Protein rolling stone

Overview
NameProtein rolling stone
Smed IDSMED30025144
Length (bp)992
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein rolling stone (SMED30025144) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein rolling stone (SMED30025144) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein rolling stone (SMED30025144) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein rolling stone (SMED30025144) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Protein rolling stone vs. Ensembl Fly
Match: CG13101 (gene:FBgn0032084 transcript:FBtr0079784)

HSP 1 Score: 70.8626 bits (172), Expect = 1.593e-13
Identity = 69/258 (26.74%), Postives = 126/258 (48.84%), Query Frame = 3
Query:   36 IMSEFQLKSFAFTHDRVYNFVESQWDFISPKL-FTCYRVIMAIGMV------LWAISDFASEWLNSYRGYPYFWLLMATNWAFMAMVIAHIALAFVNILTNCHDVRSQNVVG-------YKMCWIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFILGILYTIMLVXXXXXXXXXXXXXXXXXEALYWKYPGSAIVAVVCVIIMSILIQLFLFIFVQARIWLYK 767
            +  EFQ KS  F HD   +FV+SQW   +  + +  YR  MA+  V      +W  +D A+ +        + + +  TNW     ++ ++  A +  + + H   +  ++        +++ W  + I+    +  +IIY   L ++ +   + T   + H  N++ +  DL I + P+RL H   P + G+++ I   IY+  GGI   GKPYIY  + W  P +A   VV V+++S  I + LF F + R++L++
Sbjct:   14 VKKEFQRKSCGFDHDTPDDFVKSQWQSCTKSMAYLFYRWFMAMFFVVVVIISMWPETDDATSY--------WLYFIYMTNWGIWMCMLTNVLGAILVTIWHYHPEYADKLLNMKSYFSYFRLYWGMHIISLVLSIVITIIYWSILYDANESALDATNV-LTHAFNSICMFIDLWIVAHPLRLLHIFLPVLFGVVFAIFSYIYHLCGGINKKGKPYIYYVIDWSKPQNAFTTVVGVLLLSCCIYVLLFAFFKLRLFLHR 262          
BLAST of Protein rolling stone vs. Ensembl Fly
Match: CG13101 (gene:FBgn0032084 transcript:FBtr0079783)

HSP 1 Score: 70.8626 bits (172), Expect = 1.593e-13
Identity = 69/258 (26.74%), Postives = 126/258 (48.84%), Query Frame = 3
Query:   36 IMSEFQLKSFAFTHDRVYNFVESQWDFISPKL-FTCYRVIMAIGMV------LWAISDFASEWLNSYRGYPYFWLLMATNWAFMAMVIAHIALAFVNILTNCHDVRSQNVVG-------YKMCWIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFILGILYTIMLVXXXXXXXXXXXXXXXXXEALYWKYPGSAIVAVVCVIIMSILIQLFLFIFVQARIWLYK 767
            +  EFQ KS  F HD   +FV+SQW   +  + +  YR  MA+  V      +W  +D A+ +        + + +  TNW     ++ ++  A +  + + H   +  ++        +++ W  + I+    +  +IIY   L ++ +   + T   + H  N++ +  DL I + P+RL H   P + G+++ I   IY+  GGI   GKPYIY  + W  P +A   VV V+++S  I + LF F + R++L++
Sbjct:   14 VKKEFQRKSCGFDHDTPDDFVKSQWQSCTKSMAYLFYRWFMAMFFVVVVIISMWPETDDATSY--------WLYFIYMTNWGIWMCMLTNVLGAILVTIWHYHPEYADKLLNMKSYFSYFRLYWGMHIISLVLSIVITIIYWSILYDANESALDATNV-LTHAFNSICMFIDLWIVAHPLRLLHIFLPVLFGVVFAIFSYIYHLCGGINKKGKPYIYYVIDWSKPQNAFTTVVGVLLLSCCIYVLLFAFFKLRLFLHR 262          
BLAST of Protein rolling stone vs. Ensembl Fly
Match: CG9555 (gene:FBgn0032085 transcript:FBtr0079761)

HSP 1 Score: 60.077 bits (144), Expect = 4.348e-10
Identity = 70/271 (25.83%), Postives = 121/271 (44.65%), Query Frame = 3
Query:   36 IMSEFQLKSFAFTHDRVYNFVESQWDFISPKL-FTCYRVIMAIGMVLWAISDFASEWLNSYRGYPYFWLLMATNWAFMAMVIAHIALAFVNILTNCHDVR----SQNVVGYKMCWIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFILGILYTIMLVXXXXXXXXXXXXXXXXXEALYWKYPGSAIVAVV-CVIIMSILIQLFLFIFVQARIWLYKLIYGDTVTMHQSKCEEDDQIP 830
            +  EFQ   F+  HD   +F  SQW      + +  YR I+A       I     E  N  R     W +  T+W F    +      +  I+   + ++    +      K+ WI +       +  ++++  AL  S   +     +   H  N++ ++FD  + + P R+ HF+YPF  GI Y +  +IY++ GG+ P G  +IY  L W+ PG AI  V  CV+++S    L +F F + RI           ++++S  ++ D+IP
Sbjct:   13 LKEEFQRSKFSLHHDDPGDFCRSQWQKGDRNIIWLLYRWILAAFFAAGVIGSMV-ETFNGGR-----WFIYLTDWGFS---LCFYCCTYGAIIATIYFIKPSYFAPGSWALKIYWISHYTTVVLAMMITLVFWAALYPSMPGMGAELYNLWAHAFNSICLVFDCFMVAFPTRIMHFVYPFTAGITYGVFSLIYFWAGGMDPMGNRFIYFILDWERPGLAIGTVCGCVVLVSCFCVL-VFGFYRLRI-----------SIYESCSKKPDEIP 262          
BLAST of Protein rolling stone vs. Ensembl Fly
Match: CG9555 (gene:FBgn0032085 transcript:FBtr0345450)

HSP 1 Score: 60.077 bits (144), Expect = 4.348e-10
Identity = 70/271 (25.83%), Postives = 121/271 (44.65%), Query Frame = 3
Query:   36 IMSEFQLKSFAFTHDRVYNFVESQWDFISPKL-FTCYRVIMAIGMVLWAISDFASEWLNSYRGYPYFWLLMATNWAFMAMVIAHIALAFVNILTNCHDVR----SQNVVGYKMCWIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFILGILYTIMLVXXXXXXXXXXXXXXXXXEALYWKYPGSAIVAVV-CVIIMSILIQLFLFIFVQARIWLYKLIYGDTVTMHQSKCEEDDQIP 830
            +  EFQ   F+  HD   +F  SQW      + +  YR I+A       I     E  N  R     W +  T+W F    +      +  I+   + ++    +      K+ WI +       +  ++++  AL  S   +     +   H  N++ ++FD  + + P R+ HF+YPF  GI Y +  +IY++ GG+ P G  +IY  L W+ PG AI  V  CV+++S    L +F F + RI           ++++S  ++ D+IP
Sbjct:   13 LKEEFQRSKFSLHHDDPGDFCRSQWQKGDRNIIWLLYRWILAAFFAAGVIGSMV-ETFNGGR-----WFIYLTDWGFS---LCFYCCTYGAIIATIYFIKPSYFAPGSWALKIYWISHYTTVVLAMMITLVFWAALYPSMPGMGAELYNLWAHAFNSICLVFDCFMVAFPTRIMHFVYPFTAGITYGVFSLIYFWAGGMDPMGNRFIYFILDWERPGLAIGTVCGCVVLVSCFCVL-VFGFYRLRI-----------SIYESCSKKPDEIP 262          
BLAST of Protein rolling stone vs. Ensembl Fly
Match: CG43778 (gene:FBgn0264308 transcript:FBtr0331505)

HSP 1 Score: 53.1434 bits (126), Expect = 1.748e-7
Identity = 40/164 (24.39%), Postives = 72/164 (43.90%), Query Frame = 3
Query:  363 WIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFILGILYTIMLVXXXXXXXXXXXXXXXXXEALYWKYPGSAIVAVVCVIIMSILIQLFLFIFVQARIWLYKLIYGDTVTMHQSKCEEDDQIPIMNNDYNS 854
            W+ Y  A       ++ Y   + N E    +     + H LN +++L DLAI   PI++ H  +   +G+ Y I   IY+  GG     +  IY  + W  PG AI+   C II +  +    ++  + R+WL+       + +   +  + +    +N+D  S
Sbjct:  125 WVLYTCATVYAFIVTMCYWLLVHNPEIHKIDALNIMV-HVLNTIIMLIDLAIVGHPIKMSHAYFTTGIGLAYAIFTGIYFLAGGTDRKNQTAIYPMMDWTKPGKAIIVTACAIIFTFFVHFCCYLLYRGRVWLFT-----KLCIRGRRNRDGEMGEGLNDDSGS 282          
BLAST of Protein rolling stone vs. TrEMBL
Match: A0A4E0RE65 (Protein rolling stone OS=Fasciola hepatica OX=6192 GN=D915_002103 PE=4 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 8.862e-43
Identity = 92/282 (32.62%), Postives = 148/282 (52.48%), Query Frame = 3
Query:   45 EFQLKSFAFTHDRVYNFVESQWDFISPKLFTCYRVIMAIGMVLWAISDFASEWLNSYRGYPYFWLLMATNWAFMAMVIAHIALAFVNILTNCHDVRSQNVVGYKMCWIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFILGILYTIMLVXXXXXXXXXXXXXXXXXEALYWKYPGSAIVAVVCVIIMSILIQLFLFIFVQARIWLY----------------KLIYGDTVTMHQSKCEEDDQIPIMNN 842
            EF  +   F+H R  +F +SQW ++ P LF  YRV++AIG ++W   D   E  N Y    Y W L ATNWAF  + +    LA  +++ NC     + ++ Y+  W  Y I+ N  +  S ++  AL +S   +F++   ++KH L A+L + DL + +IPIRL H IYP ++GILY++   +++  G  GP     +Y  L W +P +A++  + VI+ S LIQ+FL++   AR+ L                 K IYG+  T      +  D +  +N+
Sbjct:   23 EFSWRGLGFSHTRPSDFTDSQWLWMKPWLFIVYRVLLAIGFIIWLSLDIPREIHNYYEDRTYIWFLYATNWAFGMLALTFFLLAIFSLVYNCPRRPDERIILYQPLWFLYTISANGSIVASSVFWIALSSSHLGVFSSQLGRLKHSLTAVLAVLDLCLSAIPIRLIHVIYPILVGILYSLCSYLFWLSGIQGPLNVGQVYPGLNWTHPRTAVLTCLSVILFSFLIQIFLYLVYYARVKLSSILNGRGFAPLFAVKTKSIYGELGTSETGDVDNPDDLLSVNS 304          
BLAST of Protein rolling stone vs. TrEMBL
Match: A0A504YZG5 (Protein rolling stone OS=Fasciola gigantica OX=46835 GN=FGIG_10378 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 3.065e-42
Identity = 92/290 (31.72%), Postives = 152/290 (52.41%), Query Frame = 3
Query:   21 RIQF*IMSEFQLKSFAFTHDRVYNFVESQWDFISPKLFTCYRVIMAIGMVLWAISDFASEWLNSYRGYPYFWLLMATNWAFMAMVIAHIALAFVNILTNCHDVRSQNVVGYKMCWIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFILGILYTIMLVXXXXXXXXXXXXXXXXXEALYWKYPGSAIVAVVCVIIMSILIQLFLFIFVQARIWL----------------YKLIYGDTVTMHQSKCEEDDQIPIMNN 842
            R++   + EF  +   F+H R  +F +SQW ++ P LF  YRV++AIG ++W   D   E  N Y    Y W L ATNWAF  + +    LA  +++ NC     + ++ Y+  W  Y I+ N  +  S ++  AL +S   +F++   ++KH L A+L + DL + +IPIRL H IYP ++GILY++   +++  G  GP     +Y  L W +P +A++  + VI+ S LIQ+FL++   +R+ L                 K IYG+  T      +  D +  +N+
Sbjct:   15 RLREFFVHEFSWRGLGFSHTRPSDFTDSQWLWMRPWLFIVYRVLLAIGFIIWLSLDIPREIHNYYEDRTYIWFLYATNWAFGMLALTFFLLAIFSLVYNCPRRPDERIILYQPLWFLYTISTNGSIVASSVFWIALSSSHLGVFSSQLGRLKHSLTAVLAVLDLCLSAIPIRLIHVIYPILVGILYSLCSYLFWLSGIQGPLNVGQVYPGLNWTHPRTAVLTCLSVILFSFLIQIFLYLVYYSRVKLSSILNGRGCAPPFAVKTKSIYGELGTSETGDVDNPDDLLSVNS 304          
BLAST of Protein rolling stone vs. TrEMBL
Match: A0A074ZRW1 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_03644 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 2.349e-38
Identity = 94/281 (33.45%), Postives = 159/281 (56.58%), Query Frame = 3
Query:   39 MSEFQLKSFAFTHDRVYNFVESQWDFISPKLFTCYRVIMAIGMVLWAISDFASEWLNSYRGYPYFWLLMATNWAFMAMVIAHIALAFVNILTNCHDVRSQNVVGYKMCWIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFILGILYTIMLVXXXXXXXXXXXXXXXXXEALYWKYPGSAIVAVVCVIIMSILIQLFLFIFVQARIWLYKLIYG---DTVTMHQSKCEE--DDQIPIMNNDYNSYSTI 866
            +SEF  KSF  +HDR  +F++SQW ++ P LFT YRV++++G ++W   D   E  N +    + W + ATNW+F  + +A   LA   ++ NC   +   ++ Y   W+ Y IA ++++  SI+Y  AL NS   +F++   K+KH L A L + DL I SIP+RL H +YP ++G++Y +   +++ GGG GP G   +Y  L W +P +AI++ +C ++ S LI + +++    R+ L     G   +TV   +    +  DD    + +D  S S++
Sbjct:   24 VSEFSWKSFGCSHDRPDDFIDSQWLWMKPWLFTTYRVLLSLGTLVWICFDIPREIHNYFHDKTHIWFVYATNWSFGLLTLAFFLLALYCLIYNCPRRKDATLILYGPIWLIYIIALDTIIVVSIVYWVALANSSLGVFSSIWGKLKHSLAACLAILDLLISSIPVRLAHVVYPILMGLIYGVFSYLFWLGGGEGPLGVGQVYPGLNWIHPKTAILSCLCALLFSFLIHILIYVTYYIRVKLSTCFGGRHAETVNQMEEGYNDLRDDVENELRDDVVSESSV 304          
BLAST of Protein rolling stone vs. TrEMBL
Match: A0A5J4NKD3 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0003886 PE=4 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.407e-37
Identity = 88/272 (32.35%), Postives = 146/272 (53.68%), Query Frame = 3
Query:   21 RIQF*IMSEFQLKSFAFTHDRVYNFVESQWDFISPKLFTCYRVIMAIGMVLWAISDFASEWLNSYRGYPYFWLLMATNWAFMAMVIAHIALAFVNILTNCHDVRSQNVVGYKMCWIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFILGILYTIMLVXXXXXXXXXXXXXXXXXEALYWKYPGSAIVAVVCVIIMSILIQLFLFIFVQARIWLYKLIYGD---TVTMHQSKCEEDDQI 827
            R+    ++EF  +   F H R  +F ESQW ++ P LFT YRV++A+ M++W   D   E    +    Y W + ATNW F  +V+    L    ++ NC    + +V+ Y+  W+ Y +A N +L   +++  AL +S+  +F +   ++KH L+ +L + DL I +IP RL H  YP + GILY++    ++ G   GP     +Y  L W +P +AI+A +CV+++S L+ + L++    R+ L   I G      +  QSK  + DQI
Sbjct:   18 RLHNFFITEFSWRCLGFNHSRPTDFTESQWVWMKPWLFTIYRVLLALSMLIWISFDIPRETHRYFGNRTYIWFVYATNWTFGLLVLVFFLLTVQCLVYNCPKRDNASVILYQPLWLLYTVAVNGILVVCLVFWVALSSSDLGVFASGWGRLKHSLSGILAILDLGISAIPFRLVHVTYPILAGILYSMFSYFFWLGDLTGPVAVGQVYPGLNWAHPRAAILACLCVLLVSFLVHICLYVTYFLRVQLSAHINGRGHAAPSAVQSKNGKYDQI 289          
BLAST of Protein rolling stone vs. TrEMBL
Match: A0A4S2MEF6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000642 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.570e-37
Identity = 87/239 (36.40%), Postives = 141/239 (59.00%), Query Frame = 3
Query:   39 MSEFQLKSFAFTHDRVYNFVESQWDFISPKLFTCYRVIMAIGMVLWAISDFASEWLNSYRGYPYFWLLMATNWAFMAMVIAHIALAFVNILTNCHDVRSQNVVGYKMCWIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFILGILYTIMLVXXXXXXXXXXXXXXXXXEALYWKYPGSAIVAVVCVIIMSILIQLFLFIFVQARI 755
            +SEF  KSF   H R  +F++SQW ++ P LFT YRV++++G ++W   D   E  N +    + W + ATNW+F  + +A   LA   ++ NC   R   ++ Y   W+ Y IA +++   SI+Y  AL NS   +F++   KIKH L A L + DL I SIP+RL H +YP ++G++Y +   +++ GGG GP G   +Y  L W +P +AI++ +C I++S LI + +++    R+
Sbjct:   24 VSEFSWKSFGCNHARPDDFIDSQWLWMKPWLFTTYRVLLSLGSLVWICFDIPREIHNYFHDKTHIWFVYATNWSFGLLTLAFFLLALYCLIYNCPRRRDATLILYGPIWLIYIIALDTIFVVSIVYWVALANSNLGVFSSIWGKIKHSLAACLAVLDLLISSIPVRLAHAVYPILIGLIYAVFSYLFWLGGGEGPLGVGQVYPGLNWIHPKTAILSCLCAILLSFLIHILIYVTYYIRV 262          
BLAST of Protein rolling stone vs. Ensembl Nematostella
Match: EDO34938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMX5])

HSP 1 Score: 56.225 bits (134), Expect = 5.255e-9
Identity = 47/157 (29.94%), Postives = 81/157 (51.59%), Query Frame = 3
Query:  363 WIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFILGILYTIMLVXXXXXXXXXXXXXXXXXEAL-YWKYPGSAI-VAVVCVIIMSILIQLFLFIFVQARIWLYKLIYGDTVTMHQSKCEEDDQI 827
            W+ + +A NS +   ++Y      S Q           H LNAL ++ DL + S+P+RL   IYPF+  I+Y I LV+Y+   G   NG+PY+Y++  + + P  A   A+   +I  +L Q+ LF   + R W  + +  +   +++  CE + Q+
Sbjct:  163 WLLHIVAANSAVAVCLVYWMISYPSYQGYTPDGLDISTHLLNALFVVIDLCLSSLPVRLLQIIYPFVYFIIYLIFLVLYWASDGTNANGQPYVYKSTDFTERPARAAGFAIGFPLIFQMLAQVILFSLYKLRCWGSEKLMENQGAVYKEGCEIERQV 319          
BLAST of Protein rolling stone vs. Ensembl Nematostella
Match: EDO45066 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTP9])

HSP 1 Score: 54.299 bits (129), Expect = 1.449e-8
Identity = 50/212 (23.58%), Postives = 86/212 (40.57%), Query Frame = 3
Query:   36 IMSEFQLKSFAFTHDRVYNFVESQWDFISPKLFTCYRVIMAIGMVLWAISDFASEWLNSYRGYPYFWLLMATNWAFMAMVIAHIALAFVNILTNCHDVRSQNVVG--------------------------YKMCWIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFILGILYTIMLV 593
            I  EFQL +    H    +F  S W F  P +   YR  +A+   +W +    S  L         W +  T+W +  + +  +A A ++        R  +                             +K  W+ Y++A +  +  ++ Y + LL    +I+    +   H LN++ +L +  +CSIPIRLFH +YPF  G +Y +  V
Sbjct:    2 IKQEFQLVNLKLIHTSPKDFASSDW-FPLP-VVIVYRTALAVYCFVWLVFSGFSTMLGGDT-----WFIYLTDWTYTCVTVYFLAAATLSTTEYVKQRRQSDKYRPLPDSDAEPTDKTATSGNSDDVMYWYHKALWVLYSMAADMAVVVTVSY-WTLLYHGFKIYLLNVNV--HLLNSVFMLAETMLCSIPIRLFHVVYPFCYGAVYILFTV 203          
BLAST of Protein rolling stone vs. Ensembl Nematostella
Match: EDO35079 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMI1])

HSP 1 Score: 52.373 bits (124), Expect = 3.611e-8
Identity = 53/180 (29.44%), Postives = 87/180 (48.33%), Query Frame = 3
Query:  234 WLLMATNWAFMAMVIAHIALAFVNILTNCHDVRSQNVVGYKMCWIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFILGILYTIMLVXXXXXXXXXXXXXXXXXEAL-YWKYPG-SAIVAVVCVIIMSILIQLFLFIFVQARIWLYK 767
            W +  TNW++  + I  I  A    LT         ++  K+ W+ +NIA N  +   + +++   N     +  + +   H LN +L+  D+ + ++P+R+ H IY  + G  Y    VIY+  GG+   G  YIY AL Y   PG +A +AV+ V++   L  L L+     R WL K
Sbjct:    9 WFIFLTNWSYTILNIHFILGALNTKLTTLPQNSRMFILACKVSWVVFNIAAN--VAPLVTFMYWGFNYVPGQYVDSSNINAHALNCVLMFADVMLSNLPVRVLHVIYALVCGFAYVTFTVIYWAAGGVNHEGNSYIYSALDYTGSPGMAATMAVLFVLLAQPLSHLLLYGLYCFRDWLVK 186          
BLAST of Protein rolling stone vs. Ensembl Nematostella
Match: EDO34937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMX4])

HSP 1 Score: 51.9878 bits (123), Expect = 6.195e-8
Identity = 32/130 (24.62%), Postives = 62/130 (47.69%), Query Frame = 3
Query:  234 WLLMATNWAFMAMVIAHIALAFVNILTNCHDVRSQNVVGYK----------MCWIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFILGILYTIMLV 593
            W +  TNW ++   +  I  + V +  +  + ++++   +           + WI +NIA ++ +  SIIY   ++     +  +T     H LN + ++ +L +  +PIRL H IYP + G+ Y I  V
Sbjct:   30 WFIYLTNWGYLLETVYFIYASAVTLWFHIREKKNKDQSDFNFSDLMRYHHSLMWILFNIAADTAVLISIIYWGWMVGPIDGLDVST-----HALNTVFMILELVLSKLPIRLLHCIYPLVFGLCYMIFTV 154          
BLAST of Protein rolling stone vs. Ensembl Nematostella
Match: EDO40160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7Z4])

HSP 1 Score: 50.447 bits (119), Expect = 2.998e-7
Identity = 70/290 (24.14%), Postives = 127/290 (43.79%), Query Frame = 3
Query:   36 IMSEFQLKSFAFTHDRVYNFVESQWDFISPKLFTCYRVIMAIGMVLWAISD--FASEWLNSYRGYPYFWLLMATNWAFMAMVIAHIALAFVNILTNCHD----VRSQNVVG---------------------YKMCWIFYNI-ACNSVLTTSIIYLFALLNSEQEIFNTTQSKI---------KHCLNALLILFDLAICSIPIRLFHFIYPFILGILY--TIMLVXXXXXXXXXXXXXXXXXEALYWKYPG-SAIVAVVCVIIMSILIQLFLFIFVQARIWLYKLIYGDT 785
            I  EF++++   +H  ++ F  S+W  +    +  YR ++A+ + +  I D  F   W +    + ++ L+  T +  +A ++  I   +V    N  D    V      G                     YK+ W+ +N+ A NSV+ +  +  + LL+ +   F   Q+ I          H +NA++++ D  I ++P+R+FH +Y  I G++Y  T ++V    G               Y K PG +AIV V    ++  LIQL  +   +ARIWL  ++   T
Sbjct:    3 IQEEFRIRNVLPSHPDLHTFTSSKW--MPTGAYLAYRWLLALYISVDVIVDRLFFKRWYSF--AFTFWGLITLTLYLNLAAILTTIK--YVKTRLNLSDHAGIVSQSGEEGISTPGAAEDETFTPDGYMPKLYKLMWLLFNVCAVNSVIVS--VGYWGLLHQK---FGR-QATIGLIGYLNINSHLINAVIMILDSMIHNVPVRIFHVVYSTIYGLIYFFTTIIVWLASGRVAYFFLD-------YSKRPGIAAIVIVGGCFVVQPLIQLMHYGLYRARIWLQGVLLDGT 273          
BLAST of Protein rolling stone vs. Planmine SMEST
Match: SMESG000077396.1 (SMESG000077396.1)

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 275/277 (99.28%), Postives = 277/277 (100.00%), Query Frame = 3
Query:   39 MSEFQLKSFAFTHDRVYNFVESQWDFISPKLFTCYRVIMAIGMVLWAISDFASEWLNSYRGYPYFWLLMATNWAFMAMVIAHIALAFVNILTNCHDVRSQNVVGYKMCWIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFILGILYTIMLVXXXXXXXXXXXXXXXXXEALYWKYPGSAIVAVVCVIIMSILIQLFLFIFVQARIWLYKLIYGDTVTMHQSKCEEDDQIPIMNNDYNSYSTIE 869
            MSEFQLKSFAFTHDRVYNFVESQWDFISPKLFTCYRVIMAIGMVLWAISDFASEWLNSYRGYPYFWLLMATNWAFMAMVIAHIALAFVNILTNCHDVRSQNVVGYKMCWIFYNIACNSVLTTSIIYLFAL+NSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPF+LGILYTIMLVIYYYGGGIGPNGKPYIYEALYWKYPGSAIVAVVCVIIMSILIQLFLFIFVQARIWLYKLIYGDTVTMHQSKCEEDDQIPIMNNDYNSYSTIE
Sbjct:    1 MSEFQLKSFAFTHDRVYNFVESQWDFISPKLFTCYRVIMAIGMVLWAISDFASEWLNSYRGYPYFWLLMATNWAFMAMVIAHIALAFVNILTNCHDVRSQNVVGYKMCWIFYNIACNSVLTTSIIYLFALVNSEQEIFNTTQSKIKHCLNALLILFDLAICSIPIRLFHFIYPFMLGILYTIMLVIYYYGGGIGPNGKPYIYEALYWKYPGSAIVAVVCVIIMSILIQLFLFIFVQARIWLYKLIYGDTVTMHQSKCEEDDQIPIMNNDYNSYSTIE 277          
The following BLAST results are available for this feature:
BLAST of Protein rolling stone vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein rolling stone vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein rolling stone vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG131011.593e-1326.74gene:FBgn0032084 transcript:FBtr0079784[more]
CG131011.593e-1326.74gene:FBgn0032084 transcript:FBtr0079783[more]
CG95554.348e-1025.83gene:FBgn0032085 transcript:FBtr0079761[more]
CG95554.348e-1025.83gene:FBgn0032085 transcript:FBtr0345450[more]
CG437781.748e-724.39gene:FBgn0264308 transcript:FBtr0331505[more]
back to top
BLAST of Protein rolling stone vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein rolling stone vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein rolling stone vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein rolling stone vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein rolling stone vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RE658.862e-4332.62Protein rolling stone OS=Fasciola hepatica OX=6192... [more]
A0A504YZG53.065e-4231.72Protein rolling stone OS=Fasciola gigantica OX=468... [more]
A0A074ZRW12.349e-3833.45Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A5J4NKD31.407e-3732.35Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A4S2MEF62.570e-3736.40Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Protein rolling stone vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein rolling stone vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein rolling stone vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein rolling stone vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO349385.255e-929.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450661.449e-823.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350793.611e-829.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349376.195e-824.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401602.998e-724.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein rolling stone vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein rolling stone vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000077396.10.000e+099.28SMESG000077396.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025144 ID=SMED30025144|Name=Protein rolling stone|organism=Schmidtea mediterranea sexual|type=transcript|length=992bp
CCCTCTATAACTTTTCTTTTCGCATTCAATTCTAAATTATGTCTGAATTT
CAATTGAAATCTTTTGCTTTTACTCACGATAGAGTTTATAATTTTGTAGA
AAGTCAATGGGATTTTATTTCTCCAAAACTATTTACATGTTATCGAGTAA
TTATGGCGATTGGTATGGTCTTGTGGGCGATTTCAGATTTTGCATCAGAA
TGGTTAAACAGTTACAGAGGGTATCCTTATTTTTGGTTGCTTATGGCAAC
GAATTGGGCCTTTATGGCTATGGTTATTGCCCATATTGCATTGGCCTTTG
TTAATATATTGACAAACTGTCACGATGTCAGGAGTCAAAATGTTGTTGGT
TACAAAATGTGCTGGATATTTTACAATATCGCCTGCAATTCTGTATTGAC
TACTTCAATTATTTACTTATTTGCTTTATTGAATTCAGAACAAGAGATTT
TTAATACGACCCAAAGCAAGATAAAGCATTGTTTAAATGCACTTCTCATT
TTATTTGATCTTGCAATTTGTTCCATTCCAATTCGCCTATTTCATTTCAT
TTATCCGTTCATACTGGGAATTTTATACACAATCATGCTGGTTATTTATT
ACTATGGTGGGGGCATTGGTCCAAATGGGAAGCCGTATATTTATGAGGCG
TTGTATTGGAAATATCCCGGCAGTGCAATTGTTGCGGTAGTCTGTGTCAT
TATAATGTCTATATTAATACAATTGTTTCTGTTCATTTTCGTCCAAGCTC
GCATTTGGCTCTATAAATTGATTTACGGCGACACAGTGACAATGCACCAA
TCAAAATGTGAAGAAGATGATCAAATTCCAATCATGAATAACGATTACAA
TTCCTATTCGACAATTGAATGACTTTATTCTAGTTATTATTGAAACTTCT
TTCATCCATGTTGTGTTGTCCTGTTCAGTATTTCAAACTTTTTTCGATAT
TAAAATTGTGAATTTAAATACAGTACATAAGGTGCAATAAAA
back to top

protein sequence of SMED30025144-orf-1

>SMED30025144-orf-1 ID=SMED30025144-orf-1|Name=SMED30025144-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=278bp
MSEFQLKSFAFTHDRVYNFVESQWDFISPKLFTCYRVIMAIGMVLWAISD
FASEWLNSYRGYPYFWLLMATNWAFMAMVIAHIALAFVNILTNCHDVRSQ
NVVGYKMCWIFYNIACNSVLTTSIIYLFALLNSEQEIFNTTQSKIKHCLN
ALLILFDLAICSIPIRLFHFIYPFILGILYTIMLVIYYYGGGIGPNGKPY
IYEALYWKYPGSAIVAVVCVIIMSILIQLFLFIFVQARIWLYKLIYGDTV
TMHQSKCEEDDQIPIMNNDYNSYSTIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR039860Rost
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR039860Protein rolling stonePANTHERPTHR12242:SF1LD06593P-RELATEDcoord: 5..249
NoneNo IPR availablePANTHERPTHR12242UNCHARACTERIZEDcoord: 5..249
NoneNo IPR availableTMHMMTMhelixcoord: 151..168
NoneNo IPR availableTMHMMTMhelixcoord: 212..234
NoneNo IPR availableTMHMMTMhelixcoord: 32..51
NoneNo IPR availableTMHMMTMhelixcoord: 170..192
NoneNo IPR availableTMHMMTMhelixcoord: 66..88
NoneNo IPR availableTMHMMTMhelixcoord: 109..131