript:FBtr0300910)

HSP 1 Score: 189.889 bits (481), Expect = 2.699e-55
Identity = 112/345 (32.46%), Postives = 191/345 (55.36%), Query Frame = 2
Query:  167 EQKVALKLPKMGAINVYIQG--TRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNFP--SMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFG--TQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVS-------------------NLRLSNEPIKINRRMSMEDYDRP 1126
            E+K  +   K G + V +QG  ++  K  + +TVHDLGCNH  ++EF+S+P M+ + ++  +IHVD+PG  D  E L   FP  S++ +  DL  +   + +  V+  GEGAGAN+LARF +     VLG ILI+  GS AS+++S K+K I+WK + +    +AES+L+ H+FG   + I  +N + E     ++  ++  L  S+N KN+  ++ +FM R++L  +  K++   + ITG  + +   V  L   +       +K +  +++I+   +VL +AP KV  S+  F +G GL++                   +L  +N   +++R +SMEDYD+P
Sbjct:   19 ERKYNISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEVAQ--SAESFLMYHKFGHVMEQIVGENPDKE----KIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTLKGCKVD--VILITGMLSPYASMVEKLHRDV-------EKERVTILKIERAGDVLADAPGKVAQSILLFCKGQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLSRGISMEDYDKP 348          
BLAST of Protein NDRG4 vs. Ensembl Fly
Match: CG2082 (gene:FBgn0027608 transcript:FBtr0078675)

HSP 1 Score: 189.504 bits (480), Expect = 3.872e-55
Identity = 113/334 (33.83%), Postives = 187/334 (55.99%), Query Frame = 2
Query:  194 KMGAINVYIQG--TRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNFP--SMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVS-------------------NLRLSNEPIKINRRMSMEDYDRP 1126
            K G + V +QG  ++  K  + +TVHDLGCNH  ++EF+S+P M+ + ++  +IHVD+PG  D  E L   FP  S++ +  DL  +   + +  V+  GEGAGAN+LARF +     VLG ILI+  GS AS+++S K+K I+WK + +    +AES+L+ H+FG Q +     EN  + K V E ++  L  S+N KN+  ++ +FM R++L  +  K++   + ITG  + +   V  L   +       +K +  +++I+   +VL +AP KV  S+  F +G GL++                   +L  +N   +++R +SMEDYD+P
Sbjct:   32 KCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEVAQ--SAESFLMYHKFGHQIV----GENPDKEKIVAE-YQKRLHRSLNSKNIGLYVKAFMNRKDLTLKGCKVD--VILITGMLSPYASMVEKLHRDV-------EKERVTILKIERAGDVLADAPGKVAQSILLFCKGQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLSRGISMEDYDKP 349          
BLAST of Protein NDRG4 vs. Ensembl Zebrafish
Match: ndrg3b (ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5606])

HSP 1 Score: 119.398 bits (298), Expect = 3.452e-29
Identity = 98/355 (27.61%), Postives = 162/355 (45.63%), Query Frame = 2
Query:  170 QKVALKLPKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLG-ER---------IAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLV---SNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSSLQSPIKISTLD 1186
            Q+  ++ P+ G ++V ++GT      +ILT HD+G NH   +    +   M  ++Q F  +HVD PGQ +      T F  P+M+++A  L  +   +K+++V+  G GAGA IL RFA+N   LV G +LI+        I+    K+  W  N I +       ++ H F T  +        TE + +I++++ ++   IN  NL  F  S+ +RR+L  ER         +  L  P L I G  +   + V      L  TK        ++    G+  V+   P K+  + +YF+QG+G +   S  RL+    + +   SM   D  R     SS ++       LD
Sbjct:   31 QEHDIETPR-GVLHVTLRGTPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMQEITQHFAVVHVDAPGQQESAPPFPTGFLYPTMDELAEMLPSVLTHLKINSVIGIGVGAGAYILTRFALNEPALVEGLVLINVDPCAKGWIDWAASKLSGWTSNLIDI-------VMAHHFSTDEL--------TENQEIIQTYRLHIAQDINQDNLALFCQSYNSRRDLEIERPVLGMNENAVKTLKCPALLIVGDTSPAVEAVVECNSRLNPTK----TTLLKMADCGGLPQVV--QPGKLAEAFKYFVQGMGYMPTASMTRLARS--RTHSASSMGSGDGSRSRTQTSSQMEGATGGPALD 361          
BLAST of Protein NDRG4 vs. Ensembl Zebrafish
Match: ndrg3b (ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5606])

HSP 1 Score: 119.398 bits (298), Expect = 3.452e-29
Identity = 98/355 (27.61%), Postives = 162/355 (45.63%), Query Frame = 2
Query:  170 QKVALKLPKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLG-ER---------IAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLV---SNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSSLQSPIKISTLD 1186
            Q+  ++ P+ G ++V ++GT      +ILT HD+G NH   +    +   M  ++Q F  +HVD PGQ +      T F  P+M+++A  L  +   +K+++V+  G GAGA IL RFA+N   LV G +LI+        I+    K+  W  N I +       ++ H F T  +        TE + +I++++ ++   IN  NL  F  S+ +RR+L  ER         +  L  P L I G  +   + V      L  TK        ++    G+  V+   P K+  + +YF+QG+G +   S  RL+    + +   SM   D  R     SS ++       LD
Sbjct:   31 QEHDIETPR-GVLHVTLRGTPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMQEITQHFAVVHVDAPGQQESAPPFPTGFLYPTMDELAEMLPSVLTHLKINSVIGIGVGAGAYILTRFALNEPALVEGLVLINVDPCAKGWIDWAASKLSGWTSNLIDI-------VMAHHFSTDEL--------TENQEIIQTYRLHIAQDINQDNLALFCQSYNSRRDLEIERPVLGMNENAVKTLKCPALLIVGDTSPAVEAVVECNSRLNPTK----TTLLKMADCGGLPQVV--QPGKLAEAFKYFVQGMGYMPTASMTRLARS--RTHSASSMGSGDGSRSRTQTSSQMEGATGGPALD 361          
BLAST of Protein NDRG4 vs. Ensembl Zebrafish
Match: ndrg3a (ndrg family member 3a [Source:ZFIN;Acc:ZDB-GENE-980526-124])

HSP 1 Score: 117.087 bits (292), Expect = 1.728e-28
Identity = 88/305 (28.85%), Postives = 149/305 (48.85%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSN-PKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLG-ER-IAKLN--------TPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSN 1075
            G ++V ++G+      +ILT HD+G NH      L N   M  ++Q F  +HVD PGQ +G     T +  P+M+++A  L  +  Q+K+++V+  G GAGA IL RFA+    LV G +LI+        I+    K+  W  N + +       ++ H F T+ +        T+ + +I++++ ++   IN  NL  F  S+  R++LG ER IA LN         P L + G  +   + V      L  TK        ++    G+  V+   P K+  + +YF+QG+G + ++ LS+
Sbjct:   26 GVLHVTMRGSPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMMEITQHFAVVHVDAPGQQEGGPPFPTGYLYPTMDELAEMLPSVLTQLKVNSVIGIGVGAGAYILTRFALIHPSLVEGLVLINVDPCAEGWIDWAASKLTGWTSNLVDI-------VMAHHFSTEEL--------TDNQELIQTYRLHIAQDINQDNLALFCGSYNARQDLGIERPIAGLNENIVKTLTCPALLVVGDTSPAVEAVVECNSRLNPTK----TTLLKMADCGGLPQVVQ--PGKLAEAFKYFVQGMGYIPHVLLSH 309          
BLAST of Protein NDRG4 vs. Ensembl Zebrafish
Match: ndrg3a (ndrg family member 3a [Source:ZFIN;Acc:ZDB-GENE-980526-124])

HSP 1 Score: 114.39 bits (285), Expect = 1.471e-27
Identity = 84/298 (28.19%), Postives = 144/298 (48.32%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLG-ER-IAKLN--------TPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLV 1054
            G ++V ++G+      +ILT HD+G NH   +    +   M  ++Q F  +HVD PGQ +G     T +  P+M+++A  L  +  Q+K+++V+  G GAGA IL RFA+    LV G +LI+        I+    K+  W  N + +       ++ H F T+ +        T+ + +I++++ ++   IN  NL  F  S+  R++LG ER IA LN         P L + G  +   + V      L  TK        ++    G+  V+   P K+  + +YF+QG+G +
Sbjct:   39 GVLHVTMRGSPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMMEITQHFAVVHVDAPGQQEGGPPFPTGYLYPTMDELAEMLPSVLTQLKVNSVIGIGVGAGAYILTRFALIHPSLVEGLVLINVDPCAEGWIDWAASKLTGWTSNLVDI-------VMAHHFSTEEL--------TDNQELIQTYRLHIAQDINQDNLALFCGSYNARQDLGIERPIAGLNENIVKTLTCPALLVVGDTSPAVEAVVECNSRLNPTK----TTLLKMADCGGLPQVV--QPGKLAEAFKYFVQGMGYI 315          
BLAST of Protein NDRG4 vs. Ensembl Zebrafish
Match: ndrg1b (N-myc downstream regulated 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1648])

HSP 1 Score: 110.153 bits (274), Expect = 4.492e-26
Identity = 93/338 (27.51%), Postives = 151/338 (44.67%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLG-ERIAK--------LNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLV---SNLRLSNEPIKINR--RMSMEDYDRPRGTGSFSSSLQS 1162
            G ++  ++G        ILT HD+G NH   +E    +  M  + Q F   HVD PGQ +G   L T++  PSM+ ++  L  +     L +V+  G GAGANILARFA+    +V G +LI+        ++    K+ +W              ++ H FG + I      N  EL   I +F+  + N+IN  NL +F+ S+ +R++L  ER  +        L  P L I G  +     V  + ++  +  P       ++    G+  V  + P K++ + +YF+QG+G +   S  RL+      N   R      D  RG      S++S
Sbjct:   25 GRVHCTMKGVPKGNRPTILTFHDIGLNHKSCFESMFHHKDMHEILQHFAVCHVDAPGQQEGASTLSTDYTYPSMDQLSESLPMVLNHFGLKSVIGMGVGAGANILARFALKHPDMVEGLVLINMSTQAEGFMDWAAQKITSW-------THALPDTVISHLFGKEEI-----HNNHEL---IATFRQLITNNINQSNLQQFVKSYKSRKDLEIERPVQGGNVNTKTLQCPALLIVGDNS---PAVDAVVDSNSRMNPTTTTF-LKMADCGGLPQV--DQPGKLIEAFKYFIQGMGYMPSASMTRLARSRTASNSSNRTRSGTTDEQRGRSHTDVSMES 341          
BLAST of Protein NDRG4 vs. Ensembl Xenopus
Match: slc15a5 (solute carrier family 15, member 5 [Source:Xenbase;Acc:XB-GENE-6049173])

HSP 1 Score: 105.531 bits (262), Expect = 1.672e-24
Identity = 90/323 (27.86%), Postives = 141/323 (43.65%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL-------GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLV---SNLRLSNEPIKINRRMSMEDYDRPR 1129
            G ++V + GT      +ILT HD+G NH   +    +   M  ++Q F   HVD PGQ +G       +  PSM+ +A  L  +  Q+ L +VL  G GAGA IL RFA+N   +V G +LI+        I    +  ++W    +  N +A     L  F  +   F N E       ++E+++ ++   IN  NL  F+ S+ +RR+L       G     L  P L + G ++     V      L  TK        ++    G   V+   P K+  + +YF+QG+G +   S  RL           S +D +R R
Sbjct:    4 GIVHVTMCGTPKLNRPVILTYHDIGLNHKTCFNSLFNFEDMHEITQHFSVCHVDAPGQQEGAASFPAGYMYPSMDQLAEMLPGVIQQLGLKSVLGLGIGAGAYILTRFALNHPSMVEGLVLIN--------INPCAEGWMDWAATKVSHNRSA-----LLCFVWEMGSFNNHE-------LVETYRQHIVQDINQNNLQLFVKSYNSRRDLEIERPFPGSNTVTLKCPALLVVGDSSPAVDAVVDCNSKLDPTK----TTLLKMSDCGGFPQVVQ--PAKLAEAFKYFVQGMGYMPAASMTRLMRSRTGSAASSSSQDGNRSR 300          
BLAST of Protein NDRG4 vs. Ensembl Xenopus
Match: slc15a5 (solute carrier family 15, member 5 [Source:Xenbase;Acc:XB-GENE-6049173])

HSP 1 Score: 105.531 bits (262), Expect = 2.009e-24
Identity = 90/323 (27.86%), Postives = 141/323 (43.65%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL-------GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLV---SNLRLSNEPIKINRRMSMEDYDRPR 1129
            G ++V + GT      +ILT HD+G NH   +    +   M  ++Q F   HVD PGQ +G       +  PSM+ +A  L  +  Q+ L +VL  G GAGA IL RFA+N   +V G +LI+        I    +  ++W    +  N +A     L  F  +   F N E       ++E+++ ++   IN  NL  F+ S+ +RR+L       G     L  P L + G ++     V      L  TK        ++    G   V+   P K+  + +YF+QG+G +   S  RL           S +D +R R
Sbjct:    4 GIVHVTMCGTPKLNRPVILTYHDIGLNHKTCFNSLFNFEDMHEITQHFSVCHVDAPGQQEGAASFPAGYMYPSMDQLAEMLPGVIQQLGLKSVLGLGIGAGAYILTRFALNHPSMVEGLVLIN--------INPCAEGWMDWAATKVSHNRSA-----LLCFVWEMGSFNNHE-------LVETYRQHIVQDINQNNLQLFVKSYNSRRDLEIERPFPGSNTVTLKCPALLVVGDSSPAVDAVVDCNSKLDPTK----TTLLKMSDCGGFPQVVQ--PAKLAEAFKYFVQGMGYMPAASMTRLMRSRTGSAASSSSQDGNRSR 300          
BLAST of Protein NDRG4 vs. Ensembl Xenopus
Match: slc15a5 (solute carrier family 15, member 5 [Source:Xenbase;Acc:XB-GENE-6049173])

HSP 1 Score: 105.145 bits (261), Expect = 2.697e-24
Identity = 90/323 (27.86%), Postives = 141/323 (43.65%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL-------GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLV---SNLRLSNEPIKINRRMSMEDYDRPR 1129
            G ++V + GT      +ILT HD+G NH   +    +   M  ++Q F   HVD PGQ +G       +  PSM+ +A  L  +  Q+ L +VL  G GAGA IL RFA+N   +V G +LI+        I    +  ++W    +  N +A     L  F  +   F N E       ++E+++ ++   IN  NL  F+ S+ +RR+L       G     L  P L + G ++     V      L  TK        ++    G   V+   P K+  + +YF+QG+G +   S  RL           S +D +R R
Sbjct:    4 GIVHVTMCGTPKLNRPVILTYHDIGLNHKTCFNSLFNFEDMHEITQHFSVCHVDAPGQQEGAASFPAGYMYPSMDQLAEMLPGVIQQLGLKSVLGLGIGAGAYILTRFALNHPSMVEGLVLIN--------INPCAEGWMDWAATKVSHNRSA-----LLCFVWEMGSFNNHE-------LVETYRQHIVQDINQNNLQLFVKSYNSRRDLEIERPFPGSNTVTLKCPALLVVGDSSPAVDAVVDCNSKLDPTK----TTLLKMSDCGGFPQVVQ--PAKLAEAFKYFVQGMGYMPAASMTRLMRSRTGSAASSSSQDGNRSR 300          
BLAST of Protein NDRG4 vs. Ensembl Xenopus
Match: kif1a (kinesin family member 1A [Source:Xenbase;Acc:XB-GENE-960470])

HSP 1 Score: 105.531 bits (262), Expect = 3.686e-24
Identity = 84/335 (25.07%), Postives = 158/335 (47.16%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLG-ER--------IAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRG-TGSFSSSLQSP 1165
            G ++V + G       ++LT HD+G NH   +  F +   M  ++Q F   H+D PGQ +G     T +  P+M+++A  L  +   + L +++  G GAGA +L+RFA+N+  LV G +LI+        I+    K+  W  N +         +VL +       F + E ++ L +++++++ ++   IN  NL  F+ S+ +R++L  ER           +  P L + G ++     V      L  T+        ++    G+   +   P K+  +++YF+QG+G + +++LS+   +     SM    R R  + S S S++ P
Sbjct:   40 GVVHVTMSGNARGNRPVLLTFHDIGLNHKSCFNSFFNFDDMHEITQHFAVCHIDAPGQQEGAPSFPTGYQYPTMDELAEMLCAVLTHLNLRSIIGIGVGAGAYVLSRFALNNPLLVEGLVLINIDPCAKGWIDWAASKLSFWTSNIV--------EIVLGQL------FGDEELQSNL-DLVQTYRLHIAQDINQDNLQLFVTSYNSRKDLEIERPIFGSSTPTNTIKCPVLLVVGDSSPAVDAVVECNSRLDPTR----TTLLKMADCGGLPQAV--QPGKLTEAIKYFVQGMGYIPHVQLSHLSTESVPSASMTRLVRSRTHSASSSGSMEMP 353          
BLAST of Protein NDRG4 vs. Ensembl Xenopus
Match: slc15a5 (solute carrier family 15, member 5 [Source:Xenbase;Acc:XB-GENE-6049173])

HSP 1 Score: 104.76 bits (260), Expect = 5.851e-24
Identity = 89/324 (27.47%), Postives = 140/324 (43.21%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL-------GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLV---SNLRLSNEPIKINRRMSMEDYDRPR 1129
            G ++V + GT      +ILT HD+G NH   +    +   M  ++Q F   HVD PGQ +G       +  PSM+ +A  L  +  Q+ L +VL  G GAGA IL RFA+N   +V G +LI+        I    +  ++W    I G        ++ H F    +   N E       ++E+++ ++   IN  NL  F+ S+ +RR+L       G     L  P L + G ++     V      L  TK        ++    G   V+   P K+  + +YF+QG+G +   S  RL           S +D +R R
Sbjct:   24 GIVHVTMCGTPKLNRPVILTYHDIGLNHKTCFNSLFNFEDMHEITQHFSVCHVDAPGQQEGAASFPAGYMYPSMDQLAEMLPGVIQQLGLKSVLGLGIGAGAYILTRFALNHPSMVEGLVLIN--------INPCAEGWMDWAATKISGWTHALPDMVISHLFSKDEVH-SNHE-------LVETYRQHIVQDINQNNLQLFVKSYNSRRDLEIERPFPGSNTVTLKCPALLVVGDSSPAVDAVVDCNSKLDPTK----TTLLKMSDCGGFPQVV--QPAKLAEAFKYFVQGMGYMPAASMTRLMRSRTGSAASSSSQDGNRSR 325          
BLAST of Protein NDRG4 vs. Ensembl Mouse
Match: Ndrg1 (N-myc downstream regulated gene 1 [Source:MGI Symbol;Acc:MGI:1341799])

HSP 1 Score: 121.324 bits (303), Expect = 9.322e-30
Identity = 93/342 (27.19%), Postives = 154/342 (45.03%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL-------GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSSLQSPIKISTLDEA 1192
            G+++V + GT      +ILT HD+G NH   Y    ++  M  ++Q F   HVD PGQ DG       +  PSM+ +A  L  +  Q  L +V+  G GAGA IL RFA+N+  +V G +L++        +    +  ++W  + I G        +V H FG + I   N E       V+ +++ ++ N +NP NL+ FI+++ +RR+L       G     L  P L + G  +     V      L  TK        ++    G+  +    P K+  + +YF+QG+G + +  ++   +  +R  S        GT S S + + P   S   E 
Sbjct:   42 GSLHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNSEDMQEITQHFAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAEMLPGVLHQFGLKSVIGMGTGAGAYILTRFALNNPEMVEGLVLMN--------VNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEI-HNNVE-------VVHTYRQHILNDMNPSNLHLFISAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDNSPAVDAVVECNSKLDPTK----TTLLKMADCGGLPQI--SQPAKLAEAFKYFVQGMGYMPSASMTR--LMRSRTASGSSVTSLEGTRSRSHTSEGPRSRSHTSEG 359          
BLAST of Protein NDRG4 vs. Ensembl Mouse
Match: Ndrg3 (N-myc downstream regulated gene 3 [Source:MGI Symbol;Acc:MGI:1352499])

HSP 1 Score: 112.079 bits (279), Expect = 1.774e-26
Identity = 83/313 (26.52%), Postives = 146/313 (46.65%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL----------GERIAKLNTPTLFITG------AAAIHCKN-VHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSN 1075
            G ++V I+G       +ILT HD+G NH   +  F +   M  ++Q F   HVD PGQ +      T +  P+M+++A  L  +   + + +++  G GAGA IL+RFA+N   LV G +LI+        I+      I+W  + + G        ++ H FG + ++           ++I++++ ++   IN +NL  F+ S+  RR+L            R+  L   TL + G       A + C + +  +  TLLK           +    G+  V+   P K+  + +YFLQG+G +  ++LS+
Sbjct:   40 GMVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEAAPSFPTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLIN--------IDPCAKGWIDWAASKLSGFTTNIVDIILAHHFGQEELQAN--------LDLIQTYRLHIAQDINQENLQLFLGSYNGRRDLEIERPILGQNDNRLKTLKCSTLLVVGDNSPAVEAVVECNSRLDPINTTLLK-----------MADCGGLPQVV--QPGKLTEAFKYFLQGMGYIPYVQLSH 323          
BLAST of Protein NDRG4 vs. Ensembl Mouse
Match: Ndrg3 (N-myc downstream regulated gene 3 [Source:MGI Symbol;Acc:MGI:1352499])

HSP 1 Score: 108.997 bits (271), Expect = 1.601e-25
Identity = 81/312 (25.96%), Postives = 144/312 (46.15%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL----------GERIAKLNTPTLFITG------AAAIHCKN-VHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLS 1072
            G ++V I+G       +ILT HD+G NH   +  F +   M  ++Q F   HVD PGQ +      T +  P+M+++A  L  +   + + +++  G GAGA IL+RFA+N   LV G +LI+        I+      I+W  + + G        ++ H FG + ++           ++I++++ ++   IN +NL  F+ S+  RR+L            R+  L   TL + G       A + C + +  +  TLLK           +    G+  V+   P K+  + +YFLQG+G + +  ++
Sbjct:   40 GMVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEAAPSFPTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLIN--------IDPCAKGWIDWAASKLSGFTTNIVDIILAHHFGQEELQAN--------LDLIQTYRLHIAQDINQENLQLFLGSYNGRRDLEIERPILGQNDNRLKTLKCSTLLVVGDNSPAVEAVVECNSRLDPINTTLLK-----------MADCGGLPQVV--QPGKLTEAFKYFLQGMGYIPSASMT 322          
BLAST of Protein NDRG4 vs. Ensembl Mouse
Match: Ndrg4 (N-myc downstream regulated gene 4 [Source:MGI Symbol;Acc:MGI:2384590])

HSP 1 Score: 98.9821 bits (245), Expect = 2.867e-22
Identity = 89/319 (27.90%), Postives = 140/319 (43.89%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNH-YQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETN--FPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLG-------ERIAKLNTPTLFITGAAA------IHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMS 1105
            G ++V I+G+       ILT HD+G NH   +  F +   M  +++ FV  HVD PGQ  G         FPSME +A  L  +        V+  G GAGA +LA+FA+    LV G +L++        I+      I+W    + G+  T    ++ H F  + +      N TEL   ++S++  + N +N  NL  F N + +RR+L             L  P + + G  A      + C N  L   T    K AD     ++ Q           P K+  + +YFLQG+G +++L+        +RR+S
Sbjct:   16 GLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLMN--------IDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELV-----NNTEL---VQSYRQQISNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEEGVVEC-NSKLDPTTTTFLKMADSGGLPQVTQ-----------PGKLTEAFKYFLQGMGYIAHLK--------DRRLS 298          
BLAST of Protein NDRG4 vs. Ensembl Mouse
Match: Ndrg4 (N-myc downstream regulated gene 4 [Source:MGI Symbol;Acc:MGI:2384590])

HSP 1 Score: 98.9821 bits (245), Expect = 6.159e-22
Identity = 89/319 (27.90%), Postives = 140/319 (43.89%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNH-YQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETN--FPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLG-------ERIAKLNTPTLFITGAAA------IHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMS 1105
            G ++V I+G+       ILT HD+G NH   +  F +   M  +++ FV  HVD PGQ  G         FPSME +A  L  +        V+  G GAGA +LA+FA+    LV G +L++        I+      I+W    + G+  T    ++ H F  + +      N TEL   ++S++  + N +N  NL  F N + +RR+L             L  P + + G  A      + C N  L   T    K AD     ++ Q           P K+  + +YFLQG+G +++L+        +RR+S
Sbjct:   68 GLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLMN--------IDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELV-----NNTEL---VQSYRQQISNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEEGVVEC-NSKLDPTTTTFLKMADSGGLPQVTQ-----------PGKLTEAFKYFLQGMGYIAHLK--------DRRLS 350          
BLAST of Protein NDRG4 vs. UniProt/SwissProt
Match: sp|O02485|YDJ1_CAEEL (Uncharacterized protein ZK1073.1 OS=Caenorhabditis elegans OX=6239 GN=ZK1073.1 PE=3 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 7.836e-58
Identity = 114/327 (34.86%), Postives = 186/327 (56.88%), Query Frame = 2
Query:  164 NEQKVALKLPKMGAINVYIQGT---RGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNFPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIA-KLNT-PTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPR 1129
            N Q V ++    G ++VY+QG    RG K  IILTVHD+G NH  +  F+++P M+ + +K +++HV +PGQ D   D   +FP+++ I  DL  +  + ++ + + FGEG GANI+ RFA+   + ++G +L+HC  +TA +IE  K+KV+N +L +  M+  A  YL+ H+FG +S   K+ +   E           L+ ++NPKNL K++ +F  R +L   I  KL T   L +TG+ A H   V+   +++        K K  L+ +D VA+V+ EAP+K+  SL    +G G++S + +     +     SME+ DRPR
Sbjct:    5 NLQMVVVQAQNCGVLHVYVQGNLEERGGK-TIILTVHDIGTNHKSFVRFVNHPSMATVKEKAIFLHVCVPGQEDNSADFFGDFPTLDGIGDDLSAVLDKFEVKSAIAFGEGVGANIICRFAMGHPNRIMGIVLVHCTSTTAGIIEYCKEKVMNMRLENSIMSDGAWDYLLAHKFGGES---KSRQEYLE----------ELKATLNPKNLSKYLVAFTKRTDLSSTIGTKLETVDALLVTGSKASHLHTVYTTHKSM-------NKKKTTLLVVDNVADVMQEAPDKLARSLILLCKGCGVLSGVAIPGMERQRTLSSSMEEADRPR 310          
BLAST of Protein NDRG4 vs. UniProt/SwissProt
Match: sp|Q3SYX0|NDRG1_BOVIN (Protein NDRG1 OS=Bos taurus OX=9913 GN=NDRG1 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.518e-30
Identity = 86/302 (28.48%), Postives = 143/302 (47.35%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL-------GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLS 1072
            G+I+V + GT      +ILT HD+G NH   Y    ++  M  ++Q F   HVD PGQ DG     T +  PSM+ +A  L  +  Q  L +++  G GAGA IL RFA+N+  +V G +LI+        +    +  ++W  + I G        +V H FG + ++  N E       V+ ++++++ N +NP NL  FIN++  RR+L       G     L  P L + G ++     V      L  TK        ++    G+  +    P K+  + +YF+QG+G + +  ++
Sbjct:   42 GSIHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNSEDMQEITQHFAVCHVDAPGQQDGAASFPTGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLIN--------VNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQ-NNVE-------VVHAYRHHVMNDMNPGNLQLFINAYNGRRDLEIERPMPGAHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTK----TTLLKMADCGGLPQI--SQPAKLAEAFKYFVQGMGYMPSASMT 321          
BLAST of Protein NDRG4 vs. UniProt/SwissProt
Match: sp|Q92597|NDRG1_HUMAN (Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.981e-29
Identity = 84/302 (27.81%), Postives = 142/302 (47.02%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL-------GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLS 1072
            G+++V + GT      +ILT HD+G NH   Y    +   M  ++Q F   HVD PGQ DG       +  PSM+ +A  L  +  Q  L +++  G GAGA IL RFA+N+  +V G +LI+        +    +  ++W  + I G        +V H FG + ++  N E       V+ +++ ++ N +NP NL+ FIN++ +RR+L       G     L  P L + G ++     V      L  TK        ++    G+  +    P K+  + +YF+QG+G + +  ++
Sbjct:   42 GSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLIN--------VNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQ-SNVE-------VVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTK----TTLLKMADCGGLPQI--SQPAKLAEAFKYFVQGMGYMPSASMT 321          
BLAST of Protein NDRG4 vs. UniProt/SwissProt
Match: sp|Q4R4Q3|NDRG1_MACFA (Protein NDRG1 OS=Macaca fascicularis OX=9541 GN=Ndrg1 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 3.358e-29
Identity = 84/302 (27.81%), Postives = 141/302 (46.69%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL-------GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLS 1072
            G+++V + GT      +ILT HD+G NH   Y    +   M  ++Q F   HVD PGQ DG       +  PSM+ +A  L  +  Q  L +++  G GAGA IL RFA+N+  +V G +LI+        +    +  ++W  + I G        +V H FG + +   N E       V+ +++ ++ N +NP NL+ FIN++ +RR+L       G     L  P L + G ++     V      L  TK        ++    G+  +    P K+  + +YF+QG+G + +  ++
Sbjct:   42 GSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLIN--------VNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEM-HSNVE-------VVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTK----TTLLKMADCGGLPQI--SQPAKLAEAFKYFVQGMGYMPSASMT 321          
BLAST of Protein NDRG4 vs. UniProt/SwissProt
Match: sp|Q62433|NDRG1_MOUSE (Protein NDRG1 OS=Mus musculus OX=10090 GN=Ndrg1 PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 6.521e-29
Identity = 93/342 (27.19%), Postives = 154/342 (45.03%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL-------GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSSLQSPIKISTLDEA 1192
            G+++V + GT      +ILT HD+G NH   Y    ++  M  ++Q F   HVD PGQ DG       +  PSM+ +A  L  +  Q  L +V+  G GAGA IL RFA+N+  +V G +L++        +    +  ++W  + I G        +V H FG + I   N E       V+ +++ ++ N +NP NL+ FI+++ +RR+L       G     L  P L + G  +     V      L  TK        ++    G+  +    P K+  + +YF+QG+G + +  ++   +  +R  S        GT S S + + P   S   E 
Sbjct:   42 GSLHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNSEDMQEITQHFAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAEMLPGVLHQFGLKSVIGMGTGAGAYILTRFALNNPEMVEGLVLMN--------VNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEI-HNNVE-------VVHTYRQHILNDMNPSNLHLFISAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDNSPAVDAVVECNSKLDPTK----TTLLKMADCGGLPQI--SQPAKLAEAFKYFVQGMGYMPSASMTR--LMRSRTASGSSVTSLEGTRSRSHTSEGPRSRSHTSEG 359          
BLAST of Protein NDRG4 vs. TrEMBL
Match: A0A3Q0KBB7 (Ndr family, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 3.249e-116
Identity = 174/321 (54.21%), Postives = 226/321 (70.40%), Query Frame = 2
Query:  206 INVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETN--FPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTK--PADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSSL 1156
            +NV++QG   P + + LT HDLGCNHYQYEEF+ + KM  + Q+  W+H+DLPGQGDG+E+L  N  FP +  +    +++   +K+ NV+LFGEGAGANILARFAI  ++LVLGAILI+C G+  +  ESL+DK++NWKL+S GMNP  ES+L++HRFG+        E+E EL+N +ESF+ NLR+SINPKNL KFI S+M R+NL E +  L  P L ITGA A H K    L E L K +     Q    E V ID V+NVLTE P+KVV S+QYFLQG+GL+SNL+L   P+++NRRMSMEDYDRP G   F S L
Sbjct:   21 LNVFVQGRIMPSKPVFLTCHDLGCNHYQYEEFVVHSKMLPIMQRSTWVHIDLPGQGDGEEELPANYVFPPINRLPDAFRDVLANLKIKNVVLFGEGAGANILARFAIAYDNLVLGAILINCTGTPPTFTESLRDKLMNWKLSSSGMNPATESFLIVHRFGS----VVETESEVELRNAVESFRQNLRHSINPKNLNKFITSYMQRKNLSESLPSLKCPVLLITGALASHHKKCRQLFEDLEKIRRDSGGQSGSSEFVMIDDVSNVLTERPDKVVDSMQYFLQGIGLLSNLKLQKTPMQLNRRMSMEDYDRPLGKTHFVSRL 337          
BLAST of Protein NDRG4 vs. TrEMBL
Match: A0A068YEP2 (Ndr OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000947700 PE=4 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 1.081e-115
Identity = 174/349 (49.86%), Postives = 237/349 (67.91%), Query Frame = 2
Query:  143 DTMTAL--SNEQKVALKLPKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETN--FPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRG----TGSFSSSLQSP 1165
            D M AL   +EQ   L+LP +G +NVY+QG    +  + LTVHDLGCNHYQYEEF+  PKM  + ++ VW+ VDLPGQGDG+E+L  +  FP++  IA  L+ +     + +V+LFGEGAGANILARFA+  + +V+GA+LIHC G TAS  +SL+DK++NWKL +IGMNP  ES+L+LHRFG      K+   E ELK  IE F+ NL++SINP+NL ++I ++M R+ L ER++ L    L ITGA A   +    L E L+K   A      ELV ++ VANVL E P+KV+ S+QYFLQG+GLVS++++   P+ +NRRMSMEDYD+P G     G F  +L +P
Sbjct:    4 DKMAALRIPSEQHCELELP-IGKVNVYVQGNLSLRTCVFLTVHDLGCNHYQYEEFVDRPKMRPIMERAVWLSVDLPGQGDGEEELPPSYTFPTLWSIAESLKSVLDHFSIDHVVLFGEGAGANILARFAMLHDEMVMGAVLIHCTGQTASFADSLRDKLVNWKLKTIGMNPATESFLILHRFGY----LKDTGTELELKQAIEHFRGNLQHSINPRNLNRYITAYMQRKPLSERLSDLKCSVLLITGALAPQRRGCEKLYEALMKVHSAKSCATRELVVVENVANVLAEKPDKVIESMQYFLQGIGLVSHIKMQTTPLNLNRRMSMEDYDKPMGRIQLAGGFRPNLAAP 347          
BLAST of Protein NDRG4 vs. TrEMBL
Match: A0A4Z2D0J9 (Uncharacterized protein OS=Schistosoma japonicum OX=6182 GN=EWB00_005776 PE=4 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 1.208e-115
Identity = 172/325 (52.92%), Postives = 227/325 (69.85%), Query Frame = 2
Query:  206 INVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETN--FPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTK--PADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSSLQSPI 1168
            +NV++QG   P + + LT HDLGCNHYQYEEF+ + KM  + Q+  W+H+DLPGQGDG+E+L ++  FP +  +    +++   +K+  V+LFGEGAGANILARFAI  ++LVLGAILI+C GS A+  ESLKDK++NWKL+S GMNP  ES+L++HRFG+        ++E EL+N +ESF+ NLR+SINPKNL KFI S+M R+NL E +  L  P L ITGA   H K    L E L K +     Q    E V ID V+NVLTE P+KV+ S+QYFLQG+GL+SNL+L   P+++NRRMSMEDYDRP G   F S L   +
Sbjct:   21 LNVFVQGRLMPLKPVFLTCHDLGCNHYQYEEFVVHSKMQPIMQRSTWVHIDLPGQGDGEEELSSSYVFPPINRLPDAFRDVLEHLKIKQVVLFGEGAGANILARFAIAYDNLVLGAILINCTGSPATFAESLKDKLMNWKLSSSGMNPATESFLIVHRFGS----VVETDSEVELRNAVESFRQNLRHSINPKNLNKFITSYMQRKNLSESLPSLKCPVLLITGALGSHHKKCRQLFEDLEKIRRDSGSQAAASEFVMIDDVSNVLTERPDKVIDSMQYFLQGIGLLSNLKLHKTPMQLNRRMSMEDYDRPMGKTHFVSRLSQQV 341          
BLAST of Protein NDRG4 vs. TrEMBL
Match: A0A4V3SFB2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004619 PE=4 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 4.629e-114
Identity = 170/338 (50.30%), Postives = 235/338 (69.53%), Query Frame = 2
Query:  155 ALSNEQKVALKLPKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETN--FPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKT-KPADQKVKF-ELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSSL 1156
             ++NE    +     G +NVY+QGT  P + + LTVHDLGCNHYQYE+F++NPKM    Q+ VW+H+DLPGQGDG+E+L     FP +  +   ++E+    K+  ++LFGEGAGANILARFAI  ++LVLGAILIHC  ++AS  E++KDK+INWKLN  GMN   ES+L+LHRFG       + ++E EL+N +E+F+ NLR+SINPKNL +FI+S+M R+ L + +A L  P L ITG+ +   +    L E L K  K A+ ++   E   IDGVANV+ E P+KV+ S+Q+FLQG+GL+SNL++   P+++NRRMSMEDYDRP G   F + L
Sbjct:    5 GMANEVHHRVHTEAAGELNVYVQGTVAPLKPVFLTVHDLGCNHYQYEDFVANPKMIPFMQRAVWLHIDLPGQGDGEEELPATYVFPPISKLPEAMKEVLDHFKIKQLVLFGEGAGANILARFAIMYDNLVLGAILIHCTAASASFAEAIKDKLINWKLNLSGMNAATESFLILHRFGP----IMDTDSEVELRNAVENFRQNLRHSINPKNLNRFISSYMQRKTLTDNLAGLKCPVLLITGSLSSQRRACRQLFEDLQKAQKHAEGRLTTREFFVIDGVANVIAERPDKVITSMQFFLQGIGLLSNLQMQKTPLQLNRRMSMEDYDRPLGKLHFVNRL 338          
BLAST of Protein NDRG4 vs. TrEMBL
Match: A0A564YYS6 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS10380 PE=4 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 1.623e-113
Identity = 173/350 (49.43%), Postives = 240/350 (68.57%), Query Frame = 2
Query:  143 DTMTAL--SNEQKVALKLPKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDL--ETNFPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKF-ELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRG----TGSFSSSLQSP 1165
            D M AL  ++EQ   L LP +G +NVY+QG    +  + LTVHDLGCNHYQYEEF+++PK+  +S++ VWI VDLPGQGDG+E+L  +  FP++ +IA  L+ +     + +V+LFGEGAGANILARFA+  + +V+GA+L+HC G TAS  +SL+DK++NWKL + GMNP  ES+L+LHRFG       +   E EL+  IE+F+ NL++SIN KNL ++I ++M R+ L ER+  L    L ITGA A   K    L E+L+K + A       ELV ++ VANVL E P+KV+ S+QYFLQG+GLVS+L++   P+ +NRRMSMEDYD+P G     G F  +L +P
Sbjct:    4 DKMAALGMASEQHHELDLP-IGKVNVYVQGNLASRNVVFLTVHDLGCNHYQYEEFVAHPKVRPISERAVWISVDLPGQGDGEEELPAQYTFPTLWNIAGSLKNVLDHFNIEHVVLFGEGAGANILARFAMLHDEMVMGAVLVHCTGQTASFADSLRDKLVNWKLKTTGMNPATESFLILHRFGC----LTDTGTELELRQAIENFRENLQHSINAKNLNRYITAYMQRKPLSERLGDLKCSVLLITGALAPQRKGCEKLYESLMKVQGAKSSCATRELVVVENVANVLAERPDKVIESMQYFLQGIGLVSHLKMQTTPLNLNRRMSMEDYDKPMGRVQLAGGFRPNLTTP 348          
BLAST of Protein NDRG4 vs. Ensembl Cavefish
Match: ndrg3a (protein NDRG3-like [Source:NCBI gene;Acc:103040941])

HSP 1 Score: 119.783 bits (299), Expect = 2.444e-29
Identity = 88/316 (27.85%), Postives = 158/316 (50.00%), Query Frame = 2
Query:  170 QKVALKLPKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLG-ER-IAKLN--------TPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSN 1075
            Q+  L+ P+ G ++V ++G       +ILT HD+G NH   +    +   M  ++Q F  +H+D PGQ +G     T +  PSM+++A  L  +  Q+K+++V+  G GAGA IL+RFA+N   LV G +LI+        +    +  I+W  + + G   T    ++ H F T+ +        T+ + +I++++ ++   IN +NL  F +S+  RR+LG ER +  LN         P L + G  +     V  + E   +  P    +  ++    G+  V+   P K+  + +YF+QG+G +  + LS+
Sbjct:   30 QEYDLETPQ-GVLHVTMRGIPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMKEITQHFAVVHIDAPGQQEGAPPFPTGYQYPSMDELAEMLPSVMTQLKVNSVIGIGVGAGAYILSRFALNHPSLVEGLVLIN--------VNPCAEGWIDWAASKLSGWTSTLVDIVMAHHFSTEEL--------TDNQELIQTYRLHIAQDINQENLTLFCDSYNARRDLGIERPVVGLNEDINNTLVCPALLVVGDTS---PAVEAVVECNCRLNPTKTTL-LKMADCGGLPQVV--QPGKLAEAFKYFVQGMGYIPYVLLSH 322          
BLAST of Protein NDRG4 vs. Ensembl Cavefish
Match: ndrg1b (protein NDRG1 [Source:NCBI gene;Acc:103037827])

HSP 1 Score: 118.627 bits (296), Expect = 5.755e-29
Identity = 91/326 (27.91%), Postives = 155/326 (47.55%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLG-ERIA--------KLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSN---LRLSNEPIKINRRMSMEDYDRPR 1129
            G ++  + G       +ILT HD+G NH   ++   S+  M  +++ F   HV+ PGQ +G   L T F  PSM+ +A  L  +     +++++    GAGA ILARFA+N   LV G +LI+        I +  +  ++W  + + G+   +   ++ H FG + I+  +        ++I +F++++  SIN  NL +F+ S+ +RRNL  ER A         L  P L + G ++     V      +  TK        ++    G+  V  + P K+  +L+YF+QGLG +S+    RLS         +S  +  R R
Sbjct:   26 GTVHCTLTGVVRENRPVILTYHDIGLNHKTCFDTLFSHEDMQEITRHFAVCHVNAPGQQEGASTLPTGFTYPSMDQLAETLPIVLKHFNITSIVGLAIGAGAYILARFALNHPDLVEGLVLIN--------INAQAEGWMDWAAHKLSGLAHASPEIVISHLFGKEEIQNNH--------DLIATFRHHITTSINQTNLQQFVKSYNSRRNLDIERPAPTGNANVKTLKCPALLVVGDSSPAVDAVVDCNSRMNPTK----TTFLKMADCGGLPQV--DQPAKLAEALKYFIQGLGYMSSAGMTRLSRSRTTSGTSVSSMEASRNR 329          
BLAST of Protein NDRG4 vs. Ensembl Cavefish
Match: ndrg3a (protein NDRG3-like [Source:NCBI gene;Acc:103040941])

HSP 1 Score: 116.701 bits (291), Expect = 1.973e-28
Identity = 85/305 (27.87%), Postives = 152/305 (49.84%), Query Frame = 2
Query:  182 LKLPKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSI-GMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLG-ER-IAKLN--------TPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLV 1054
            L+ P+ G ++V ++G       +ILT HD+G NH   +    +   M  ++Q F  +H+D PGQ +G     T +  PSM+++A  L  +  Q+K+++V+  G GAGA IL+RFA+N   LV G +LI+        +    +  I+W  + + G   T    ++ H F T+ +        T+ + +I++++ ++   IN +NL  F +S+  RR+LG ER +  LN         P L + G  +     V  + E   +  P    +  ++    G+  V+   P K+  + +YF+QG+G +
Sbjct:   21 LETPQ-GVLHVTMRGIPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMKEITQHFAVVHIDAPGQQEGAPPFPTGYQYPSMDELAEMLPSVMTQLKVNSVIGIGVGAGAYILSRFALNHPSLVEGLVLIN--------VNPCAEGWIDWAASKLSGWTSTLVDIVMAHHFSTEEL--------TDNQELIQTYRLHIAQDINQENLTLFCDSYNARRDLGIERPVVGLNEDINNTLVCPALLVVGDTS---PAVEAVVECNCRLNPTKTTL-LKMADCGGLPQVVQ--PGKLAEAFKYFVQGMGYI 302          
BLAST of Protein NDRG4 vs. Ensembl Cavefish
Match: ndrg3b (ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5606])

HSP 1 Score: 115.931 bits (289), Expect = 8.927e-28
Identity = 82/305 (26.89%), Postives = 144/305 (47.21%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL----------GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSN 1075
            G ++V ++GT      +ILT HD+G NH   +    +   M  ++Q F  +HVD PGQ +      + +  P+M+++A  L  +  Q+K+++V+  G GAGA IL R A+N   LV G +LI+        ++    K+  W  N + +       ++ H F T  +        TE + +I++++ ++   IN  NL  F NS+  RR+L           E +  L  P L + G  +   + V      L  TK        ++    G+  V+   P K+  + +YF+QG+G + ++ LS+
Sbjct:   87 GVLHVTLRGTPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMQEITQHFAVVHVDAPGQQENAPPFPSGYQYPTMDELAEMLPSVLTQLKINSVIGIGVGAGAYILTRLALNQSTLVEGLVLINVDPCAKGWMDWAASKLSGWTSNLVDI-------VMGHHFSTDEL--------TENQEIIQTYRLHIAQDINQDNLALFCNSYNGRRDLEIERPILGINEETVNTLKCPALLVVGDTSPAVEAVVECNSRLNPTK----TTLLKMADCGGLPQVV--QPGKLAEAFKYFVQGMGYIPHVLLSH 370          
BLAST of Protein NDRG4 vs. Ensembl Cavefish
Match: ndrg3b (ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5606])

HSP 1 Score: 116.316 bits (290), Expect = 1.044e-27
Identity = 88/331 (26.59%), Postives = 152/331 (45.92%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL----------GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSS 1153
            G ++V ++GT      +ILT HD+G NH   +    +   M  ++Q F  +HVD PGQ +      + +  P+M+++A  L  +  Q+K+++V+  G GAGA IL R A+N   LV G +LI+        ++    K+  W  N + +       ++ H F T  +        TE + +I++++ ++   IN  NL  F NS+  RR+L           E +  L  P L + G  +   + V      L  TK        ++    G+  V+   P K+  + +YF+QG+G + ++ LS+   +     SM    R R   + S S
Sbjct:  111 GVLHVTLRGTPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMQEITQHFAVVHVDAPGQQENAPPFPSGYQYPTMDELAEMLPSVLTQLKINSVIGIGVGAGAYILTRLALNQSTLVEGLVLINVDPCAKGWMDWAASKLSGWTSNLVDI-------VMGHHFSTDEL--------TENQEIIQTYRLHIAQDINQDNLALFCNSYNGRRDLEIERPILGINEETVNTLKCPALLVVGDTSPAVEAVVECNSRLNPTK----TTLLKMADCGGLPQVV--QPGKLAEAFKYFVQGMGYIPHVLLSHLSSESVPTASMTRLARSRTHSASSVS 420          
BLAST of Protein NDRG4 vs. Ensembl Nematostella
Match: EDO32493 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUY2])

HSP 1 Score: 145.976 bits (367), Expect = 1.484e-39
Identity = 100/323 (30.96%), Postives = 166/323 (51.39%), Query Frame = 2
Query:  158 LSNEQKVALKLPKMGAINVYIQGTRGP----------KEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSE--HLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIA-----KLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLR 1066
            +S E     ++ K+G + VYI+G              K+ +++T HDLG NH   +E+FL +  + ++  +FV  H+D PGQ  G E+L  ++  P++ ++A  + ++     L +V+ FG G+GANIL   A+ S+    +LG IL+   G+T+S  E  + KV  W+LN+ G      +YL  H F  ++ K  N E       ++E+F   ++ +INP NL  F+NS+M R N+          K  + T +I      H  +    ++      P D+K K+ +++ D   +VL E P+ +   L  F+QGLGLV  LR
Sbjct:    1 MSEETPKQERVEKVGDLTVYIEGEEAKDKTDEKENVKKKDVMITFHDLGMNHKTCFEKFLMHEDIKSIKDRFVIYHLDAPGQETGAENLSNDYQYPTINELADMVGKVLDHFALDDVVCFGVGSGANILCHLALASKWKERILGLILVEPCGATSSFKEWGEAKVKKWQLNAKGFTEGTANYLKWHHFERKTGK-PNIE-------LMENFCDEMKKNINPHNLAAFLNSYMHRPNILNEAKQSVKDKSVSTTAYIMVVTGEHSPHKEQSEQFFRVLSPVDRK-KYSILKPDCGTSVLEEKPDTMAEGLLLFIQGLGLVPTLR 314          
BLAST of Protein NDRG4 vs. Ensembl Nematostella
Match: EDO40164 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S803])

HSP 1 Score: 121.324 bits (303), Expect = 1.013e-30
Identity = 94/295 (31.86%), Postives = 142/295 (48.14%), Query Frame = 2
Query:  218 IQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIA-LDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL--------GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLR 1066
            +QGT G  +  I+T HD+G NH   +  F +   +  L + F   H+D PGQ + ++ L   F  P+ME++A   + E+  Q+ +S  +  G GAGAN+L R+ +     V   +L++     +  IE    KV   +L++ G+    E YL+ H FG      K  E   +L +   ++K +LR+ +NP NL  FINS++TR N+        G     L  PTL +TG  + H  +V      L      D K+   +   D     L E P KV  +L  FLQG G V  LR
Sbjct:    1 MQGTEG--KPAIVTFHDIGQNHTSAFLGFFNFVDVQPLLEHFCIYHIDAPGQENCEKQLPETFVYPTMEELADFVVHEVVKQLSISRFIGLGVGAGANVLCRYGLMYPDFVDALVLVNLSVGKSGWIEWGYQKVCVRQLHNKGLTTFVEDYLLWHHFGE-----KTKEENLDLSS---AYKDSLRSLLNPHNLALFINSYITRTNIDIVRPVEGGPNPRSLKCPTLLVTGTFSPHGDDVVESNSRL------DPKISEYMKVSDCGGMPLEEQPAKVAQALILFLQGNGYVQRLR 279          
BLAST of Protein NDRG4 vs. Ensembl Medaka
Match: ndrg3a (NDRG family member 3 [Source:NCBI gene;Acc:101162117])

HSP 1 Score: 116.316 bits (290), Expect = 4.133e-28
Identity = 80/305 (26.23%), Postives = 144/305 (47.21%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLG----------ERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSN 1075
            G ++V ++G       +ILT HD+G NH   +    +   M  ++Q F  +HVD PGQ +G     T +  P+M++++  L  +  ++K+++V+  G GAG+ IL RFA+N+  LV G +LI         I+    K+  W  N + +       ++ H F T  +        TE + +I++++ ++   IN  NL  F  S+  R++LG          + +  L  P L + G  +   + V      L  TK        ++    G+  V+   P K+  + +YF+QG+G +  + LS+
Sbjct:   39 GVLHVTMRGVPKGNRPVILTYHDIGLNHKSCFNTLFNYEDMQEITQHFAVVHVDAPGQQEGAPPFPTGYRYPTMDELSEMLPSVMTRLKINSVIGIGVGAGSYILTRFALNNPALVEGLVLIDVDPCAEGWIDWAASKLSGWTSNLVDI-------VMAHHFSTDEL--------TENQELIQTYRLHIAQDINQDNLALFCGSYQYRQDLGIERPVVGLNEDTVNTLTCPALLVVGDTSPAVEAVVECNSRLNPTK----TTLLKMADCGGLPQVV--QPGKLAEAFKYFVQGMGYIPYVHLSH 322          
BLAST of Protein NDRG4 vs. Ensembl Medaka
Match: ndrg3a (NDRG family member 3 [Source:NCBI gene;Acc:101162117])

HSP 1 Score: 115.546 bits (288), Expect = 5.728e-28
Identity = 80/305 (26.23%), Postives = 144/305 (47.21%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLG----------ERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSN 1075
            G ++V ++G       +ILT HD+G NH   +    +   M  ++Q F  +HVD PGQ +G     T +  P+M++++  L  +  ++K+++V+  G GAG+ IL RFA+N+  LV G +LI         I+    K+  W  N + +       ++ H F T  +        TE + +I++++ ++   IN  NL  F  S+  R++LG          + +  L  P L + G  +   + V      L  TK        ++    G+  V+   P K+  + +YF+QG+G +  + LS+
Sbjct:   26 GVLHVTMRGVPKGNRPVILTYHDIGLNHKSCFNTLFNYEDMQEITQHFAVVHVDAPGQQEGAPPFPTGYRYPTMDELSEMLPSVMTRLKINSVIGIGVGAGSYILTRFALNNPALVEGLVLIDVDPCAEGWIDWAASKLSGWTSNLVDI-------VMAHHFSTDEL--------TENQELIQTYRLHIAQDINQDNLALFCGSYQYRQDLGIERPVVGLNEDTVNTLTCPALLVVGDTSPAVEAVVECNSRLNPTK----TTLLKMADCGGLPQVV--QPGKLAEAFKYFVQGMGYIPYVHLSH 309          
BLAST of Protein NDRG4 vs. Ensembl Medaka
Match: ndrg3a (NDRG family member 3 [Source:NCBI gene;Acc:101162117])

HSP 1 Score: 113.235 bits (282), Expect = 4.630e-27
Identity = 78/296 (26.35%), Postives = 139/296 (46.96%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLG----------ERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLG 1048
            G ++V ++G       +ILT HD+G NH   +    +   M  ++Q F  +HVD PGQ +G     T +  P+M++++  L  +  ++K+++V+  G GAG+ IL RFA+N+  LV G +LI         I+    K+  W  N + +       ++ H F T  +        TE + +I++++ ++   IN  NL  F  S+  R++LG          + +  L  P L + G  +   + V      L  TK        ++    G+  V+   P K+  + +YF+QG+G
Sbjct:   39 GVLHVTMRGVPKGNRPVILTYHDIGLNHKSCFNTLFNYEDMQEITQHFAVVHVDAPGQQEGAPPFPTGYRYPTMDELSEMLPSVMTRLKINSVIGIGVGAGSYILTRFALNNPALVEGLVLIDVDPCAEGWIDWAASKLSGWTSNLVDI-------VMAHHFSTDEL--------TENQELIQTYRLHIAQDINQDNLALFCGSYQYRQDLGIERPVVGLNEDTVNTLTCPALLVVGDTSPAVEAVVECNSRLNPTK----TTLLKMADCGGLPQVV--QPGKLAEAFKYFVQGMG 313          
BLAST of Protein NDRG4 vs. Ensembl Medaka
Match: ndrg1a (protein NDRG1 [Source:NCBI gene;Acc:101170853])

HSP 1 Score: 109.383 bits (272), Expect = 1.068e-25
Identity = 82/302 (27.15%), Postives = 146/302 (48.34%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVL-HRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL-------GERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLS 1072
            G I+  ++G    +  +ILT HD+G NH   ++   ++  MS + Q F   HVD PGQ +G     T +  PSM+ ++  L  +     L +V+  G GAGA ILARFA+NS  +V G +LI+        I    +  ++W  + I     A + LV+ H FG + I            ++I  ++ ++ + +N  NL+ F+ ++ +RR+L       G  +  L  P+L + G ++     V  + E   K  P    +  ++    G+  V  + P K+  + +YF+QG+G + +  ++
Sbjct:   40 GRIHCTMKGVPKSERPVILTYHDIGLNHKTCWDSLFNHEDMSEIMQHFAVCHVDAPGQHEGANTFSTGYEYPSMDQLSETLPLVLKHFGLKSVVGMGIGAGAYILARFALNSPSMVEGLVLIN--------INPCAEGWMDWAAHKISGWTNAMTDLVITHLFGKEEINHN--------PDLIARYRNHIID-MNQFNLHLFVKAYESRRDLEIERPVPGSNVRTLKCPSLLVVGDSS---PAVDAVVECNTKLDPTKATL-LKMADCGGMPQV--DQPGKLTEAFKYFIQGMGYMPSASMT 318          
BLAST of Protein NDRG4 vs. Ensembl Medaka
Match: ENSORLT00000006023.2 (protein NDRG1 [Source:NCBI gene;Acc:101156766])

HSP 1 Score: 105.145 bits (261), Expect = 2.656e-24
Identity = 87/339 (25.66%), Postives = 160/339 (47.20%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQ-YEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLET--NFPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGER---------IAKLNTPTLFITG------AAAIHCKN-VHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSSLQ 1159
            G ++  + GT      +ILT HD+G NH   +E   ++  M  + +     HV+ PGQ +  + L T   +P+++ ++  L  +     L +V+  G GAGA ILARFA+N   LV G +LI+   +   +++S+ +K+ +W         T    L+ H FG + I+ KN +       ++ ++++ +  ++N  N+ +F  S+  R  L  +         +  L   TL + G       A + C + ++  + TLLK           +    G+  V  + P KV  +L+YF+QGLG +S+  ++    +     S   ++ PR + S ++ LQ
Sbjct:   26 GDLHCIMTGTPKANRPVILTFHDVGLNHKSCFETLFNHEDMQEIVKHLPVCHVEAPGQQEAAKSLPTLYTYPTVDQLSEALPAVLKNFGLRSVIGLGVGAGAYILARFALNHPDLVDGLVLINVNPNAEGLMDSVANKITDW-------TQTLPDKLIAHLFGQEEIQ-KNYD-------LVATYRHYITATMNQSNVSQFFRSYNNRTTLDVQRPVSGGNINVRTLKCSTLLVVGDNSPAVEAVVDCNSKLNPNKTTLLK-----------MADCGGLPQV--DQPAKVTEALKYFIQGLGYLSSASMTRLRSRTTSSTSSVSFEAPR-SRSHTNELQ 335          
BLAST of Protein NDRG4 vs. Planmine SMEST
Match: SMESG000065324.1 (SMESG000065324.1)

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 349/349 (100.00%), Postives = 349/349 (100.00%), Query Frame = 2
Query:  149 MTALSNEQKVALKLPKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNFPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSSLQSPIKISTLDEAY 1195
            MTALSNEQKVALKLPKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNFPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSSLQSPIKISTLDEAY
Sbjct:    1 MTALSNEQKVALKLPKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNFPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSSLQSPIKISTLDEAY 349          
BLAST of Protein NDRG4 vs. Planmine SMEST
Match: SMESG000065324.1 (SMESG000065324.1)

HSP 1 Score: 708.368 bits (1827), Expect = 0.000e+0
Identity = 345/349 (98.85%), Postives = 345/349 (98.85%), Query Frame = 2
Query:  149 MTALSNEQKVALKLPKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNFPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSSLQSPIKISTLDEAY 1195
            MTALSNEQKVALKLPKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNFPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGT    FKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSSLQSPIKISTLDEAY
Sbjct:    1 MTALSNEQKVALKLPKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNFPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGT----FKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSSLQSPIKISTLDEAY 345          
BLAST of Protein NDRG4 vs. Planmine SMEST
Match: SMESG000021236.1 (SMESG000021236.1)

HSP 1 Score: 281.567 bits (719), Expect = 5.430e-91
Identity = 147/326 (45.09%), Postives = 217/326 (66.56%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETL---LKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNL---RLSN--EPIKINRRMSMEDYDRPRGTGSFS 1147
            G +  YI+GTR   E  ILTVHD+GCNH QY +FL +  M  L+ + VW +V LPGQ   D DL +++  P+M+ IA DL E    + +S++++FGEGAGANILAR A++ +  +LGA+L++CVGST +++ESLKDK+I WKL++IGM  + E+YLV+HRFG       N E++ +L  +I ++K  LR++ N KNL+ ++ S+M R NL ++   +  P LFI+G+ A +  +V  L E +   LK +P D+K   E ++ID  ANVL E  ++V  SLQYFLQG GLV +    R+S+   PI  NR++SME+YD P+G  + +
Sbjct:   10 GKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGV----MNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTIRCPILFISGSLANYADDVKCLYEDIQGFLKNEP-DRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIG-NRKISMEEYDSPKGASNIT 329          
BLAST of Protein NDRG4 vs. Planmine SMEST
Match: SMESG000021236.1 (SMESG000021236.1)

HSP 1 Score: 265.388 bits (677), Expect = 4.115e-84
Identity = 147/364 (40.38%), Postives = 216/364 (59.34%), Query Frame = 2
Query:  200 GAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL--------------------------------------GERIAKLNTPTLFITGAAAIHCKNVHLLQETL---LKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNL---RLSN--EPIKINRRMSMEDYDRPRGTGSFS 1147
            G +  YI+GTR   E  ILTVHD+GCNH QY +FL +  M  L+ + VW +V LPGQ   D DL +++  P+M+ IA DL E    + +S++++FGEGAGANILAR A++ +  +LGA+L++CVGST +++ESLKDK+I WKL++IGM  + E+YLV+HRFG       N E++ +L  +I ++K  LR++ N KNL+ ++ S+M R NL                                        +   +  P LFI+G+ A +  +V  L E +   LK +P D+K   E ++ID  ANVL E  ++V  SLQYFLQG GLV +    R+S+   PI  NR++SME+YD P+G  + +
Sbjct:   10 GKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGV----MNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPAIKCPILFISGSLANYADDVKCLYEDIQGFLKNEP-DRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIG-NRKISMEEYDSPKGASNIT 367          
BLAST of Protein NDRG4 vs. Planmine SMEST
Match: SMESG000055204.1 (SMESG000055204.1)

HSP 1 Score: 141.354 bits (355), Expect = 6.094e-40
Identity = 61/112 (54.46%), Postives = 84/112 (75.00%), Query Frame = 2
Query:  191 PKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLE-TNFPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAIN 523
            PK G +N+YIQG R P E II T+HDLGCNH +YE+FL +  M  +  + VWIH+D+PGQGD DEDL    FP+M++IA D++ +  ++ + + +LFGEGAGANILARFA++
Sbjct:   12 PKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHIRNRCVWIHLDIPGQGDNDEDLNLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAVS 123          
The following BLAST results are available for this feature:
BLAST of Protein NDRG4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NDRG14.126e-3027.81N-myc downstream regulated 1 [Source:HGNC Symbol;A... [more]
NDRG14.126e-3027.81N-myc downstream regulated 1 [Source:HGNC Symbol;A... [more]
NDRG32.031e-2727.48NDRG family member 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
NDRG31.197e-2626.28NDRG family member 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
NDRG31.690e-2626.28NDRG family member 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ZK1073.16.160e-5934.86pep chromosome:WBcel235:X:16124151:16128865:-1 gen... [more]
ZK1073.16.160e-5934.86pep chromosome:WBcel235:X:16123942:16128815:-1 gen... [more]
Y48G10A.31.606e-2928.21pep chromosome:WBcel235:I:13471683:13474185:-1 gen... [more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG20823.164e-5633.53gene:FBgn0027608 transcript:FBtr0078672[more]
CG20823.164e-5633.53gene:FBgn0027608 transcript:FBtr0300909[more]
CG20822.699e-5532.46gene:FBgn0027608 transcript:FBtr0078674[more]
CG20822.699e-5532.46gene:FBgn0027608 transcript:FBtr0300910[more]
CG20823.872e-5533.83gene:FBgn0027608 transcript:FBtr0078675[more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndrg3b3.452e-2927.61ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ndrg3b3.452e-2927.61ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ndrg3a1.728e-2828.85ndrg family member 3a [Source:ZFIN;Acc:ZDB-GENE-98... [more]
ndrg3a1.471e-2728.19ndrg family member 3a [Source:ZFIN;Acc:ZDB-GENE-98... [more]
ndrg1b4.492e-2627.51N-myc downstream regulated 1b [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc15a51.672e-2427.86solute carrier family 15, member 5 [Source:Xenbase... [more]
slc15a52.009e-2427.86solute carrier family 15, member 5 [Source:Xenbase... [more]
slc15a52.697e-2427.86solute carrier family 15, member 5 [Source:Xenbase... [more]
kif1a3.686e-2425.07kinesin family member 1A [Source:Xenbase;Acc:XB-GE... [more]
slc15a55.851e-2427.47solute carrier family 15, member 5 [Source:Xenbase... [more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ndrg19.322e-3027.19N-myc downstream regulated gene 1 [Source:MGI Symb... [more]
Ndrg31.774e-2626.52N-myc downstream regulated gene 3 [Source:MGI Symb... [more]
Ndrg31.601e-2525.96N-myc downstream regulated gene 3 [Source:MGI Symb... [more]
Ndrg42.867e-2227.90N-myc downstream regulated gene 4 [Source:MGI Symb... [more]
Ndrg46.159e-2227.90N-myc downstream regulated gene 4 [Source:MGI Symb... [more]
back to top
BLAST of Protein NDRG4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O02485|YDJ1_CAEEL7.836e-5834.86Uncharacterized protein ZK1073.1 OS=Caenorhabditis... [more]
sp|Q3SYX0|NDRG1_BOVIN2.518e-3028.48Protein NDRG1 OS=Bos taurus OX=9913 GN=NDRG1 PE=2 ... [more]
sp|Q92597|NDRG1_HUMAN1.981e-2927.81Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=... [more]
sp|Q4R4Q3|NDRG1_MACFA3.358e-2927.81Protein NDRG1 OS=Macaca fascicularis OX=9541 GN=Nd... [more]
sp|Q62433|NDRG1_MOUSE6.521e-2927.19Protein NDRG1 OS=Mus musculus OX=10090 GN=Ndrg1 PE... [more]
back to top
BLAST of Protein NDRG4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KBB73.249e-11654.21Ndr family, putative OS=Schistosoma mansoni OX=618... [more]
A0A068YEP21.081e-11549.86Ndr OS=Echinococcus multilocularis OX=6211 GN=EmuJ... [more]
A0A4Z2D0J91.208e-11552.92Uncharacterized protein OS=Schistosoma japonicum O... [more]
A0A4V3SFB24.629e-11450.30Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A564YYS61.623e-11349.43Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndrg3a2.444e-2927.85protein NDRG3-like [Source:NCBI gene;Acc:103040941... [more]
ndrg1b5.755e-2927.91protein NDRG1 [Source:NCBI gene;Acc:103037827][more]
ndrg3a1.973e-2827.87protein NDRG3-like [Source:NCBI gene;Acc:103040941... [more]
ndrg3b8.927e-2826.89ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ndrg3b1.044e-2726.59ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein NDRG4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein NDRG4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO324931.484e-3930.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401641.013e-3031.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndrg3a4.133e-2826.23NDRG family member 3 [Source:NCBI gene;Acc:1011621... [more]
ndrg3a5.728e-2826.23NDRG family member 3 [Source:NCBI gene;Acc:1011621... [more]
ndrg3a4.630e-2726.35NDRG family member 3 [Source:NCBI gene;Acc:1011621... [more]
ndrg1a1.068e-2527.15protein NDRG1 [Source:NCBI gene;Acc:101170853][more]
ENSORLT00000006023.22.656e-2425.66protein NDRG1 [Source:NCBI gene;Acc:101156766][more]
back to top
BLAST of Protein NDRG4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065324.10.000e+0100.00SMESG000065324.1[more]
SMESG000065324.10.000e+098.85SMESG000065324.1[more]
SMESG000021236.15.430e-9145.09SMESG000021236.1[more]
SMESG000021236.14.115e-8440.38SMESG000021236.1[more]
SMESG000055204.16.094e-4054.46SMESG000055204.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025164 ID=SMED30025164|Name=Protein NDRG4|organism=Schmidtea mediterranea sexual|type=transcript|length=1506bp
AAAAAATTTTTCAAAACAGAAATTTTCCACTCTCTACTTTTGTGTGTATT
CAGAAATTTATTTTAACCAAATTTTTTTCTGTTTCATTATTATTGCAGTT
TAATTTTTTTCTTCTAACTGATTTTCTAACAAGGAATTTTTCGACACAAT
GACCGCGCTGAGCAATGAACAAAAAGTTGCTCTCAAGCTACCAAAAATGG
GAGCAATTAATGTTTATATTCAGGGTACTCGAGGTCCAAAGGAGCAGATC
ATTTTGACAGTTCACGACCTCGGGTGTAATCATTACCAATATGAAGAATT
TTTATCCAATCCTAAAATGTCGGCCTTAAGTCAGAAATTCGTATGGATTC
ATGTTGACCTTCCTGGCCAAGGTGATGGGGATGAAGATCTTGAAACAAAT
TTTCCTTCTATGGAAGATATCGCATTGGATTTACAAGAACTTTGTGTGCA
AATGAAATTGTCGAACGTTCTCCTTTTTGGTGAAGGAGCTGGAGCAAATA
TTCTTGCTAGATTTGCTATTAACAGTGAACACTTGGTTTTGGGTGCTATT
TTGATTCACTGTGTTGGCTCAACGGCCTCCATGATTGAATCTCTTAAAGA
CAAGGTGATAAACTGGAAATTAAATTCAATCGGAATGAACCCGACAGCGG
AAAGCTATTTGGTCTTACATAGGTTTGGAACGCAATCAATCAAGTTCAAG
AATGCCGAAAATGAAACAGAACTGAAAAATGTCATAGAAAGCTTTAAATA
CAATTTGAGGAATTCAATAAATCCAAAAAATCTCTACAAATTCATCAATT
CGTTTATGACGCGACGAAATTTGGGAGAAAGAATCGCGAAGTTGAATACG
CCAACTCTATTCATCACTGGTGCCGCAGCAATCCACTGCAAGAACGTCCA
TTTGCTACAGGAAACGTTATTGAAAACAAAACCAGCTGATCAAAAAGTTA
AATTTGAGCTTGTTCAAATAGATGGAGTTGCCAACGTCTTAACTGAAGCG
CCTGAAAAAGTTGTCGTGAGTTTGCAATATTTCCTGCAAGGCCTTGGCTT
AGTCAGTAATCTTCGACTGTCCAATGAGCCCATCAAAATAAACAGACGAA
TGTCAATGGAAGATTATGACAGACCAAGAGGAACTGGATCCTTTAGTAGT
TCCTTGCAGTCCCCAATAAAGATTTCTACACTTGACGAGGCCTATTAATT
ATTAATAGCATGCTGCTTGTTTCATAGAAAGTTCATATTTTAGTATATAA
TAGTTGTTGTGGTATTCACATTTGAACAGGAATATTATACATATATATAT
ATACTTTCTGAAGGCTTTTGGCATTATTATATAATTACAGTGCTGTACAT
AGTTTACTTGTATGCACTGACGCTTTATTATAATTTATATATATATATAT
TTCTTACTGGAAAATTAATGCTTACCAAGTAGCCGTACGATAGGCAGTGT
ATTTGTCATTTTATTTTAATAAATACATTTTTATTTGAAAAAAAAAGATC
GGAAGA
back to top

protein sequence of SMED30025164-orf-1

>SMED30025164-orf-1 ID=SMED30025164-orf-1|Name=SMED30025164-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=350bp
MTALSNEQKVALKLPKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQYEE
FLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNFPSMEDIALDLQELCV
QMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLK
DKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFK
YNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNV
HLLQETLLKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLG
LVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSSSLQSPIKISTLDEAY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
GO:0032287peripheral nervous system myelin maintenance
GO:0042127regulation of cell proliferation
GO:0045576mast cell activation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
IPR004142NDRG
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004142NDRGPFAMPF03096Ndrcoord: 16..302
e-value: 1.5E-68
score: 230.6
IPR004142NDRGPANTHERPTHR11034N-MYC DOWNSTREAM REGULATEDcoord: 12..327
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 3..298
e-value: 1.1E-61
score: 210.8
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 22..245
NoneNo IPR availablePANTHERPTHR11034:SF40BCDNA.GH02439coord: 12..327