cilia- and flagella-associated protein 91

Overview
Namecilia- and flagella-associated protein 91
Smed IDSMED30025152
Uniprot Best hitCilia- and flagella-associated protein 91 OS=Macaca fascicularis OX=9541 GN=MAATS1 PE=2 SV=3 (E=0)
Length (bp)2659
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cilia- and flagella-associated protein 91 (SMED30025152) t-SNE clustered cells

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 91 (SMED30025152) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cilia- and flagella-associated protein 91 (SMED30025152) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 91 (SMED30025152) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025152

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025152SMESG000056200.1 SmedASXL_016813SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30025152SMESG000056200.1 dd_Smed_v4_10405_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025152SMESG000056200.1 dd_Smed_v4_10405_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30025152SMESG000056200.1 dd_Smed_v4_10405_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30025152SMESG000056200.1 dd_Smed_v4_9724_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30025152SMESG000056200.1 dd_Smed_v4_9724_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025152SMESG000056200.1 dd_Smed_v4_9724_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025152SMESG000056200.1 dd_Smed_v4_9724_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30025152SMESG000056200.1 dd_Smed_v4_9724_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025152SMESG000056200.1 dd_Smed_v6_10405_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30025152SMESG000056200.1 dd_Smed_v6_9724_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025152SMESG000056200.1 dd_Smed_v4_10405_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025152SMESG000056200.1 dd_Smed_v4_9724_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30025152SMESG000056200.1 dd_Smed_v4_9724_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30025152SMESG000056200.1 dd_Smed_v4_9724_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025152SMESG000056200.1 SMED_10971_V2_1rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025152SMESG000056200.1 SMED_10971_V2_1rGPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Human
Match: AC069444.2 (novel protein)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 338/711 (47.54%), Postives = 487/711 (68.50%), Query Frame = 1
Query:   91 RNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYA-ESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHY--QISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTN-AGYKKRKYREQDKLRILHESI--KKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFL 2205
            R +D+LYD L+ +S E+DH +A  +A     R++ VP + TMFS+L HYPR  +     DPVP FI+R W+G  E+ +  ++ L     T++  S  +P    E  EV G++R++YF RP +P+  Q+P +V+ AV++++ +     S + +      T+GTQT YRD+DVQTDPYS EY+V     PE+LTLA+LT GRGLPAG  EVEMI+RAR +R  EA LP L+D +Q EKRRKMM+ +E +EWA RE+EIE+LQ++RLEVL +LLR+REE   E++ + L+  W+K Q+ K+     ++  +V  IR+L+  RKNIE K   R+II+DYS+ +SQ + PL+R+G F D NS+ ++V + YL TY GL+ELE   PD+V  P+I  PK    T  AG+ KR  R   +L  +H+++  KK+ V+  K  KP RFL++   P PR PTPT+E+    EE+ E  +I LQK++RGR +Q MMFEGK+KR ELI+ELR+ H+L  +E    K ++   + LQRQ+ L EH+   ++  L+GLEG ++A+MFDFLSKEL+R+QEERRIHAF MLA+R+RR+REAEESG RQ+E++R RE DEIFK+VVKV+ +T+  YL+DII      TA   ++ EIE++A+KIND AYE E   T L+ EE+VA+L+++FLIPEV K  ++EK++  Q+K + +AH+ I + T+  +
Sbjct:   35 RAYDFLYDPLFIVSSEKDHTQANIQATLIRSRLRKVPRFKTMFSNLIHYPRYSLYWSKSDPVPPFISREWKGHKEKHREALRQL-----TTTDASFQMPKEVYEDPEVTGKNRYKYFERPFLPFFQQMPFNVVYAVSKAEPYTFPPTSTKHLSIPSKSTVGTQTDYRDADVQTDPYSAEYVVCQDSIPELLTLATLTWGRGLPAGQAEVEMIERAREKRAWEASLPALSDTSQFEKRRKMMNEMERKEWAFREQEIEKLQEIRLEVLKELLRKREENQNEVNMKHLNARWSKLQEGKEAKMAKIQRTHVSTIRKLVGKRKNIEGKLERRNIIKDYSDYASQVYGPLSRLGCFPDNNSEDFVVKNYYLNTYEGLVELESCLPDFVTQPQIRAPKPKVITTKAGFLKRAARLDYELAEVHKALLDKKNKVLEVK--KPPRFLQRNPIPQPRLPTPTLEMTSNEEEEMEMAVIYLQKLLRGRVVQNMMFEGKEKRLELIQELRTCHALQEDEKLVKKAEKQVTLALQRQRNLHEHKVSLVENHLAGLEGRALADMFDFLSKELVRLQEERRIHAFVMLAERQRRVREAEESGRRQVEKQRLREEDEIFKEVVKVHHSTISSYLEDIILNTEANTAEEQARAEIEKMAEKINDIAYEMESRRTYLQSEEIVAELVYSFLIPEVQKYFVKEKVRNAQRKHILAAHQIIHSYTESMV 738          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Human
Match: MAATS1 (MYCBP associated and testis expressed 1 [Source:HGNC Symbol;Acc:HGNC:24010])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 338/711 (47.54%), Postives = 487/711 (68.50%), Query Frame = 1
Query:   91 RNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYA-ESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHY--QISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTN-AGYKKRKYREQDKLRILHESI--KKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFL 2205
            R +D+LYD L+ +S E+DH +A  +A     R++ VP + TMFS+L HYPR  +     DPVP FI+R W+G  E+ +  ++ L     T++  S  +P    E  EV G++R++YF RP +P+  Q+P +V+ AV++++ +     S + +      T+GTQT YRD+DVQTDPYS EY+V     PE+LTLA+LT GRGLPAG  EVEMI+RAR +R  EA LP L+D +Q EKRRKMM+ +E +EWA RE+EIE+LQ++RLEVL +LLR+REE   E++ + L+  W+K Q+ K+     ++  +V  IR+L+  RKNIE K   R+II+DYS+ +SQ + PL+R+G F D NS+ ++V + YL TY GL+ELE   PD+V  P+I  PK    T  AG+ KR  R   +L  +H+++  KK+ V+  K  KP RFL++   P PR PTPT+E+    EE+ E  +I LQK++RGR +Q MMFEGK+KR ELI+ELR+ H+L  +E    K ++   + LQRQ+ L EH+   ++  L+GLEG ++A+MFDFLSKEL+R+QEERRIHAF MLA+R+RR+REAEESG RQ+E++R RE DEIFK+VVKV+ +T+  YL+DII      TA   ++ EIE++A+KIND AYE E   T L+ EE+VA+L+++FLIPEV K  ++EK++  Q+K + +AH+ I + T+  +
Sbjct:   35 RAYDFLYDPLFIVSSEKDHTQANIQATLIRSRLRKVPRFKTMFSNLIHYPRYSLYWSKSDPVPPFISREWKGHKEKHREALRQL-----TTTDASFQMPKEVYEDPEVTGKNRYKYFERPFLPFFQQMPFNVVYAVSKAEPYTFPPTSTKHLSIPSKSTVGTQTDYRDADVQTDPYSAEYVVCQDSIPELLTLATLTWGRGLPAGQAEVEMIERAREKRAWEASLPALSDTSQFEKRRKMMNEMERKEWAFREQEIEKLQEIRLEVLKELLRKREENQNEVNMKHLNARWSKLQEGKEAKMAKIQRTHVSTIRKLVGKRKNIEGKLERRNIIKDYSDYASQVYGPLSRLGCFPDNNSEDFVVKNYYLNTYEGLVELESCLPDFVTQPQIRAPKPKVITTKAGFLKRAARLDYELAEVHKALLDKKNKVLEVK--KPPRFLQRNPIPQPRLPTPTLEMTSNEEEEMEMAVIYLQKLLRGRVVQNMMFEGKEKRLELIQELRTCHALQEDEKLVKKAEKQVTLALQRQRNLHEHKVSLVENHLAGLEGRALADMFDFLSKELVRLQEERRIHAFVMLAERQRRVREAEESGRRQVEKQRLREEDEIFKEVVKVHHSTISSYLEDIILNTEANTAEEQARAEIEKMAEKINDIAYEMESRRTYLQSEEIVAELVYSFLIPEVQKYFVKEKVRNAQRKHILAAHQIIHSYTESMV 738          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Human
Match: MAATS1 (MYCBP associated and testis expressed 1 [Source:HGNC Symbol;Acc:HGNC:24010])

HSP 1 Score: 154.836 bits (390), Expect = 6.936e-42
Identity = 82/199 (41.21%), Postives = 124/199 (62.31%), Query Frame = 1
Query:   91 RNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYA-ESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHY--QISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCG 678
            R +D+LYD L+ +S E+DH +A  +A     R++ VP + TMFS+L HYPR  +     DPVP FI+R W+G  E+ +  ++ L     T++  S  +P    E  EV G++R++YF RP +P+  Q+P +V+ AV++++ +     S + +      T+GTQT YRD+DVQTDPYS EY+V     PE+LTLA+LT G
Sbjct:   35 RAYDFLYDPLFIVSSEKDHTQANIQATLIRSRLRKVPRFKTMFSNLIHYPRYSLYWSKSDPVPPFISREWKGHKEKHREALRQL-----TTTDASFQMPKEVYEDPEVTGKNRYKYFERPFLPFFQQMPFNVVYAVSKAEPYTFPPTSTKHLSIPSKSTVGTQTDYRDADVQTDPYSAEYVVCQDSIPELLTLATLTWG 228          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Fly
Match: CG15145 (gene:FBgn0032649 transcript:FBtr0080991)

HSP 1 Score: 73.559 bits (179), Expect = 5.653e-13
Identity = 136/536 (25.37%), Postives = 247/536 (46.08%), Query Frame = 1
Query:  565 TQTIYRDSDVQTDPYSPE-YLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRE-LEAQLPPLN---------DFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKI---IRGRA--IQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEV----VADLIHNFLIPEVH 2112
            TQT+YR+S  QT  Y PE Y        E+  L S+  G   P GL+EVE+ +RAR R + L+A    +N         DF Q    + M +A E E W  RE+ I+E Q +RLE++IK+  +RE      S  ++++     ++ + +      ++Y + +R++ K       K   +  +       S  +AP  R G   +R +   + N+R        + ++E      L  +I++    Q     + K K   Q K RI     +         E+ L  L  + +        T+ V D G++ K   + LL K    +R R   +Q   +    +R       RST      + +  ++Q+ ++ +   QK+  + ++ ++   +   EG  +  M  FL+ E+ R++E+RR+H FS+LA ++R   EA E+GLRQ E   R  ++E+F+    V+    D Y+  I+  ++ + A+N +   + E+A++I D   E  L +  L Q  +    +  ++H+ + P+++
Sbjct:  150 TQTLYRESSAQTLAYLPEIYDDDEARTLELFILPSVLPGDK-PPGLYEVEVFERARRRHKFLDALKLKINQQRRHGQKLDFNQY---KTMTEAFEWEHWMEREERIQECQMMRLEIVIKMFDKREREMHAASKTRIEQGCELIEKRRKEALRKNEIEYQRGMRRISKQLAKTSIKWQKQKPMYSLGSPCSDFYAPPMRYGVDPNRRNFNSVTNTRAFN-----MRIDE------LEKQINM----QIIECPFAKLKQWSQPKQRIAEIENRFCN------EEHLDELYHLLR--------TLRVTDGGQQPKPDCLKLLFKHTPNLRSRMSLVQPKSYTNLYERNAYTA--RSTSR--PTQQKAVQEQKNQLSSEYAQKLARDVQKNDLKSMILAYEGSMIGYMMQFLTDEMNRLKEQRRLHFFSLLASKKRWQLEAAEAGLRQKENSIRLLYEEMFQYTNAVSTDVSDQYVHSILTDDLGYMAANEAAEAVTEMAKQI-DMDIERWLESFKLIQNPLNYIPLRLMLHDMVCPDLN 647          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Fly
Match: CG15144 (gene:FBgn0032648 transcript:FBtr0303652)

HSP 1 Score: 62.7734 bits (151), Expect = 1.384e-9
Identity = 70/206 (33.98%), Postives = 106/206 (51.46%), Query Frame = 1
Query:  562 GTQTIYRDSDVQTDPYSPEYLVR-PGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKR--------RKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLR---LKYVKAIR----QLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIG 1131
             TQT+YR+S  QT  + PE L +   E  E+ TLA L  G   P GLHEVE ++RAR R +    L         E R        +++++A E E+W  RE++I++ Q +RLE++IK+  +RE   +EM N    R+    QQ + +    LR   ++Y + +R    QL KT +  E K +P   +Q      S+ + PL R G
Sbjct:  201 ATQTLYRESSAQTLAFLPEILNKDKSETFELYTLAKLLPGDK-PPGLHEVEFLERARRRWKFSKALKDNFKRLLCEAREVSIKTQYKEILEAFEWEQWIQREEDIQQCQMMRLEIVIKMFDKRE---KEMHNASKARIEKSVQQIEKRRQDGLRKNEIEYQRGMRRNNIQLAKTARKWE-KQSP---MQALGSPCSEFYGPLIRYG 398          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Fly
Match: CG15143 (gene:FBgn0032647 transcript:FBtr0080993)

HSP 1 Score: 51.6026 bits (122), Expect = 3.856e-6
Identity = 61/204 (29.90%), Postives = 106/204 (51.96%), Query Frame = 1
Query:  565 TQTIYRDSDVQTDPYSPE-YLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLP-PLNDFAQSEKR-------RKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIR----QLLKTRKNIENKHAPRDIIQDYSEG--SSQTWAPLTRIG 1131
            TQT+YR+S  QT  Y PE +     E  E+ +L S+      P GLHEVE+++RAR R      L     +  Q  ++       +++++AIE E+W  RE++I+E Q +RL+++IK+  +RE+     S  +++    + ++ +        +++ + +R    QL K  +  E K +P      Y+ G  SS+ +APL R G
Sbjct:  139 TQTLYRESSAQTMAYLPEIFEANSVETLELFSLPSIFPVANRP-GLHEVEILERARKRWAFSDALKIHFKNLLQDARKVAIKTELKEILEAIEWEQWIQREEDIQECQMMRLQIVIKMFDKREKEMHTASKTRIETACERIEKRRQAGLRKNEIEFQRGMRRMEFQLTKNPRRWE-KQSPM-----YALGSPSSEFYAPLLRYG 335          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Zebrafish
Match: maats1 (MYCBP-associated, testis expressed 1 [Source:ZFIN;Acc:ZDB-GENE-070912-489])

HSP 1 Score: 497.664 bits (1280), Expect = 1.180e-163
Identity = 347/756 (45.90%), Postives = 498/756 (65.87%), Query Frame = 1
Query:   88 ERNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHYQISDEEIYHA-LTRTIGTQTIYRDSDVQTDPYSPEYLVRPGE-APEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFLINPNANDAQVETMGSDDDFISNSEKRNEILPETRKKYENYNITNTDVE 2349
            +R +DYLYD +Y LS + DH R   +A +S +R++ VP + +M SDL H+P+  +R+   DPVP FI+R WRG+ EQ +  ++ L+       I+S  + +    A V G DR+++F+RP+IP+A Q+PPDV+ A+ +SD      D++       R++  QT YR+S+ QTDPYSP YL+RPG  +PE+LTLA+LT G GLPAGL EVEMI RAR +R  EA LPPLND +Q +KRR+MM+ +E +EWA RE+EIE+LQ+ RL +L++LLRQREE  +E+  ++LD  ++++Q EK+     +R  Y+ A+R+LL  RKN+E     RDII+DYS+  SQ +APL R GQ  DRNS +  V S +L+TY GLLELE S    V  P+I VPK       G+  R  R   +L   H+++K+  V    E+KPLRFL K EKP+PRPPTPT+E P EG+E++E  II LQK++RGR+ Q  MFE K++  ELI+ELR+TH+L   E +  + ++   + LQRQ+     RE  I+   + L G  + +M DFLSKEL+R+QEERRIHAF++LA+R+RRIREAEESG RQ+EERRRRE DEIFKQVV+V+Q TVD YL+D+I  +I+ TA   ++ EI   A+++N+  Y  E    + + EE+VA+L++ FLIPEV K D +E+++ +Q++ L +A           +I+P +    V T      + ++S   N IL +  +     N+T+ D E
Sbjct:   22 QRTYDYLYDPVYTLSADVDHGRENIRAQASLDRMRRVPEFNSMISDLPHHPQYSLRLEATDPVPGFIDRRWRGYAEQRRQALQQLT------GIVSGAVTHAPNPANVTGVDRWKFFKRPLIPFAQQIPPDVVFALPKSDLLSSDGDDKRSPTPFQRSVAVQTDYRESETQTDPYSPSYLLRPGTTSPELLTLATLTWGHGLPAGLAEVEMIKRARIKRAWEATLPPLNDLSQLDKRRRMMEEMERKEWAFREQEIEKLQETRLTLLLQLLRQREEEQEEVKMERLDASFSQRQNEKEARLKKIRSDYIIAMRKLLAKRKNVEGNLEKRDIIKDYSDYGSQMYAPLARTGQTPDRNSNRSTVKSHFLSTYQGLLELEASLSPSVTLPQIKVPKPK--VTKGFISRSARRDLELMKTHQALKEEKVCRV-EKKPLRFLFKKEKPVPRPPTPTVEKPPEGDEERELAIIFLQKLLRGRSTQNQMFEEKERWLELIQELRTTHALQKEEQDKKEVEKQVTLALQRQRDFQIDREAQIESFTAALSGGVIVDMLDFLSKELVRLQEERRIHAFTLLAERDRRIREAEESGRRQIEERRRREEDEIFKQVVRVHQDTVDMYLEDVILTSINQTADAQAREEIHRKAEELNNITYAMEETMNSQQSEEIVAELVYRFLIPEVQKMDFRERVRHSQRRHLQAAR---------LIISPGST---VPTEPQSPSYRASSAILNHILSQVEEVVPG-NLTSRDPE 755          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Zebrafish
Match: maats1 (MYCBP-associated, testis expressed 1 [Source:ZFIN;Acc:ZDB-GENE-070912-489])

HSP 1 Score: 459.529 bits (1181), Expect = 5.843e-150
Identity = 318/652 (48.77%), Postives = 445/652 (68.25%), Query Frame = 1
Query:   88 ERNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHYQISDEEIYHA-LTRTIGTQTIYRDSDVQTDPYSPEYLVRPGE-APEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESE 2037
            +R +DYLYD +Y LS + DH R   +A +S +R++ VP + +M SDL H+P+  +R+   DPVP FI+R WRG+ EQ +  ++ L+       I+S  + +    A V G DR+++F+RP+IP+A Q+PPDV+ A+ +SD      D++       R++  QT YR+S+ QTDPYSP YL+RPG  +PE+LTLA+LT G GLPAGL EVEMI RAR +R  EA LPPLND +Q +KRR+MM+ +E +EWA RE+EIE+LQ+ RL +L++LLRQREE  +E+  ++LD  ++++Q EK+     +R  Y+ A+R+LL  RKN+E     RDII+DYS+  SQ +APL R GQ  DRNS +  V S +L+TY GLLELE S    V  P+I VPK       G+  R  R   +L   H+++K+  V    E+KPLRFL K EKP+PRPPTPT+E P EG+E++E  II LQK++RGR+ Q  MFE K++  ELI+ELR+TH+L   E +  + ++   + LQRQ+     RE  I+   + L G  + +M DFLSKEL+R+QEERRIHAF++LA+R+RRIREAEESG RQ+EERRRRE DEIFKQVV+V+Q TVD YL+D+I  +I+ TA   ++ EI   A+++N+  Y  E
Sbjct:   22 QRTYDYLYDPVYTLSADVDHGRENIRAQASLDRMRRVPEFNSMISDLPHHPQYSLRLEATDPVPGFIDRRWRGYAEQRRQALQQLT------GIVSGAVTHAPNPANVTGVDRWKFFKRPLIPFAQQIPPDVVFALPKSDLLSSDGDDKRSPTPFQRSVAVQTDYRESETQTDPYSPSYLLRPGTTSPELLTLATLTWGHGLPAGLAEVEMIKRARIKRAWEATLPPLNDLSQLDKRRRMMEEMERKEWAFREQEIEKLQETRLTLLLQLLRQREEEQEEVKMERLDASFSQRQNEKEARLKKIRSDYIIAMRKLLAKRKNVEGNLEKRDIIKDYSDYGSQMYAPLARTGQTPDRNSNRSTVKSHFLSTYQGLLELEASLSPSVTLPQIKVPKPK--VTKGFISRSARRDLELMKTHQALKEEKVCRV-EKKPLRFLFKKEKPVPRPPTPTVEKPPEGDEERELAIIFLQKLLRGRSTQNQMFEEKERWLELIQELRTTHALQKEEQDKKEVEKQVTLALQRQRDFQIDREAQIESFTAALSGGVIVDMLDFLSKELVRLQEERRIHAFTLLAERDRRIREAEESGRRQIEERRRREEDEIFKQVVRVHQDTVDMYLEDVILTSINQTADAQAREEIHRKAEELNNITYAME 664          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Zebrafish
Match: maats1 (MYCBP-associated, testis expressed 1 [Source:ZFIN;Acc:ZDB-GENE-070912-489])

HSP 1 Score: 461.455 bits (1186), Expect = 6.972e-150
Identity = 338/755 (44.77%), Postives = 484/755 (64.11%), Query Frame = 1
Query:   88 ERNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHYQISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGE-APEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFLINPNANDAQVETMGSDDDFISNSEKRNEILPETRKKYENYNITNTDVE 2349
            +R +DYLYD +Y LS + DH R   +A +S +R++ VP + +M SDL H+P+  +R+   DPVP FI+R WRG+ EQ +  ++ L+       I+S  + +    A V G DR+++F+R           D++     SD      D+       R++  QT YR+S+ QTDPYSP YL+RPG  +PE+LTLA+LT G GLPAGL EVEMI RAR +R  EA LPPLND +Q +KRR+MM+ +E +EWA RE+EIE+LQ+ RL +L++LLRQREE  +E+  ++LD  ++++Q EK+     +R  Y+ A+R+LL  RKN+E     RDII+DYS+  SQ +APL R GQ  DRNS +  V S +L+TY GLLELE S    V  P+I VPK       G+  R  R   +L   H+++K+  V    E+KPLRFL K EKP+PRPPTPT+E P EG+E++E  II LQK++RGR+ Q  MFE K++  ELI+ELR+TH+L   E +  + ++   + LQRQ+     RE  I+   + L G  + +M DFLSKEL+R+QEERRIHAF++LA+R+RRIREAEESG RQ+EERRRRE DEIFKQVV+V+Q TVD YL+D+I  +I+ TA   ++ EI   A+++N+  Y  E    + + EE+VA+L++ FLIPEV K D +E+++ +Q++ L +A           +I+P +    V T      + ++S   N IL +  +     N+T+ D E
Sbjct:   22 QRTYDYLYDPVYTLSADVDHGRENIRAQASLDRMRRVPEFNSMISDLPHHPQYSLRLEATDPVPGFIDRRWRGYAEQRRQALQQLT------GIVSGAVTHAPNPANVTGVDRWKFFKRS----------DLL----SSDG----DDKRSPTPFQRSVAVQTDYRESETQTDPYSPSYLLRPGTTSPELLTLATLTWGHGLPAGLAEVEMIKRARIKRAWEATLPPLNDLSQLDKRRRMMEEMERKEWAFREQEIEKLQETRLTLLLQLLRQREEEQEEVKMERLDASFSQRQNEKEARLKKIRSDYIIAMRKLLAKRKNVEGNLEKRDIIKDYSDYGSQMYAPLARTGQTPDRNSNRSTVKSHFLSTYQGLLELEASLSPSVTLPQIKVPKPK--VTKGFISRSARRDLELMKTHQALKEEKVCRV-EKKPLRFLFKKEKPVPRPPTPTVEKPPEGDEERELAIIFLQKLLRGRSTQNQMFEEKERWLELIQELRTTHALQKEEQDKKEVEKQVTLALQRQRDFQIDREAQIESFTAALSGGVIVDMLDFLSKELVRLQEERRIHAFTLLAERDRRIREAEESGRRQIEERRRREEDEIFKQVVRVHQDTVDMYLEDVILTSINQTADAQAREEIHRKAEELNNITYAMEETMNSQQSEEIVAELVYRFLIPEVQKMDFRERVRHSQRRHLQAAR---------LIISPGST---VPTEPQSPSYRASSAILNHILSQVEEVVPG-NLTSRDPE 736          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Xenopus
Match: zbtb33 (zinc finger and BTB domain containing 33 [Source:Xenbase;Acc:XB-GENE-486567])

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 364/724 (50.28%), Postives = 508/724 (70.17%), Query Frame = 1
Query:   91 RNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPN--YAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHYQISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFLINPNANDAQVETMGSDD 2256
            R +D+LYD L  LS E+DHA+A+++A  S +R+Q VP YPTMFS+L H PR  +R+  KDPVP+F++R WRG  EQ    M+ L++        S+  P    A + EV GRDR++YF RP++P+  Q+ P+V+LA++++D     + +     L RT+  QT YRDS+ QTDPYSPEY+ RPG  PE+LTLA+LT GRGLPAGL EVEMI+RAR +R  EA LPPL+D +Q EKRRKMMD  E +EWA REKEIE+LQ+ RLEVL KLL++REE  +E+  ++LD  W+K Q EK++    +R +++ AIR+L     N+E K   RDII+++S+ +SQT+APL+RIG F DR S+QY+V S +L +Y GLLELE + PD+V  P++ VPK    T +G+ KR      +L  +H ++  +       +KPLRFLEKIEKP PRP TP ++ P EG+E++E  +ILLQ++IRGR IQ  MFEGK+KR ELI+ELR+TH+L        K ++   + LQRQ+ L EH+   +D  LS LEG  +++MFDFLSKEL+R+QEERRIHAF+MLA+R+RRIREAEESGLRQLEERRRRE DEIF+Q+V V Q+TVD YL++II    + TA   ++ EI+  A++IND AY+ E   + ++ EE+VA+L+++FLIPEV K  ++++++++Q++ + +AHR I   T  FL     N A   T G ++
Sbjct:   19 RAYDFLYDPLCTLSSEKDHAQASFRAQLSHDRMQKVPVYPTMFSELVHKPRYSLRLQLKDPVPQFMDRRWRGRAEQRLNAMRQLAQ--------SQAPPPQVLAGNGEVSGRDRYKYFERPLVPFVQQVLPNVLLAISRAD--LSPAPDRPASPLVRTVAIQTDYRDSEAQTDPYSPEYVARPGSVPELLTLANLTWGRGLPAGLAEVEMIERAREKRAWEATLPPLSDTSQLEKRRKMMDEQERKEWAFREKEIEKLQEARLEVLQKLLQKREEKQKEIDTKRLDSRWSKLQAEKEERIKQIRKQHITAIRKLTGKMNNVEGKLERRDIIKEFSDCASQTYAPLSRIGYFPDRLSEQYVVKSPFLNSYQGLLELEANLPDFVTQPRVKVPKVRTTTRSGFLKRTAVLDRELEQVHAALLANKTKTPTSKKPLRFLEKIEKPAPRPETPRVQDPPEGDEERELAVILLQRLIRGRGIQNTMFEGKEKRVELIQELRTTHALQEEGQLLKKAEKQATLALQRQRELGEHKASVLDSHLSELEGGVLSDMFDFLSKELVRLQEERRIHAFAMLAERQRRIREAEESGLRQLEERRRREEDEIFRQLVHVQQSTVDSYLEEIILSATETTAEEQARQEIQRKAEEINDIAYQMESSRSRIQSEEIVAELVYSFLIPEVQKTSVRDRVRRSQRRHIQAAHRVICRDTQAFL---EQNGALQSTFGGNN 729          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Xenopus
Match: zbtb33 (zinc finger and BTB domain containing 33 [Source:Xenbase;Acc:XB-GENE-486567])

HSP 1 Score: 537.339 bits (1383), Expect = 7.040e-180
Identity = 327/685 (47.74%), Postives = 455/685 (66.42%), Query Frame = 1
Query:   91 RNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQS----DNHYQISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEK 2133
            R +D+LYD L  LS E+DHA+A+++A  S +R+Q VP YPTMFS+L H PR  +R+  KDPVP+F++R WRG  EQ    M+ L++       +       A + EV GRDR++YF R +  Y       ++++ N S          + +     L RT+  QT YRDS+ QTDPYSPEY+ RPG  PE+LTLA+LT GRGLPAGL EVEMI+RAR +R  EA LPPL+D +Q EKRRKMMD  E +EWA REKEIE+LQ+ RLEVL KLL++REE  +E+  ++LD  W+K Q EK++    +R +++ AIR+L     N+E K   RDII+++S+ +SQT+APL+RIG F DR S+QY+V S +L +Y GLLELE + PD+V  P++ VPK    T +G+ KR      +L  +H   +   ++                    P    +    +G+E++E  +ILLQ++IRGR IQ  MFEGK+KR ELI+ELR+TH+L        K ++   + LQRQ+ L EH+   +D  LS LEG  +++MFDFLSKEL+R+QEERRIHAF+MLA+R+RRIREAEESGLRQLEERRRRE DEIF+Q+V V Q+TVD YL++II    + TA   ++ EI+  A++IND AY+ E   + ++ EE+VA+L+++FLIPEV K  ++++
Sbjct:   19 RAYDFLYDPLCTLSSEKDHAQASFRAQLSHDRMQKVPVYPTMFSELVHKPRYSLRLQLKDPVPQFMDRRWRGRAEQRLNAMRQLAQSQAPPPQV------LAGNGEVSGRDRYKYFERYVTLY-------LVISTNYSLLLVRADLSPAPDRPASPLVRTVAIQTDYRDSEAQTDPYSPEYVARPGSVPELLTLANLTWGRGLPAGLAEVEMIERAREKRAWEATLPPLSDTSQLEKRRKMMDEQERKEWAFREKEIEKLQEARLEVLQKLLQKREEKQKEIDTKRLDSRWSKLQAEKEERIKQIRKQHITAIRKLTGKMNNVEGKLERRDIIKEFSDCASQTYAPLSRIGYFPDRLSEQYVVKSPFLNSYQGLLELEANLPDFVTQPRVKVPKVRTTTRSGFLKRTAVLDRELEQVHAVWRACSLL--------------------PTWILLCFSQQGDEERELAVILLQRLIRGRGIQNTMFEGKEKRVELIQELRTTHALQEEGQLLKKAEKQATLALQRQRELGEHKASVLDSHLSELEGGVLSDMFDFLSKELVRLQEERRIHAFAMLAERQRRIREAEESGLRQLEERRRREEDEIFRQLVHVQQSTVDSYLEEIILSATETTAEEQARQEIQRKAEEINDIAYQMESSRSRIQSEEIVAELVYSFLIPEVQKTSVRDR 670          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Mouse
Match: Maats1 (MYCBP-associated, testis expressed 1 [Source:MGI Symbol;Acc:MGI:2443598])

HSP 1 Score: 541.191 bits (1393), Expect = 1.971e-180
Identity = 333/711 (46.84%), Postives = 476/711 (66.95%), Query Frame = 1
Query:   91 RNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHYQISDEEIYHAL--TRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPK-QSQFTNAGYKKRKYREQDKLRILHESI---KKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFL 2205
            R +DYLYD L+ +S ERDHA+A  +A     R++ VPN+ +MFS+L H+PR  +     DPVP  + R WRG   + K +++ L    DTS  + +      E  +V G++R+++F RP +P+  Q+P +V+L+  ++       +   Y  +    T+ TQT YRD+DVQTDPYSPEY+V     PE+LTLA+LT GRGLPAG  EVE+I+RAR +R  EA LPPLND  Q+EKRRKMM+A+E +EWA RE EIE+LQ+LRLEVL +LL++REE   E++ + L+  W K Q+ K+     +R K+V  IR+L+   KNIE K   RDII DYS  +SQ + PL+R+G+F D NS+ ++V + YL TY GL+ELE S PD+V  P+I  PK Q   T AG+ KR  R   +L  +H+++   K  G+  TK    LRFL+K      R PTP++E+    E + E  +I LQK++RGR +Q MMFEGK+KR ELI ELR++H+L  ++    K ++   + LQRQ+ L E +   I+  L  LEG  +A+MFDFLSKEL+R+QEERRIHAF+MLA+R+RR+REAEESG RQ+E++R ++ D IFK+V+KV+Q+TV  YL+DII    + TA   ++ EIE++A++IN+ AYE E   T L+ EE+VA+L+++FLIPEV K  ++EK++  Q+K + +AH  I + T+  L
Sbjct:   34 RTYDYLYDPLFIVSSERDHAQANIQATLIRSRLKKVPNFRSMFSNLFHHPRYSMYWSKTDPVPLHVTREWRGQEAKHKEVLR-LQAAMDTSFQMPK---EKDEDPDVSGKNRYKFFDRPFLPFLQQMPLNVVLSPVKTQPLLLTPESSKYAIIPTKSTVATQTDYRDADVQTDPYSPEYVVCQDTIPELLTLANLTWGRGLPAGQAEVEIIERAREKRAWEATLPPLNDSVQAEKRRKMMNAMERKEWAFREGEIEKLQELRLEVLKQLLKRREEDQNELNMRHLNDQWYKLQEAKEAKVAQIRHKHVSDIRKLMGKGKNIEGKLQRRDIISDYSNFASQVYGPLSRLGRFPDNNSEDFVVRNHYLNTYEGLVELESSLPDFVTQPRIKPPKPQIITTKAGFLKRTARMDYELAEVHKALVDKKNKGLEGTKS---LRFLQKNPISQARLPTPSLEMTSYEEGEIEMAVIYLQKLLRGRVVQNMMFEGKEKRLELILELRTSHALQEDDKLVKKAEKQVTLALQRQRNLHEDKLSVIENHLGDLEGRVLADMFDFLSKELVRLQEERRIHAFAMLAERQRRMREAEESGRRQVEQKRLQQEDMIFKEVIKVHQSTVTSYLEDIILNTEERTAEEQARKEIEKIAEEINNIAYEMENRRTYLQSEEIVAELVYSFLIPEVQKDFVKEKVRNAQRKHILAAHEIIHSNTETML 737          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Mouse
Match: Maats1 (MYCBP-associated, testis expressed 1 [Source:MGI Symbol;Acc:MGI:2443598])

HSP 1 Score: 240.736 bits (613), Expect = 1.598e-71
Identity = 142/314 (45.22%), Postives = 204/314 (64.97%), Query Frame = 1
Query:   91 RNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHYQISDEEIYHAL--TRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQL 1026
            R +DYLYD L+ +S ERDHA+A  +A     R++ VPN+ +MFS+L H+PR  +     DPVP  + R WRG   + K +++ L    DTS  + +      E  +V G++R+++F RP +P+  Q+P +V+L+  ++       +   Y  +    T+ TQT YRD+DVQTDPYSPEY+V     PE+LTLA+LT GRGLPAG  EVE+I+RAR +R  EA LPPLND  Q+EKRRKMM+A+E +EWA RE EIE+LQ+LRLEVL +LL++REE   E++ + L+  W K Q+ K+     +R K+V    ++
Sbjct:   34 RTYDYLYDPLFIVSSERDHAQANIQATLIRSRLKKVPNFRSMFSNLFHHPRYSMYWSKTDPVPLHVTREWRGQEAKHKEVLR-LQAAMDTSFQMPK---EKDEDPDVSGKNRYKFFDRPFLPFLQQMPLNVVLSPVKTQPLLLTPESSKYAIIPTKSTVATQTDYRDADVQTDPYSPEYVVCQDTIPELLTLANLTWGRGLPAGQAEVEIIERAREKRAWEATLPPLNDSVQAEKRRKMMNAMERKEWAFREGEIEKLQELRLEVLKQLLKRREEDQNELNMRHLNDQWYKLQEAKEAKVAQIRHKHVSEAEEM 343          
BLAST of cilia- and flagella-associated protein 91 vs. UniProt
Match: sp|Q95LR0|CFA91_MACFA (Cilia- and flagella-associated protein 91 OS=Macaca fascicularis OX=9541 GN=MAATS1 PE=2 SV=3)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 335/708 (47.32%), Postives = 485/708 (68.50%), Query Frame = 1
Query:   91 RNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHY--QISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTN-AGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFL 2205
            R +D+LYD L+ +S E+DH +A  +A     R++ VP + TMFS+L HYPR  +     DPVP FI+R W+G  E+ +  ++ L+ + DTS  + R +    E  EV G++R++YF RP +P+  Q+P +V+ A+++++ +     S +++      T+GTQT YRD+DVQTDPYSPEY+V     PE+LTLA+LT GRGLPAG  EVEMI+RAR +R  EA LP L+D +Q EKRRKMM+ +E +EWA RE+EIE+LQ++RLEVL +LLR+REE   E++ + L+  W+K Q+ K+     ++  +V  IR+L+   KNIE K   R+I +DYS+ +SQ + PL+R+G F D NS+ ++V + YL TY GL+ELE   PD+V  P+I  PK    T  AG+ KR  R   +L  +H+++      + +  KP RFL++   P PR PTPT+E+    EE+ E  +I LQK++RGR IQ MMFEGK+KR ELI+ELR+ H+L  +E    K ++   + LQRQ+ L EH+   ++  L+GLEG ++A+MFDFLSKEL+R+QEERRIHAF MLA+R+RRIREAEESG RQ+E++R RE DEIFK+VVKV+ +T+  YL+DII      TA   ++ EIE++A+KIND AYE E   T L+ EE+VA+L+++FLIPEV K  ++EK++  Q+K + +AH+ I + T+  +
Sbjct:   35 RAYDFLYDPLFIVSSEKDHTQANIQATLIRSRLRKVPRFKTMFSNLIHYPRYSLYWSKSDPVPPFISRQWKGHEEKHREALRQLA-ITDTSFQMPREV---YEDPEVTGKNRYKYFERPFLPFFQQMPFNVVYAISKAEPYTFPPTSTKQLSIPSKLTVGTQTDYRDADVQTDPYSPEYVVCQDSIPELLTLATLTWGRGLPAGQAEVEMIERAREKRAWEATLPALSDTSQFEKRRKMMNEMERKEWAFREQEIEKLQEIRLEVLKELLRKREENQNEVNMKHLNARWSKLQEAKEAKMATIQRTHVSTIRKLVGKGKNIEGKLERRNITKDYSDYASQVYGPLSRLGCFPDNNSEDFVVKNYYLNTYEGLVELESRLPDFVTQPRIRAPKPKVITTKAGFLKRAARLDYELAEVHKALLDKKNKVLEARKPPRFLQRNPIPQPRLPTPTLEMTSNEEEEIEMAVIYLQKLLRGRVIQNMMFEGKEKRLELIQELRTCHALQEDEKLVKKAEKQVTLALQRQRNLHEHKVSLVENHLAGLEGRALADMFDFLSKELVRLQEERRIHAFVMLAERQRRIREAEESGRRQVEKQRLREEDEIFKEVVKVHHSTISSYLEDIILNTEANTAEEQARAEIEKMAEKINDIAYEMESRRTYLQSEEIVAELVYSFLIPEVQKYFVKEKVRNAQRKHILAAHQIIHSCTESMV 738          
BLAST of cilia- and flagella-associated protein 91 vs. UniProt
Match: sp|Q7Z4T9|CFA91_HUMAN (Cilia- and flagella-associated protein 91 OS=Homo sapiens OX=9606 GN=MAATS1 PE=1 SV=3)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 338/711 (47.54%), Postives = 487/711 (68.50%), Query Frame = 1
Query:   91 RNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYA-ESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHY--QISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTN-AGYKKRKYREQDKLRILHESI--KKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFL 2205
            R +D+LYD L+ +S E+DH +A  +A     R++ VP + TMFS+L HYPR  +     DPVP FI+R W+G  E+ +  ++ L     T++  S  +P    E  EV G++R++YF RP +P+  Q+P +V+ AV++++ +     S + +      T+GTQT YRD+DVQTDPYS EY+V     PE+LTLA+LT GRGLPAG  EVEMI+RAR +R  EA LP L+D +Q EKRRKMM+ +E +EWA RE+EIE+LQ++RLEVL +LLR+REE   E++ + L+  W+K Q+ K+     ++  +V  IR+L+  RKNIE K   R+II+DYS+ +SQ + PL+R+G F D NS+ ++V + YL TY GL+ELE   PD+V  P+I  PK    T  AG+ KR  R   +L  +H+++  KK+ V+  K  KP RFL++   P PR PTPT+E+    EE+ E  +I LQK++RGR +Q MMFEGK+KR ELI+ELR+ H+L  +E    K ++   + LQRQ+ L EH+   ++  L+GLEG ++A+MFDFLSKEL+R+QEERRIHAF MLA+R+RR+REAEESG RQ+E++R RE DEIFK+VVKV+ +T+  YL+DII      TA   ++ EIE++A+KIND AYE E   T L+ EE+VA+L+++FLIPEV K  ++EK++  Q+K + +AH+ I + T+  +
Sbjct:   35 RAYDFLYDPLFIVSSEKDHTQANIQATLIRSRLRKVPRFKTMFSNLIHYPRYSLYWSKSDPVPPFISREWKGHKEKHREALRQL-----TTTDASFQMPKEVYEDPEVTGKNRYKYFERPFLPFFQQMPFNVVYAVSKAEPYTFPPTSTKHLSIPSKSTVGTQTDYRDADVQTDPYSAEYVVCQDSIPELLTLATLTWGRGLPAGQAEVEMIERAREKRAWEASLPALSDTSQFEKRRKMMNEMERKEWAFREQEIEKLQEIRLEVLKELLRKREENQNEVNMKHLNARWSKLQEGKEAKMAKIQRTHVSTIRKLVGKRKNIEGKLERRNIIKDYSDYASQVYGPLSRLGCFPDNNSEDFVVKNYYLNTYEGLVELESCLPDFVTQPQIRAPKPKVITTKAGFLKRAARLDYELAEVHKALLDKKNKVLEVK--KPPRFLQRNPIPQPRLPTPTLEMTSNEEEEMEMAVIYLQKLLRGRVVQNMMFEGKEKRLELIQELRTCHALQEDEKLVKKAEKQVTLALQRQRNLHEHKVSLVENHLAGLEGRALADMFDFLSKELVRLQEERRIHAFVMLAERQRRVREAEESGRRQVEKQRLREEDEIFKEVVKVHHSTISSYLEDIILNTEANTAEEQARAEIEKMAEKINDIAYEMESRRTYLQSEEIVAELVYSFLIPEVQKYFVKEKVRNAQRKHILAAHQIIHSYTESMV 738          
BLAST of cilia- and flagella-associated protein 91 vs. UniProt
Match: sp|Q8BRC6|CFA91_MOUSE (Cilia- and flagella-associated protein 91 OS=Mus musculus OX=10090 GN=Maats1 PE=1 SV=3)

HSP 1 Score: 541.191 bits (1393), Expect = 1.379e-179
Identity = 333/711 (46.84%), Postives = 476/711 (66.95%), Query Frame = 1
Query:   91 RNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHYQISDEEIYHAL--TRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPK-QSQFTNAGYKKRKYREQDKLRILHESI---KKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFL 2205
            R +DYLYD L+ +S ERDHA+A  +A     R++ VPN+ +MFS+L H+PR  +     DPVP  + R WRG   + K +++ L    DTS  + +      E  +V G++R+++F RP +P+  Q+P +V+L+  ++       +   Y  +    T+ TQT YRD+DVQTDPYSPEY+V     PE+LTLA+LT GRGLPAG  EVE+I+RAR +R  EA LPPLND  Q+EKRRKMM+A+E +EWA RE EIE+LQ+LRLEVL +LL++REE   E++ + L+  W K Q+ K+     +R K+V  IR+L+   KNIE K   RDII DYS  +SQ + PL+R+G+F D NS+ ++V + YL TY GL+ELE S PD+V  P+I  PK Q   T AG+ KR  R   +L  +H+++   K  G+  TK    LRFL+K      R PTP++E+    E + E  +I LQK++RGR +Q MMFEGK+KR ELI ELR++H+L  ++    K ++   + LQRQ+ L E +   I+  L  LEG  +A+MFDFLSKEL+R+QEERRIHAF+MLA+R+RR+REAEESG RQ+E++R ++ D IFK+V+KV+Q+TV  YL+DII    + TA   ++ EIE++A++IN+ AYE E   T L+ EE+VA+L+++FLIPEV K  ++EK++  Q+K + +AH  I + T+  L
Sbjct:   34 RTYDYLYDPLFIVSSERDHAQANIQATLIRSRLKKVPNFRSMFSNLFHHPRYSMYWSKTDPVPLHVTREWRGQEAKHKEVLR-LQAAMDTSFQMPK---EKDEDPDVSGKNRYKFFDRPFLPFLQQMPLNVVLSPVKTQPLLLTPESSKYAIIPTKSTVATQTDYRDADVQTDPYSPEYVVCQDTIPELLTLANLTWGRGLPAGQAEVEIIERAREKRAWEATLPPLNDSVQAEKRRKMMNAMERKEWAFREGEIEKLQELRLEVLKQLLKRREEDQNELNMRHLNDQWYKLQEAKEAKVAQIRHKHVSDIRKLMGKGKNIEGKLQRRDIISDYSNFASQVYGPLSRLGRFPDNNSEDFVVRNHYLNTYEGLVELESSLPDFVTQPRIKPPKPQIITTKAGFLKRTARMDYELAEVHKALVDKKNKGLEGTKS---LRFLQKNPISQARLPTPSLEMTSYEEGEIEMAVIYLQKLLRGRVVQNMMFEGKEKRLELILELRTSHALQEDDKLVKKAEKQVTLALQRQRNLHEDKLSVIENHLGDLEGRVLADMFDFLSKELVRLQEERRIHAFAMLAERQRRMREAEESGRRQVEQKRLQQEDMIFKEVIKVHQSTVTSYLEDIILNTEERTAEEQARKEIEKIAEEINNIAYEMENRRTYLQSEEIVAELVYSFLIPEVQKDFVKEKVRNAQRKHILAAHEIIHSNTETML 737          
BLAST of cilia- and flagella-associated protein 91 vs. UniProt
Match: sp|A8IH47|CFA91_CHLRE (Cilia- and flagella-associated protein 91 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP91 PE=1 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 7.180e-37
Identity = 128/426 (30.05%), Postives = 212/426 (49.77%), Query Frame = 1
Query:   88 ERNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYAS-QLPPDVILAVNQSDNHYQISDEEIYHAL---------TRTIGTQTIYRDSDVQTDPYSPEY-LVRPG---------------EAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQ---QEKDKLFLNLRLKYVKAIRQLLKTRKNIENK---HAPRDIIQDYSEGSSQTWAPLTRIGQFLDRN--SQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQ 1263
            +R +D LYD  + ++G RDH R    A   +  I+  P Y   FS+L H+P + +R+ + D VP F++R++R                 D +    R     +++  V G +R +YFRRP++  A   +       +    +H  ++                 ++TIGTQ+ YR+++ QT P+ P Y L  PG               + PEVL L  L    GLPAGL EV  ID+ R +R  EA LPP++D A+   R++M++  E +EW  RE+EI  +Q  RLE+L   L+ REE   E+ ++   R+  +K+     +   F +++   +K +RQL++ RK +E     H P  I++ Y+   S T+APL R G+F +     ++         T  G+++LE   P  +LNP+++ P++
Sbjct:    5 QRPYDALYDPNFTVAGPRDHYRQQTMAGGFN--IERAPVYNNFFSELPHHPPSTLRLKNADRVPAFVDRNYR-------------PAANDPNDTRQR-----SDALAVSGPNRPKYFRRPMLAAAEIHIKQAPPSQLPPLPSHQDLNATAPAAMGGAGGLGEPRSKTIGTQSDYRENEAQTAPWEPGYVLPAPGALTAKQAALMRRYHTDVPEVLQLKDLAFPDGLPAGLQEVTRIDKMRAKRAFEASLPPIDDVARLPLRQRMIEEWEAKEWEEREQEILSIQDKRLELLDNALQVREE---ELDDENRLRVEARKEAMLAGRAGKFADVQATRIKTMRQLIENRKYVEKHRKLHKP-TIVERYANYGSGTYAPLQREGRFPESKPLGKEIETEGYAPVTLKGVVDLESFLPSRLLNPRVAAPQK 406          
BLAST of cilia- and flagella-associated protein 91 vs. TrEMBL
Match: gnl|BL_ORD_ID|15745653 (tr|R7UKA3|R7UKA3_CAPTE CFAP91 domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_90714 PE=4 SV=1)

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 389/701 (55.49%), Postives = 524/701 (74.75%), Query Frame = 1
Query:  112 DKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHYQISDEEIYHALT---RTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFL 2205
            DK + +S ERDHARAT+KA++S+ R++ VPNYPTMFS L H+PR Q+++   DPVPKFI+R WRG+ +Q +  +   +      ++  +  P   +SA V G +R+++FRRPIIP+  Q+PP+V L+  + D     + E    A T   RT  TQT YRD + QTDPY+PEY+VRPG APE+LTLA+L+ GRGLPAGL EVEMI+RAR +R  EA LPPLND +Q +KRRKMMD +ET EWA+RE EIE+LQ+ RLEVL +LL+QREE +Q+++ ++LDRLW +KQ+EK++    +R +++K IR+L + R+ +E K   RD + DY++  SQT+AP+TR+G FLDR S+QY+V SRY++TY GLLELE+S PDYV+ P+I  PK    T +G+ +RKYR++ +L  LH  IK++   + +  KPLRFL+KIEKPIPRPPTP +EVP + EE+KE  +I LQ++IRGRAIQ MMFEGK+KR ELI+E+RSTH+L   E E  KQ++   + LQRQ+ L EH+E  IDE+LS +EG SM +M DFLSKEL+R+QEERRIHAFSMLA+R+RRIREAEESG RQ+EERRRRE DEIFKQV+KV+Q +VD YL+DII F++D TA   ++ EI E A KIND AY  E   T LE EE+V+DL+H+FL+PEV K+ ++EK+   Q+KFL +AH EI N  ++ +
Sbjct:    1 DKNFIVSSERDHARATFKAHTSTNRVKRVPNYPTMFSVLPHHPRFQVKLESTDPVPKFISRQWRGYADQHREAVVRHTTFNYDPTV--QVPPQQFDSAPVSGPNRYKFFRRPIIPFMQQVPPEVFLSNARQDPLTSSAQEAQNRAPTPANRTQQTQTDYRDGEAQTDPYTPEYVVRPGSAPELLTLATLSHGRGLPAGLAEVEMIERARVKRAWEATLPPLNDVSQLDKRRKMMDEMETREWALRESEIEKLQEARLEVLKRLLKQREEHHQDLNTKRLDRLWARKQEEKEERVARIRAEHIKTIRKLTEKRRKVEGKLERRDRVTDYADYGSQTYAPMTRVGVFLDRGSEQYVVKSRYISTYQGLLELEDSMPDYVMQPRIKAPKPRTVTKSGFVRRKYRQEQQLAELHAVIKENKNKVEEPPKPLRFLQKIEKPIPRPPTPAVEVPSQEEEEKELAVIFLQQVIRGRAIQNMMFEGKEKRIELIKEMRSTHALQDAEQEICKQEKQATLALQRQRHLHEHKEGFIDEALSSMEGSSMGDMLDFLSKELIRLQEERRIHAFSMLAERQRRIREAEESGKRQVEERRRREEDEIFKQVIKVHQNSVDTYLEDIIMFSVDSTADGQARQEISEQATKINDIAYAVEDQRTQLESEEIVSDLVHSFLLPEVQKQTVREKVMLQQRKFLQAAHNEIHNTGEDVI 699          
BLAST of cilia- and flagella-associated protein 91 vs. TrEMBL
Match: gnl|BL_ORD_ID|25027911 (tr|C3YCJ4|C3YCJ4_BRAFL CFAP91 domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_269790 PE=4 SV=1)

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 394/740 (53.24%), Postives = 537/740 (72.57%), Query Frame = 1
Query:   91 RNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYA-ESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHYQISDEEIYHA---LTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQ-SQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFLI-----NPNANDAQVETMGSDDDFISNSEK 2280
            R HDYLYD L+ +S +RDHARAT+KA++S +RI+ VP Y TMFS+LRH+PR  +R+   DPVP +INR WRG+ +QA+  +   +      S+    +P  +   AEV GR+R++YFRRPIIP+  Q+PPDV+LA N+ D       ++       +TRT+  QT YRDS+ QT+PYSPEY+VRPG APE+LTLA+LT GRGLPAGL EVEMI+RAR +R  EA LPPLND +Q +KRRKMMD  E +EWAIRE EIE+LQ+ RLEVL KLL+QRE+ ++E++ ++LDRLW KKQQ K+     +R +++K IR+L K R+N+E K   RDI  +YS  +SQT+AP++R+G FLDR S+QY+V SR+LTTY GLLELE S PD+V  P+I  PKQ S     GY KRK R + +L  ++E ++K+ +   +  KPLRFL+KIEKPIPRPPTP++EVP + EED+E  +I LQK+IRG+A+Q MMFEGK+KR+ELI EL+STH+L   + +  K ++  I+ LQRQ+ + +H+E NIDE L+ LEG+++ +M DFLSKEL+R+QEERRIHAFSMLA+R+RRIREAEESG RQ+EERRRRE DEIFKQV+ V+Q TVD YL+DII  ++D TA   ++ E++  A+ IND AYE E   T L+ EE+V++L+H+FL+PEV K+  +EK+K  Q+K L +AH+ +    +  +      +P A+D  +E   + +     S K
Sbjct:   16 RTHDYLYDPLFSVSSDRDHARATFKAHTSVDRIKRVPEYNTMFSNLRHHPRFSVRLEATDPVPAYINRQWRGYADQAREALVRYTTFNYDPSV---QIPAVSYPDAEVAGRNRYQYFRRPIIPFLQQVPPDVLLATNKVDPLAPPESQQAARPPTPMTRTVAIQTDYRDSETQTEPYSPEYVVRPGSAPELLTLATLTFGRGLPAGLAEVEMIERARAKRAWEATLPPLNDVSQLDKRRKMMDEQERKEWAIREAEIEKLQEARLEVLKKLLQQREQNHRELTTKRLDRLWTKKQQHKEDKVTRIRREHIKTIRKLTKKRQNVEGKLERRDITHEYSNHASQTYAPISRVGVFLDRGSEQYVVKSRHLTTYEGLLELEGSLPDFVTQPRIRAPKQRSVVGKDGYVKRKNRREKELAEIYEEMQKNKLKGDEAPKPLRFLQKIEKPIPRPPTPSVEVPSQEEEDQELAVIFLQKLIRGKAVQNMMFEGKEKRRELILELQSTHALQEAQQQMKKSEKEAILTLQRQRQMHQHKESNIDEGLADLEGQAIGDMLDFLSKELIRLQEERRIHAFSMLAERQRRIREAEESGRRQVEERRRREEDEIFKQVIGVHQETVDTYLQDIIIGSVDATAERQAREEVQRKAETINDIAYEIEESRTKLQSEEIVSELVHSFLLPEVQKQTTREKVKTQQRKHLLAAHKVVHKEGEGVMAMHGQPSPAADDKVMEDKATQEGGEKTSPK 752          
BLAST of cilia- and flagella-associated protein 91 vs. TrEMBL
Match: gnl|BL_ORD_ID|23915473 (tr|K1PU74|K1PU74_CRAGI AMY-1-associating protein expressed in testis 1 OS=Crassostrea gigas OX=29159 GN=CGI_10011943 PE=4 SV=1)

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 401/724 (55.39%), Postives = 545/724 (75.28%), Query Frame = 1
Query:   58 IMSQTRTLV-----VERNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSD---NHYQISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFL 2205
            + +QT+TL        R HDYLYD  +  S ERDHAR+T+KA++S++R++ VP Y TMFS+LRH+PR Q+R+   DPVPKFI+R WRG+ +QA+  M   +      ++     P +  +AEVGGR+R+++F+RPIIP+  Q+PP+V+LA  + D      Q+  E     LT+T+  QT YRDS+ QTDPY+PEY+VRPG APE+LTLA+L+ GRGLPAG+ EVEMI+RAR +R  EA LPPLND +Q EKRRKMMD +E +EWA+RE+EIE+LQ+ RLEVL +LL++REE + E++ ++LD+LW+KKQ+EKD     +R +++K IR+L + R  +E +   RDIIQ+YS   SQT+APLTRIG FLDR S+QY+V SR+L+TY GLLELE S PD+V+NP++  PK    T  GY KRKYR++ +L+ +H++I +       E KPLRFL+KIEKPIPRPPTPT++VP E EE+KE  +I LQ++IRGRAIQ M+FEGK+KR+ELI+ELRSTH+L   E +  +Q++   + LQRQ+ L EH+E  +DE++S LEG S+A+  DFLSKEL+R+QEERRIHAFSMLA+R+RRIREAEESG RQ+EERRRRE DE+FKQVVKV+Q +VD YL+DII  +ID TA   ++ EI + A+KIND AYE E   T L+ EE+VADL+H FL+PEV K  ++EK++++Q+K+L +AH+EI    +E L
Sbjct:    1 MATQTQTLKRSGFQPARTHDYLYDPHHVTSSERDHARSTFKAHTSTDRVKRVPLYNTMFSELRHHPRFQMRLDVTDPVPKFISRQWRGYADQARDAMIRYTTFNYDPNVT--VPPKHYANAEVGGRNRYKFFKRPIIPFLQQIPPEVMLATARQDPLAGPDQLQLERPPTPLTKTVEVQTDYRDSEAQTDPYTPEYVVRPGSAPELLTLATLSHGRGLPAGMAEVEMIERARAKRAWEATLPPLNDVSQLEKRRKMMDEMERKEWALREQEIEKLQEARLEVLKQLLKKREENHAELNIKRLDKLWSKKQKEKDAKVKKIRNEHIKTIRKLTRKRGKVEGQMERRDIIQEYSNFGSQTYAPLTRIGMFLDRGSEQYVVKSRHLSTYQGLLELEASLPDFVVNPRVKAPKPKTVTKTGYMKRKYRQEQELKDMHQTIVEEKEKGELEPKPLRFLQKIEKPIPRPPTPTVDVPSEEEEEKELAVIFLQQVIRGRAIQNMIFEGKEKRQELIKELRSTHALQEAEQQMKQQEKQATLALQRQRRLHEHKELLVDEAMSQLEGSSLADTMDFLSKELVRLQEERRIHAFSMLAERQRRIREAEESGRRQVEERRRREEDEVFKQVVKVHQRSVDTYLEDIILGSIDKTADEQARGEIMDQAEKINDVAYEIEESRTQLQSEEIVADLVHCFLLPEVQKTTMREKVRRDQRKYLLAAHKEIHKEGEEIL 722          
BLAST of cilia- and flagella-associated protein 91 vs. TrEMBL
Match: gnl|BL_ORD_ID|23537951 (tr|A0A210PYU3|A0A210PYU3_MIZYE Protein MAATS1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT22059 PE=4 SV=1)

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 409/728 (56.18%), Postives = 547/728 (75.14%), Query Frame = 1
Query:   58 IMSQTRTLV--VERNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSII--SRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSD---NHYQISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFLINPNA 2220
            + +QT+T+     R HDYLYD  + +S ERDHARAT+KA++ ++R++ VPNY TMFS+LRH+PR Q+R+   DPVPKFI+R WRG+GEQ +  M   +      S++  S++  N    AEVGG++R+++F+RP+IP+  Q+PP+V+LA  + D      Q+  E     LTRT+  QT YRDS+ QTDPY+PEY+VRPG APE+LTLA+L+ GRGLPAGL EVEMI+RAR +R  EA LPPLND +Q +KRR+MMD +E +EWA+RE+EIE+LQ+ RLEVL  LL++REE +QE++ ++LD++W+KKQ+EK+     +R +++K IR+L   RK +E K   RD+IQD+S   SQT+APLTRIG FLDR S+QY+V SR++ TY GL+ELE+S PD+VLNP+I  PK    T AG+ KRKYR+Q +L  +HES+K       +E KPLRFL+KIEKPIPRPPTP +EVP E EE+KE  II LQK+IRGRAIQ M+FEGK+KR ELI+ELRSTH+L   E     Q++   + LQRQ+ L EH+E  +DES+S LEG SM + +DFLSKEL+R+QEERRIHAFSMLA+R+RRIREAEESG RQ+EERRRRE DE+FKQ VKV+Q +VD YL+DII  +ID TA   ++ EI E A  IND AYE E   T L+  E+VADL+H FLIPEV K+D++EK++++Q+++L +AH++I    DE +I+ NA
Sbjct:    1 MATQTQTIKRQAARTHDYLYDNHFVVSSERDHARATFKAHTGTDRVKRVPNYTTMFSELRHHPRFQMRLDVTDPVPKFISRQWRGYGEQQRDAMVRYTTFNYDPSVVVPSKHFAN----AEVGGKNRYKFFKRPMIPFLQQIPPEVMLATARQDPLAGPDQLLVERPPTPLTRTVEVQTDYRDSEAQTDPYTPEYVVRPGSAPELLTLATLSFGRGLPAGLAEVEMIERARAKRAWEATLPPLNDVSQLDKRRRMMDEMERKEWALREQEIEKLQEARLEVLKDLLKKREENHQELNIKRLDKIWSKKQKEKESKIKKIRNEHIKTIRKLTGKRKQVEGKLERRDVIQDFSNYGSQTYAPLTRIGMFLDRGSEQYVVRSRHINTYQGLIELEQSLPDFVLNPRIKAPKPKTVTKAGFIKRKYRKQRELMDMHESLKAEKAKGEEEPKPLRFLQKIEKPIPRPPTPAVEVPPEEEEEKELAIIYLQKVIRGRAIQNMIFEGKEKRTELIKELRSTHALQDAEQSLKHQEKQATLALQRQRRLHEHKEFLVDESMSQLEGSSMGDTYDFLSKELIRLQEERRIHAFSMLAERQRRIREAEESGRRQVEERRRREEDEVFKQAVKVHQISVDTYLEDIILGSIDKTADIQARSEISEKATMINDLAYEMEDKRTELQSSEIVADLVHCFLIPEVQKQDMREKVRRDQRRYLVAAHKQIVKDGDE-IIDMNA 723          
BLAST of cilia- and flagella-associated protein 91 vs. TrEMBL
Match: gnl|BL_ORD_ID|23862759 (tr|V4A585|V4A585_LOTGI CFAP91 domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_142246 PE=4 SV=1)

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 392/713 (54.98%), Postives = 533/713 (74.75%), Query Frame = 1
Query:   91 RNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAK--LMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHYQISDEEIYHA------LTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFL 2205
            R +DYLYD L+ ++ ERDHARAT+KA++SS+R+++VPN  TMFS+LRH+PR Q+R+   DPVPKFI+R WRG+ +Q +  L+         +  +  +  P+    AEV GR+R++Y +RP+IP+  Q+PP+V+LA  + D    +S +E  H        T+T  TQT YRDS+ QTDPY+PEY+V+PG APE+LTLA+L+ GRGLPAGL EVEMI+RAR +R  EA LPPL+D +Q +KRRKMMD +E +EWA+RE+EIE LQ+ RLEVL KLL+QREE +Q++++++LD+LW KKQ+ K+     +R +++K IR+L + R+NIE K   R+I+ DYSE  SQT+AP TRIG FLDR S+Q++V SR+L+TY GLLELE S PD+V  P++  PK    T AG+ KRKYR++ +L  +HE++K++     +E KPLRFL+KIEKP+PRPPTP++EVP E EE++E   I LQ++IRGRAIQ MMFEGK+KR ELI+ELRSTH+L   E    KQ+    + LQRQ+ L EH+   +DESL  +EG S+  M DFLSKEL+R+QEERRIHAFSMLA+R+RRIREAEESG RQ+EERRRRE DEIFKQV+KV+Q TVD YL+ II   ++ TA N ++ EI+E AQKIND AYE E   T LE EE+VADL+H FL+PE  K+ ++EK++ NQ++++ +AH+EI   T++ +
Sbjct:   19 RTYDYLYDPLHNVASERDHARATFKAHTSSDRVKLVPNAKTMFSELRHHPRFQMRLEVNDPVPKFISRQWRGYADQQRDALIRYKTFNYDPSVQVPQKVFPD----AEVTGRNRYKYAKRPMIPFLQQVPPEVLLATARQDP---LSSQEQGHVERPPTPPTKTTETQTDYRDSEAQTDPYTPEYVVQPGTAPELLTLATLSYGRGLPAGLAEVEMIERARAKRAWEATLPPLSDTSQLDKRRKMMDDMERKEWALREQEIERLQEARLEVLKKLLKQREENHQDLNSKRLDKLWRKKQKVKESRVKKIRNEHIKTIRKLTEKRRNIEGKLERRNIVNDYSEFGSQTYAPKTRIGIFLDRGSEQFVVKSRHLSTYQGLLELEASLPDFVTAPRVKAPKPKTVTKAGFIKRKYRQERELIEMHEALKEAKTKGKEELKPLRFLQKIEKPVPRPPTPSVEVPSEEEEERELATIFLQQVIRGRAIQNMMFEGKEKRIELIKELRSTHALQEAEQLQKKQEMTTTLALQRQRRLHEHKVSLVDESLGNMEGSSVGHMLDFLSKELIRLQEERRIHAFSMLAERQRRIREAEESGRRQVEERRRREQDEIFKQVIKVHQNTVDSYLESIIIGAVNTTADNQAREEIQEQAQKINDLAYEIEDRRTQLESEEIVADLVHCFLLPEAQKQTMREKVRSNQRRYVMAAHKEIHKSTEDLI 724          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Cavefish
Match: maats1 (MYCBP associated and testis expressed 1 [Source:NCBI gene;Acc:103022588])

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 334/711 (46.98%), Postives = 488/711 (68.64%), Query Frame = 1
Query:   73 RTLVVERNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHYQISDEEIYHA--LTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAP-EVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITD 2196
            R    +R +DYLYD  + LS ERDH+R   +A +SS+R + VP + +MFS+L H+PR  +R+   DPVP FI+R WRG  EQ +  +K LS +      I  + P+  + A V   D +R+FRRP+IP+  Q+PPDV+LA+  +D     + +         RT+G QT YRDS+ QT+PYSPEY +RPG AP E+LTLASL  G GLPA L EVEMI+RAR +R  EA LPPLND  Q EKR+KMMD +E +EWA RE+EIE+LQ+ RL +L +LL+QRE   ++ + ++LD  +++++++K+     +   YV ++R+L   R+N+E K   RDII D ++ +SQT+APL+R G F DR +++ +V SR+L TY GLL+LE S P  VL P+I  PK  + + +  K+ + RE + LR       + G V  KE+KPLRFL K EKP+PRPPTP +++P EG E+++  +I LQK++RGR+IQ  M EG++KR ELI+ELR+TH+L   E E  + ++   ++LQRQ+   E R   ++  +SGL G  + +M DFL+KEL+R+Q+ERRIHAF++LA+R+RR++EAEESG RQ+EERRRRE DEIF+QVVKV+Q TVD YL+DII   I+ TA   ++ EI ++AQ++ND  Y  E   +  + E++VA+L+++FLIPEV K  ++E+++++Q++ L +A R + +  D
Sbjct:   15 RGYRAQRTYDYLYDPTFSLSSERDHSRVAIQAQASSDRARRVPEFNSMFSNLPHHPRFTLRLDAADPVPAFIDRRWRGQSEQRREALKTLSGMLPG---IQLHKPSMVDVARV---DHWRFFRRPLIPFFQQVPPDVVLALPNADPLSVRNGDAARPGSPFQRTVGVQTDYRDSEAQTEPYSPEYTLRPGTAPPELLTLASLKWGHGLPARLEEVEMIERARMKRAWEATLPPLNDLTQLEKRKKMMDEMERKEWAFREQEIEKLQEARLALLKQLLQQREAQQEQSTVKRLDLCFSQQKRQKESRLQKIHRDYVLSLRKLTAQRRNVEGKLERRDIINDQADYASQTYAPLSRCGVFPDRGTERNVVKSRFLNTYQGLLDLEASLPPSVLEPRIKAPKPKE-SKSFIKRSERREVELLRTYQALKDEKGRV--KEKKPLRFLYKTEKPVPRPPTPEVDMPPEGSEERDLAVIYLQKLLRGRSIQKQMLEGREKRMELIQELRTTHALQREEQELHRAEKLVTLDLQRQREQHESRTSQVEGYVSGLLGAELVDMLDFLAKELVRLQDERRIHAFTLLAERDRRLQEAEESGRRQVEERRRREEDEIFRQVVKVHQATVDLYLEDIILGTIEQTADAQAREEIHQMAQELNDITYAMEEKRSTAQSEDIVAELVYSFLIPEVQKITVRERVRQSQRRHLTAA-RSLIHSAD 715          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Cavefish
Match: maats1 (MYCBP associated and testis expressed 1 [Source:NCBI gene;Acc:103022588])

HSP 1 Score: 171.785 bits (434), Expect = 2.381e-44
Identity = 114/228 (50.00%), Postives = 170/228 (74.56%), Query Frame = 1
Query: 1450 EGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEK 2133
            +G E+++  +I LQK++RGR+IQ  M EG++KR ELI+ELR+TH+L   E E  + ++   ++LQRQ+   E R   ++  +SGL G  + +M DFL+KEL+R+Q+ERRIHAF++LA+R+RR++EAEESG RQ+EERRRRE DEIF+QVVKV+Q TVD YL+DII   I+ TA   ++ EI ++AQ++ND  Y  E   +  + E++VA+L+++FLIPEV K  ++E+
Sbjct:   25 QGSEERDLAVIYLQKLLRGRSIQKQMLEGREKRMELIQELRTTHALQREEQELHRAEKLVTLDLQRQREQHESRTSQVEGYVSGLLGAELVDMLDFLAKELVRLQDERRIHAFTLLAERDRRLQEAEESGRRQVEERRRREEDEIFRQVVKVHQATVDLYLEDIILGTIEQTADAQAREEIHQMAQELNDITYAMEEKRSTAQSEDIVAELVYSFLIPEVQKITVRER 252          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Nematostella
Match: EDO40940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5P5])

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 367/712 (51.54%), Postives = 510/712 (71.63%), Query Frame = 1
Query:  112 DKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHYQISD--EEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFL-INPNANDAQVE 2238
            D L+ LS +RDHARAT+KA++ ++R++ VP+Y TMFSDL H+PR  + +   DPVPKFI R WRG+ EQA+  +   +      ++     P      +VGG+DR+++FRRPIIP+  Q+PPDV+L   + +    +    E     LTRT+  QT YR+S+ QTDPYSPEY+VRPG  PE+LTLA+L+ G GLPAGL EVEMI+RAR +R  E+ LP LND    EKRR MMD  E  EWA RE EIE+LQ+ RLEVL ++L++REE + E++ ++LDRLW+KKQ+EK+  F  ++ +++K +R+L + R+ +E K   RD++QDYS+ +SQT+AP++R+G FLDR S+QY + S +L+TY GLLELE S PD+V  P+I  PK      AG+ KR  R Q +L  + ++I  +     + EKPL+FL K+EKP+PRPPTP++E+P + EED E   I LQKIIRGRAIQ MMFEGK+KR ELI+ELRSTH+L        + +R  ++ LQRQ+ L +H+E  ++E+L+  EG ++A+MFDFLSKEL+R+QEERRIHAF+MLA+R+RRIREAEESG RQ+EERRRRE DEIFKQVVKV+Q TVD YL+D+I   I+ TA + ++ EI+E A+KIN  A++ E   T L+ EE+VA+L+ +FL+PEV K  ++EK+K++Q+K L +AHR I   T+E +  +P  +   VE
Sbjct:    8 DPLHTLSSDRDHARATFKAHTGTDRVKRVPHYKTMFSDLPHHPRYSVHLEVTDPVPKFIPRQWRGYQEQAREALIRYTTFNYDPNV--SVPPKVHPYTDVGGQDRYKFFRRPIIPFLQQVPPDVLLQTARYNPMAPLDSMRERPPTPLTRTVMVQTDYRESETQTDPYSPEYVVRPGSQPELLTLATLSHGHGLPAGLAEVEMIERARAKRIWESTLPALNDMDNLEKRRHMMDEQERREWAFRESEIEKLQEARLEVLQRILQEREEDHAELNTKRLDRLWSKKQKEKEAKFDKIQKEHIKKMRKLKEKRRTVEGKLERRDVVQDYSDFNSQTYAPMSRVGVFLDRGSEQYSIQSFHLSTYQGLLELEASLPDFVTQPRIQAPKPKSGGKAGFVKRTQRRQRELEEVADAINLAKRP-AQPEKPLKFLVKVEKPVPRPPTPSVEIPSQAEEDAELATIFLQKIIRGRAIQNMMFEGKEKRLELIQELRSTHALQEGGQAEKRNERQSVLTLQRQRRLDQHKESFVEEALARTEGGTLADMFDFLSKELIRLQEERRIHAFAMLAERQRRIREAEESGRRQVEERRRREEDEIFKQVVKVHQNTVDTYLEDVIMGAIEVTAEDQARKEIQEQAEKINQIAHDMEQTKTKLQSEEIVAELVTSFLLPEVQKITVREKVKRHQRKHLLAAHRIIHGKTEEIMQTHPQPDPKPVE 716          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Nematostella
Match: EDO26341 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC93])

HSP 1 Score: 195.282 bits (495), Expect = 1.969e-56
Identity = 103/233 (44.21%), Postives = 161/233 (69.10%), Query Frame = 1
Query:  856 LQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKE 1554
            LQ+ RLEVL ++L++REE + E++ ++LDRLW+KKQ+EK+  F  ++ +++K +R+L + R+ +E K   RD++QDYS+ +SQT+AP++R+G FLDR S+QY + S +L+TY GLLELE S PD+V  P+I  PK      AG+ KR  R Q +L  + ++I  +     + EKPL+FL K+EKP+PRPPTP++E+P +       E+I LQ+  R  A  AM+ E +++ +E
Sbjct:    1 LQEARLEVLQRILQEREEDHAELNTKRLDRLWSKKQKEKEAKFDKIQKEHIKKMRKLKEKRRTVEGKLERRDVVQDYSDFNSQTYAPMSRVGVFLDRGSEQYSIQSFHLSTYQGLLELEASLPDFVTQPRIQAPKPKSGGKAGFVKRTQRRQRELEEVADAINLAKRP-AQPEKPLKFLVKVEKPVPRPPTPSVEIPSQ-------ELIRLQEERRIHAF-AMLAERQRRIRE 224          

HSP 2 Score: 65.4698 bits (158), Expect = 1.505e-11
Identity = 57/78 (73.08%), Postives = 69/78 (88.46%), Query Frame = 1
Query: 1741 SKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASN 1974
            S+EL+R+QEERRIHAF+MLA+R+RRIREAEESG RQ+EERRRRE DEIFKQVVKV+Q TVD YL+D+I   I+ TA +
Sbjct:  197 SQELIRLQEERRIHAFAMLAERQRRIREAEESGRRQVEERRRREEDEIFKQVVKVHQNTVDTYLEDVIMGAIEVTAED 274          
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Medaka
Match: maats1 (MYCBP associated and testis expressed 1 [Source:NCBI gene;Acc:101161200])

HSP 1 Score: 257.299 bits (656), Expect = 8.252e-74
Identity = 253/716 (35.34%), Postives = 396/716 (55.31%), Query Frame = 1
Query:   76 TLVVERNHDYLYDKLYQLSGERDHARATYKANS-SSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHYQISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGE-APEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSG---LLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKII------NLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNI 2190
            T+  ER H  L    Y +  E D AR   +     +   + V ++ +MFS+   +P   +++   DP P F +     + +Q +       K   T  I         +   V G D ++YF+RP+ P + QL P V+ A  Q D   +I  ++  H    T+G QT YR+S+ QTDPYSP Y++R G  A E+L LA+L+ GRGLPAGL EVEMI+  R +R  EA+LPPL+D +Q +KRR+M++ I  +EWA+R+ +I++LQ+ RL +L   LR+R EA +  + Q++++++ + ++EK+     +   Y++++R+L   RK  E K    DI+ ++               +++  +S+     S+   T  G     EL +S P   +  KI  PK +   N      + R    + +L E   +      ++++PLRFL K +K  P   +   + P + EE  E  +I+LQK++RGR +Q  M EG +  ++ + ELR+ HS+ S E E  K  +  ++      + QRQK      EE I   + G E E +   FD LSKE++R+QEERR+HAF++LADRERR REAEESG RQ EERRRRE DEIF+QVV+V+Q +VD YL+ II   +D  +   ++ EI E  +++N+ AY  E      + EE+V++L+H+ LIP V K    + +++ Q+K L +A   I  I
Sbjct:    8 TVTEERRHPPLGPVYYTVPSEVDRARTRCRTVPFQNHTFRKVLDFASMFSE---HPNYTVKVDPADPGPAFTDPDQLRWTQQPQT-----GKNQQTWQI---------KECRVTGADYWKYFKRPLNPSSHQLLPHVVFA--QED--LEIPGQQPTHF---TVGVQTDYRESETQTDPYSPGYVIRRGATASELLQLAALSWGRGLPAGLDEVEMIEWGREKRAWEARLPPLDDKSQLKKRRRMLEEILAKEWALRDVKIQKLQEARLALLKDQLRRRHEAQENSTFQRINQMYAEYEEEKETRLQKIHNDYLRSLRKLEAKRKTAEGKRL--DIVTEFQ--------------RYVLTDSRTNKSGSQNSLTNKGEQIQAELHQSVPKPGI--KIHKPKVANNPN------QIRVGKAVDLLLEYKAQIEEKTPEKKRPLRFLVKKKKLTP--VSAREKSPPQSEEQTELAVIVLQKLLRGRRMQHEMCEGVEDSRDFMRELRTVHSIHSEEQELLKADKELVMRQKDQRDRQRQKA---SEEEAIHRGVVGAEQELL---FDTLSKEMVRLQEERRLHAFALLADRERRRREAEESGRRQEEERRRREEDEIFRQVVQVHQQSVDMYLEGIILETLDKMSHEKAREEIHEKLKELNEIAYAMEKSLDERQSEEIVSELLHSHLIPGVEKSIFWQNVRRKQRKHLQAAQSVIQEI 667          
BLAST of cilia- and flagella-associated protein 91 vs. Planmine SMEST
Match: SMESG000056200.1 (SMESG000056200.1)

HSP 1 Score: 1443.33 bits (3735), Expect = 0.000e+0
Identity = 765/792 (96.59%), Postives = 774/792 (97.73%), Query Frame = 1
Query:   61 MSQTRTLVVERNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQL----------PPDVILAVNQSDNHYQISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFLINPNANDAQVETMGSDDDFISNSEKRNEILPETRKKYENYNITNTDVETRKSDEKEKILEDNIESFL 2406
            MSQTRTLVVERNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQ+          PPDVILAVNQSDNHYQISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAIETEEWAIREKEIEELQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHA RDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADRERRIREAEESGLRQLEERRRREHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFLINPNANDAQVETMGSDDDFISNSE+RNEILPETRKKYE+YNITNTDVETR   +++K L+  ++ FL
Sbjct:    1 MSQTRTLVVERNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQVIKGKYILCITPPDVILAVNQSDNHYQISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAIETEEWAIREKEIEELQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHASRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADRERRIREAEESGLRQLEERRRREHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFLINPNANDAQVETMGSDDDFISNSERRNEILPETRKKYESYNITNTDVETRNLMKRKKFLKITLKVFL 792          
BLAST of cilia- and flagella-associated protein 91 vs. Planmine SMEST
Match: SMESG000020917.1 (SMESG000020917.1)

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 318/712 (44.66%), Postives = 484/712 (67.98%), Query Frame = 1
Query:   82 VVERNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYPTMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDTSSIISRYLPN-YAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDNHYQISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTLASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDAXXXXXXXXXXXXXXXLQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKKQQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTWAPLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPKQSQFTNAGYKKRKYREQDKLRILHESIK-KSGVVITKEEKPLRFLEKIEKPIPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELIEELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEGESMAEMFDFLSKELLRVQEERRIHAFSMLADXXXXXXXXXXXXXXXXXXXXXXXHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQKINDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFLYSAHREIFNITDEFLIN 2211
            + E  ++YLYDK  +LS  ++H +A Y+A   +   +  P +  MFSDL+ YP++++    +  +P +  R +  + +     +   + +G     +   +P  Y       G DR+ YF  P++P +  LPPDV+L   Q    Y +  ++    +TRTIGTQTIYRD   QTDPYSP++++RPG  PE+L L  L+   GLP GLHEV+MI+RARH RE+E + P L D A   KRR  ++ +E EEW IR+++IEELQ  RL  ++KL+++R+E  + +  + L+R+   + + +D+    +R +YVKA+R+LLK R+ +++K   + +I+ Y+  +S TWAPL RIGQF+D+ SQ+Y+V+++Y+TT++GL +LE+S P YVLNP I +P+   +TN GYK +K+R +++L  L++ +K K+ +++ ++ KPL+FL K EK I RPPTP+++     + D E  +  L+++I+GRAIQ MMFEGK+KR +LI E++STH+L   E E  +++++ ++  QR ++  E +E  I+E++  LEGES+ +M DFL KEL+R+QEERR+HAF+M+A RERR+REAEESGLRQLEERRRRE DEIFKQ+VKVNQTTV+ YL+D+I  NID TA  +++ +IE +A +IN  AYESE     L  EE+V+DL+H+FLIPEV+K   +E+I  NQ+++L  AHREI   TD  + N
Sbjct:    4 IKENPYNYLYDKTSKLSSSKNHEKALYRAKIFATVYKSQPIFENMFSDLQAYPKSKVSTKHQSVIPPWFLRDYTTYMKDINSYLLRYTGIGCNPENLKDMIPEIYKRDPNPIGIDRYLYFYSPVLPKSLILPPDVMLRSEQYKRAYYLKRKKDVIDMTRTIGTQTIYRDGSTQTDPYSPDFVLRPGAEPEILMLIPLSYRNGLPVGLHEVKMIERARHHREVEKKYPSLTDIAGVRKRRAALNKLEIEEWRIRDEQIEELQMARLNAIMKLMKERKENLENVHCESLERICIDRVKYRDEKIAIVRYEYVKAMRKLLKARRMLKDKKIEKCLIEQYNNPASNTWAPLARIGQFMDKGSQRYVVDNKYITTFNGLSDLEDSLPSYVLNPHIKIPQMKNYTNDGYKNKKFRLEEELTELYKYLKTKNQIILAEKLKPLKFLTKNEKIITRPPTPSMDFQISYDADVELALTFLKQLIKGRAIQVMMFEGKEKRIQLINEIKSTHALYKEEIEIRRREKSIVLGHQRNQIFYERKESEINEAIEHLEGESLGDMCDFLGKELIRLQEERRLHAFAMMAIRERRMREAEESGLRQLEERRRREEDEIFKQIVKVNQTTVESYLEDLISENIDITADEVARKDIEIMANEINTMAYESESHRDYLRTEEIVSDLVHHFLIPEVYKTQARERIALNQRRYLVQAHREILKATDVVVNN 715          
The following BLAST results are available for this feature:
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
AC069444.20.000e+047.54novel protein[more]
MAATS10.000e+047.54MYCBP associated and testis expressed 1 [Source:HG... [more]
MAATS16.936e-4241.21MYCBP associated and testis expressed 1 [Source:HG... [more]
back to top
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG151455.653e-1325.37gene:FBgn0032649 transcript:FBtr0080991[more]
CG151441.384e-933.98gene:FBgn0032648 transcript:FBtr0303652[more]
CG151433.856e-629.90gene:FBgn0032647 transcript:FBtr0080993[more]
back to top
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
maats11.180e-16345.90MYCBP-associated, testis expressed 1 [Source:ZFIN;... [more]
maats15.843e-15048.77MYCBP-associated, testis expressed 1 [Source:ZFIN;... [more]
maats16.972e-15044.77MYCBP-associated, testis expressed 1 [Source:ZFIN;... [more]
back to top
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zbtb330.000e+050.28zinc finger and BTB domain containing 33 [Source:X... [more]
zbtb337.040e-18047.74zinc finger and BTB domain containing 33 [Source:X... [more]
back to top
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Maats11.971e-18046.84MYCBP-associated, testis expressed 1 [Source:MGI S... [more]
Maats11.598e-7145.22MYCBP-associated, testis expressed 1 [Source:MGI S... [more]
back to top
BLAST of cilia- and flagella-associated protein 91 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q95LR0|CFA91_MACFA0.000e+047.32Cilia- and flagella-associated protein 91 OS=Macac... [more]
sp|Q7Z4T9|CFA91_HUMAN0.000e+047.54Cilia- and flagella-associated protein 91 OS=Homo ... [more]
sp|Q8BRC6|CFA91_MOUSE1.379e-17946.84Cilia- and flagella-associated protein 91 OS=Mus m... [more]
sp|A8IH47|CFA91_CHLRE7.180e-3730.05Cilia- and flagella-associated protein 91 OS=Chlam... [more]
back to top
BLAST of cilia- and flagella-associated protein 91 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157456530.000e+055.49tr|R7UKA3|R7UKA3_CAPTE CFAP91 domain-containing pr... [more]
gnl|BL_ORD_ID|250279110.000e+053.24tr|C3YCJ4|C3YCJ4_BRAFL CFAP91 domain-containing pr... [more]
gnl|BL_ORD_ID|239154730.000e+055.39tr|K1PU74|K1PU74_CRAGI AMY-1-associating protein e... [more]
gnl|BL_ORD_ID|235379510.000e+056.18tr|A0A210PYU3|A0A210PYU3_MIZYE Protein MAATS1 OS=M... [more]
gnl|BL_ORD_ID|238627590.000e+054.98tr|V4A585|V4A585_LOTGI CFAP91 domain-containing pr... [more]
back to top
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
maats10.000e+046.98MYCBP associated and testis expressed 1 [Source:NC... [more]
maats12.381e-4450.00MYCBP associated and testis expressed 1 [Source:NC... [more]
back to top
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO409400.000e+051.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263411.969e-5644.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cilia- and flagella-associated protein 91 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
maats18.252e-7435.34MYCBP associated and testis expressed 1 [Source:NC... [more]
back to top
BLAST of cilia- and flagella-associated protein 91 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000056200.10.000e+096.59SMESG000056200.1[more]
SMESG000020917.10.000e+044.66SMESG000020917.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025152 ID=SMED30025152|Name=cilia- and flagella-associated protein 91|organism=Schmidtea mediterranea sexual|type=transcript|length=2659bp
TGAATCAAGTGTTCTCTTTTTAAATTGGTAATATTTTTTAGTTCTAATTT
TTTTTTAATTATGAGTCAAACTCGTACACTTGTTGTAGAAAGAAATCACG
ACTATTTATATGATAAGCTTTATCAGTTGTCTGGCGAACGAGATCATGCC
AGAGCGACATACAAAGCAAATTCTTCATCAGAAAGAATTCAAGTCGTGCC
AAATTATCCGACAATGTTTAGTGATTTGAGGCATTATCCAAGAAATCAAA
TTAGAATTATAGACAAAGATCCAGTGCCTAAGTTCATAAACAGGCACTGG
AGGGGTTTCGGTGAACAGGCTAAACTAATGATGAAAAATCTTTCAAAATT
GGGCGACACGTCGTCAATAATCAGTAGATACCTACCTAATTATGCGGAAT
CTGCAGAAGTTGGGGGCAGAGATCGATTTAGATATTTTCGCAGACCTATA
ATTCCTTATGCTTCACAACTGCCCCCTGATGTTATTCTTGCTGTAAATCA
ATCTGATAATCATTATCAAATTAGCGATGAAGAAATTTACCATGCCTTAA
CTCGGACCATTGGAACTCAAACTATTTATAGAGATTCAGATGTTCAAACC
GACCCATATAGTCCTGAATATCTCGTCAGACCGGGTGAAGCGCCTGAAGT
TTTGACTTTAGCAAGTCTCACATGTGGACGAGGACTTCCAGCAGGTTTAC
ACGAAGTAGAAATGATAGATCGAGCACGACATCGTCGAGAACTTGAAGCT
CAATTACCACCATTGAATGACTTTGCTCAATCCGAAAAACGACGTAAAAT
GATGGACGCAATTGAAACGGAAGAATGGGCAATCCGAGAAAAGGAAATAG
AAGAATTGCAAAAGTTGAGATTGGAAGTACTCATTAAATTGCTGAGGCAA
AGAGAAGAAGCGTATCAAGAGATGAGTAATCAAAAATTAGATAGATTGTG
GAATAAAAAACAACAAGAAAAAGATAAGTTGTTTTTAAACTTACGGTTGA
AATATGTTAAAGCTATTAGGCAGCTGTTAAAAACTCGTAAAAACATCGAA
AACAAACACGCACCACGAGACATTATTCAAGATTATTCAGAAGGATCTTC
TCAAACTTGGGCTCCTTTAACAAGAATAGGACAATTTCTTGACAGAAATT
CTCAACAATATTTAGTCAACAGCCGATATTTGACGACCTATTCAGGGCTT
TTGGAGTTGGAAGAATCTTTTCCAGATTATGTTCTGAATCCTAAGATTTC
TGTTCCTAAACAAAGCCAATTTACAAATGCTGGGTACAAAAAAAGAAAAT
ATCGAGAACAAGACAAATTAAGAATATTGCATGAATCAATTAAAAAATCA
GGCGTTGTGATTACTAAAGAAGAAAAACCATTACGCTTCCTAGAGAAAAT
AGAGAAACCCATTCCTCGTCCACCTACTCCAACAATTGAAGTTCCAGATG
AAGGTGAAGAGGATAAAGAAAGAGAAATTATTCTACTTCAAAAAATAATT
AGAGGAAGAGCAATACAAGCAATGATGTTTGAAGGTAAGCAAAAGCGAAA
AGAACTAATTGAAGAATTACGATCCACTCATTCTTTACTTTCTAATGAAA
GTGAAGGTGACAAACAGCAAAGAGCAAAAATTATAAATCTTCAAAGACAG
AAAATGCTTTTAGAACATAGAGAAGAAAACATAGATGAATCATTATCCGG
TTTGGAAGGAGAATCAATGGCTGAAATGTTCGATTTTCTTAGTAAAGAAC
TTTTACGAGTTCAAGAAGAAAGGAGAATTCATGCATTTTCAATGTTAGCT
GATCGAGAAAGAAGAATTCGTGAAGCAGAAGAAAGTGGATTGCGTCAGTT
AGAAGAAAGAAGACGAAGAGAGCATGATGAAATTTTTAAACAAGTTGTGA
AAGTCAATCAAACAACAGTCGATTGTTACTTAAAGGACATAATTGATTTT
AATATTGACTGGACTGCGTCCAACATTTCAAAATTGGAAATTGAAGAACT
TGCTCAAAAGATCAACGATCAGGCATACGAGTCAGAACTAGTCAACACAA
ACTTAGAACAAGAGGAAGTTGTTGCTGATCTTATCCATAACTTCCTTATT
CCCGAGGTTCACAAAAAAGATATTCAAGAGAAGATAAAAAAAAATCAAAA
GAAATTTTTGTATTCAGCACACAGAGAAATTTTCAATATTACTGATGAAT
TCCTTATAAATCCAAATGCTAATGATGCGCAAGTTGAGACAATGGGATCG
GATGATGACTTCATAAGCAACTCAGAAAAAAGAAATGAAATTTTGCCTGA
AACTCGAAAGAAATATGAAAATTATAATATCACTAATACTGATGTTGAAA
CCCGAAAATCTGATGAAAAGGAAAAAATTCTTGAAGATAACATTGAAAGT
TTTCTTGAAGATTTCACAACAGATTTAAATTTGATCCTTGAAAAAAAACC
AGTTGGATCCCCAGTTGAGAAGGACTCTGTTTATTTTAAAGAAGATAGTG
TAAAATTTGACGAAAACGACACCCAGTTACAAATAGGCGATGAAGTTCAA
GATGATAATCCAGAAGGTTTCGACAATGATTCAGAGATTCCTGGAAATGA
ATAACACATCTTCTATTCTTAAACTGTTTATTGTCGATAACAATAAACCA
GATGAAATT
back to top

protein sequence of SMED30025152-orf-1

>SMED30025152-orf-1 ID=SMED30025152-orf-1|Name=SMED30025152-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=848bp
MSQTRTLVVERNHDYLYDKLYQLSGERDHARATYKANSSSERIQVVPNYP
TMFSDLRHYPRNQIRIIDKDPVPKFINRHWRGFGEQAKLMMKNLSKLGDT
SSIISRYLPNYAESAEVGGRDRFRYFRRPIIPYASQLPPDVILAVNQSDN
HYQISDEEIYHALTRTIGTQTIYRDSDVQTDPYSPEYLVRPGEAPEVLTL
ASLTCGRGLPAGLHEVEMIDRARHRRELEAQLPPLNDFAQSEKRRKMMDA
IETEEWAIREKEIEELQKLRLEVLIKLLRQREEAYQEMSNQKLDRLWNKK
QQEKDKLFLNLRLKYVKAIRQLLKTRKNIENKHAPRDIIQDYSEGSSQTW
APLTRIGQFLDRNSQQYLVNSRYLTTYSGLLELEESFPDYVLNPKISVPK
QSQFTNAGYKKRKYREQDKLRILHESIKKSGVVITKEEKPLRFLEKIEKP
IPRPPTPTIEVPDEGEEDKEREIILLQKIIRGRAIQAMMFEGKQKRKELI
EELRSTHSLLSNESEGDKQQRAKIINLQRQKMLLEHREENIDESLSGLEG
ESMAEMFDFLSKELLRVQEERRIHAFSMLADRERRIREAEESGLRQLEER
RRREHDEIFKQVVKVNQTTVDCYLKDIIDFNIDWTASNISKLEIEELAQK
INDQAYESELVNTNLEQEEVVADLIHNFLIPEVHKKDIQEKIKKNQKKFL
YSAHREIFNITDEFLINPNANDAQVETMGSDDDFISNSEKRNEILPETRK
KYENYNITNTDVETRKSDEKEKILEDNIESFLEDFTTDLNLILEKKPVGS
PVEKDSVYFKEDSVKFDENDTQLQIGDEVQDDNPEGFDNDSEIPGNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0005575cellular_component
GO:0005737cytoplasm
GO:0005739mitochondrion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR032840CFAP91_dom
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0008150biological_process