slc28a-2

Overview
Nameslc28a-2 (AKN21617.1)
Smed IDSMED30025137
Length (bp)959
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc28a-2 (SMED30025137) t-SNE clustered cells

Violin plots show distribution of expression levels for slc28a-2 (SMED30025137) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025137

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30025137SMESG000077408.1 dd_Smed_v6_59544_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
collecting ductSMED30025137SMESG000077408.1 Smed-slc28a-2smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc28a-2 vs. Ensembl Human
Match: SLC28A2 (solute carrier family 28 member 2 [Source:HGNC Symbol;Acc:HGNC:11002])

HSP 1 Score: 136.732 bits (343), Expect = 1.857e-47
Identity = 67/159 (42.14%), Postives = 104/159 (65.41%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNW 587
            + A+ L++AS+M AP +LA SKL YPE + S   S +  K+P     NV+EA +  A+D+ GL   VA NL+ F+ +L+F+N+ L W+G  + +   L+F+ ICSYL  P+ F++G+++ DC  VAE+ GIK F+NEF+AYQ+L +   NK++     W
Sbjct:  357 VDASSLISASVMAAPCALASSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLATNVAANLIAFLAVLAFINAALSWLGELVDIQG-LTFQVICSYLLRPMVFMMGVEWTDCPMVAEMVGIKFFINEFVAYQQL-SQYKNKRLSGMEEW 513          

HSP 2 Score: 72.7886 bits (177), Expect = 1.857e-47
Identity = 41/97 (42.27%), Postives = 60/97 (61.86%), Query Frame = 2
Query:  632 WIE*NCPKEWNNSDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEEKK*NSLCLLF--TKFCAR 916
            WIE    K+W  S R+ +I T+ LCGF N++S+G+ LG L +I PHR  D+S ++  +L  G  VSLI+ C+AG+LY  +   + C+ F  T F  R
Sbjct:  513 WIE--GEKQWI-SVRAEIITTFSLCGFANLSSIGITLGGLTSIVPHRKSDLSKVVVRALFTGACVSLISACMAGILYVPRGAEADCVSFPNTSFTNR 606          
BLAST of slc28a-2 vs. Ensembl Human
Match: SLC28A3 (solute carrier family 28 member 3 [Source:HGNC Symbol;Acc:HGNC:16484])

HSP 1 Score: 141.354 bits (355), Expect = 1.980e-46
Identity = 69/152 (45.39%), Postives = 100/152 (65.79%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQ 566
            +P++HLLTAS+M AP SLA +KL +PET+    T  +  K+      N++EA T+ A  S  L+A +A+NL+ F+ LLSF+NS L W GN       LSFE ICSY+F P +F++G++++D F VA L G K F NEF+AY+ L   I+ ++
Sbjct:  384 VPSSHLLTASVMSAPASLAAAKLFWPETEKPKITLKNAMKMESGDSGNLLEAATQGASSSISLVANIAVNLIAFLALLSFMNSALSWFGNMFDYPQ-LSFELICSYIFMPFSFMMGVEWQDSFMVARLIGYKTFFNEFVAYEHLSKWIHLRK 534          

HSP 2 Score: 64.6994 bits (156), Expect = 1.980e-46
Identity = 31/62 (50.00%), Postives = 45/62 (72.58%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLL 859
            RS +IATY LCGF NI S+G+++G L ++AP R +DI+S    +L+AG +   +T CIAG+L
Sbjct:  551 RSEIIATYALCGFANIGSLGIVIGGLTSMAPSRKRDIASGAVRALIAGTVACFMTACIAGIL 612          
BLAST of slc28a-2 vs. Ensembl Human
Match: SLC28A1 (solute carrier family 28 member 1 [Source:HGNC Symbol;Acc:HGNC:11001])

HSP 1 Score: 129.413 bits (324), Expect = 2.583e-43
Identity = 68/159 (42.77%), Postives = 101/159 (63.52%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNW 587
            I A  L+ AS+M AP +LA+SKLVYPE + S     +  K+      N+IEA +  A  S  ++A +A NL+ F+ +L F+N+ L W+G+ + +   LSF+ ICSY+  P+AFL+G+ + DC  VAEL GIK+FLNEF+AYQ L +    +++  A  W
Sbjct:  362 IDATSLIAASVMAAPCALALSKLVYPEVEESKFRREEGVKLTYGDAQNLIEAASTGAAISVKVVANIAANLIAFLAVLDFINAALSWLGDMVDIQG-LSFQLICSYILRPVAFLMGVAWEDCPVVAELLGIKLFLNEFVAYQDL-SKYKQRRLAGAEEW 518          

HSP 2 Score: 66.2402 bits (160), Expect = 2.583e-43
Identity = 31/70 (44.29%), Postives = 46/70 (65.71%), Query Frame = 2
Query:  653 KEWNNSDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLY 862
            K+W  S R+ V+ T+ LCGF N +S+G++LG L ++ P R  D S I+  +L  G  VSL+  C+AG+LY
Sbjct:  523 KQWI-SVRAEVLTTFALCGFANFSSIGIMLGGLTSMVPQRKSDFSQIVLRALFTGACVSLVNACMAGILY 591          
BLAST of slc28a-2 vs. Ensembl Human
Match: SLC28A1 (solute carrier family 28 member 1 [Source:HGNC Symbol;Acc:HGNC:11001])

HSP 1 Score: 129.413 bits (324), Expect = 2.583e-43
Identity = 68/159 (42.77%), Postives = 101/159 (63.52%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNW 587
            I A  L+ AS+M AP +LA+SKLVYPE + S     +  K+      N+IEA +  A  S  ++A +A NL+ F+ +L F+N+ L W+G+ + +   LSF+ ICSY+  P+AFL+G+ + DC  VAEL GIK+FLNEF+AYQ L +    +++  A  W
Sbjct:  362 IDATSLIAASVMAAPCALALSKLVYPEVEESKFRREEGVKLTYGDAQNLIEAASTGAAISVKVVANIAANLIAFLAVLDFINAALSWLGDMVDIQG-LSFQLICSYILRPVAFLMGVAWEDCPVVAELLGIKLFLNEFVAYQDL-SKYKQRRLAGAEEW 518          

HSP 2 Score: 66.2402 bits (160), Expect = 2.583e-43
Identity = 31/70 (44.29%), Postives = 46/70 (65.71%), Query Frame = 2
Query:  653 KEWNNSDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLY 862
            K+W  S R+ V+ T+ LCGF N +S+G++LG L ++ P R  D S I+  +L  G  VSL+  C+AG+LY
Sbjct:  523 KQWI-SVRAEVLTTFALCGFANFSSIGIMLGGLTSMVPQRKSDFSQIVLRALFTGACVSLVNACMAGILY 591          
BLAST of slc28a-2 vs. Ensembl Human
Match: SLC28A1 (solute carrier family 28 member 1 [Source:HGNC Symbol;Acc:HGNC:11001])

HSP 1 Score: 63.929 bits (154), Expect = 8.770e-11
Identity = 28/63 (44.44%), Postives = 42/63 (66.67%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLY 862
            R+ V+ T+ LCGF N +S+G++LG L ++ P R  D S I+  +L  G  VSL+  C+AG+LY
Sbjct:  363 RAEVLTTFALCGFANFSSIGIMLGGLTSMVPQRKSDFSQIVLRALFTGACVSLVNACMAGILY 425          
BLAST of slc28a-2 vs. Ensembl Celegans
Match: slc-28.1 (Sodium/nucleoside cotransporter [Source:UniProtKB/TrEMBL;Acc:G5EE77])

HSP 1 Score: 73.559 bits (179), Expect = 6.642e-22
Identity = 45/144 (31.25%), Postives = 80/144 (55.56%), Query Frame = 3
Query:  126 LLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGI--DYRDCFKVAELFGIKIFLNEFIAYQKLGTM 551
            +LTASI+ AP SLA SKL+YPE + ++    D  ++         + +  + +     +  +   L+V + LL+ ++ I  +IG+ +  +   SF+ +  Y F+P+A+++GI  +      VA+L G K  +NEF+AY KLG +
Sbjct:  336 ILTASILSAPMSLACSKLMYPEEQETIIKEEDF-ELDHENEKGFFDTLCSAGVALVPTVFAIGATLVVVMSLLALLDQIFFYIGDLIGYDG-WSFQMLFGYAFFPLAYIMGITNNSNQTLLVAQLMGSKTAVNEFVAYDKLGQL 477          

HSP 2 Score: 48.9062 bits (115), Expect = 6.642e-22
Identity = 25/69 (36.23%), Postives = 40/69 (57.97%), Query Frame = 2
Query:  653 KEWNNSDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLL 859
            KE     +SV++ATY LCGF N  S+G+ + V+  +AP R    S ++  +L AG +   +   +AG+L
Sbjct:  479 KEGKLDPKSVLVATYALCGFSNFGSMGIQMEVIGGLAPGRKTVASKVMLRALCAGAIACFMNATVAGIL 547          
BLAST of slc28a-2 vs. Ensembl Celegans
Match: slc-28.2 (Sodium/nucleoside cotransporter [Source:UniProtKB/TrEMBL;Acc:A0A131MBV2])

HSP 1 Score: 76.6406 bits (187), Expect = 2.764e-15
Identity = 45/145 (31.03%), Postives = 86/145 (59.31%), Query Frame = 3
Query:  123 HLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGI-DYRD-CFKVAELFGIKIFLNEFIAYQKLGTM 551
            +LLTAS++ AP SLA SK+++PET+ S     D  K+  +      + +  + +     +  +   L+V + LL+F+++++++IG+ +  +   +F+ +  Y F+P+A+++G+ D  D    VA+L G K  +NEF+AY  LG +
Sbjct:  341 YLLTASLLSAPMSLACSKIMFPETEESNVKEEDF-KLEHNDKRGFFDTLCSAGVALVPTVFAIGATLVVIMSLLAFLDAVMEYIGDLIGYDG-WTFQMLFGYAFFPLAYMMGVNDNSDQTLLVAQLMGTKTAVNEFVAYNNLGIL 483          

HSP 2 Score: 52.373 bits (124), Expect = 2.459e-7
Identity = 26/62 (41.94%), Postives = 40/62 (64.52%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLL 859
            +SVVIATY LCGF N +S+GM +  L  +AP +   IS ++  +L AG++   +   +AG+L
Sbjct:  492 KSVVIATYALCGFSNFSSMGMSIEFLGGLAPSKRSTISKLVLRALCAGSIACFMNATVAGIL 553          
BLAST of slc28a-2 vs. Ensembl Celegans
Match: slc-28.2 (Sodium/nucleoside cotransporter [Source:UniProtKB/TrEMBL;Acc:A0A131MBV2])

HSP 1 Score: 76.6406 bits (187), Expect = 2.764e-15
Identity = 45/145 (31.03%), Postives = 86/145 (59.31%), Query Frame = 3
Query:  123 HLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGI-DYRD-CFKVAELFGIKIFLNEFIAYQKLGTM 551
            +LLTAS++ AP SLA SK+++PET+ S     D  K+  +      + +  + +     +  +   L+V + LL+F+++++++IG+ +  +   +F+ +  Y F+P+A+++G+ D  D    VA+L G K  +NEF+AY  LG +
Sbjct:  341 YLLTASLLSAPMSLACSKIMFPETEESNVKEEDF-KLEHNDKRGFFDTLCSAGVALVPTVFAIGATLVVIMSLLAFLDAVMEYIGDLIGYDG-WTFQMLFGYAFFPLAYMMGVNDNSDQTLLVAQLMGTKTAVNEFVAYNNLGIL 483          

HSP 2 Score: 52.373 bits (124), Expect = 2.459e-7
Identity = 26/62 (41.94%), Postives = 40/62 (64.52%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLL 859
            +SVVIATY LCGF N +S+GM +  L  +AP +   IS ++  +L AG++   +   +AG+L
Sbjct:  492 KSVVIATYALCGFSNFSSMGMSIEFLGGLAPSKRSTISKLVLRALCAGSIACFMNATVAGIL 553          
BLAST of slc28a-2 vs. Ensembl Celegans
Match: slc-28.1 (Sodium/nucleoside cotransporter [Source:UniProtKB/TrEMBL;Acc:G5EE77])

HSP 1 Score: 49.6766 bits (117), Expect = 3.915e-8
Identity = 25/72 (34.72%), Postives = 41/72 (56.94%), Query Frame = 2
Query:  653 KEWNNSDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEE 868
            KE     +SV++ATY LCGF N  S+G+ + V+  +AP R    S ++  +L AG +   +   +AG+L  +
Sbjct:   21 KEGKLDPKSVLVATYALCGFSNFGSMGIQMEVIGGLAPGRKTVASKVMLRALCAGAIACFMNATVAGILISD 92          

HSP 2 Score: 26.1794 bits (56), Expect = 3.915e-8
Identity = 10/19 (52.63%), Postives = 13/19 (68.42%), Query Frame = 3
Query:  495 FGIKIFLNEFIAYQKLGTM 551
             G K  +NEF+AY KLG +
Sbjct:    1 MGSKTAVNEFVAYDKLGQL 19          
BLAST of slc28a-2 vs. Ensembl Fly
Match: CNT2 (gene:FBgn0025709 transcript:FBtr0088562)

HSP 1 Score: 104.375 bits (259), Expect = 5.303e-33
Identity = 54/151 (35.76%), Postives = 94/151 (62.25%), Query Frame = 3
Query:  117 ANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQI 569
            A HL+T+S+M AP +LAISKL  PET+ S  TS+D  ++  S  +++++A +  A ++  ++  +  N++ F+  ++F+N ++ W G  + L  I  FE+I S LF P+ + +G+   DC  +A++   K  +NEF+AY++LG  I N  I
Sbjct:  366 AAHLITSSVMAAPATLAISKLYMPETEES-QTSSDSIELEKSQDSSLLDAASSGASNAVPIVLGIIANIVAFVAFIAFLNGLVSWFGYLVGLEQI-DFEWIFSKLFIPLVWAMGVPKEDCDIIAKVVATKTIINEFVAYERLGQYIENNDI 514          

HSP 2 Score: 55.8398 bits (133), Expect = 5.303e-33
Identity = 28/74 (37.84%), Postives = 46/74 (62.16%), Query Frame = 2
Query:  662 NNSD---RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEEKK 874
             N+D   RS  IAT+ +CGF N +S+G+L+G L  +APHR   I+++   + V G++V  ++   AG+L +E  
Sbjct:  510 ENNDITARSAGIATFAICGFANPSSLGILIGSLSAMAPHRRSTITAVAFRAFVVGSIVCFVSASFAGILIQEDD 583          
BLAST of slc28a-2 vs. Ensembl Fly
Match: CNT2 (gene:FBgn0025709 transcript:FBtr0088560)

HSP 1 Score: 104.375 bits (259), Expect = 5.303e-33
Identity = 54/151 (35.76%), Postives = 94/151 (62.25%), Query Frame = 3
Query:  117 ANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQI 569
            A HL+T+S+M AP +LAISKL  PET+ S  TS+D  ++  S  +++++A +  A ++  ++  +  N++ F+  ++F+N ++ W G  + L  I  FE+I S LF P+ + +G+   DC  +A++   K  +NEF+AY++LG  I N  I
Sbjct:  366 AAHLITSSVMAAPATLAISKLYMPETEES-QTSSDSIELEKSQDSSLLDAASSGASNAVPIVLGIIANIVAFVAFIAFLNGLVSWFGYLVGLEQI-DFEWIFSKLFIPLVWAMGVPKEDCDIIAKVVATKTIINEFVAYERLGQYIENNDI 514          

HSP 2 Score: 55.8398 bits (133), Expect = 5.303e-33
Identity = 28/74 (37.84%), Postives = 46/74 (62.16%), Query Frame = 2
Query:  662 NNSD---RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEEKK 874
             N+D   RS  IAT+ +CGF N +S+G+L+G L  +APHR   I+++   + V G++V  ++   AG+L +E  
Sbjct:  510 ENNDITARSAGIATFAICGFANPSSLGILIGSLSAMAPHRRSTITAVAFRAFVVGSIVCFVSASFAGILIQEDD 583          
BLAST of slc28a-2 vs. Ensembl Fly
Match: CNT2 (gene:FBgn0025709 transcript:FBtr0088561)

HSP 1 Score: 104.375 bits (259), Expect = 5.347e-33
Identity = 54/151 (35.76%), Postives = 94/151 (62.25%), Query Frame = 3
Query:  117 ANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQI 569
            A HL+T+S+M AP +LAISKL  PET+ S  TS+D  ++  S  +++++A +  A ++  ++  +  N++ F+  ++F+N ++ W G  + L  I  FE+I S LF P+ + +G+   DC  +A++   K  +NEF+AY++LG  I N  I
Sbjct:  365 AAHLITSSVMAAPATLAISKLYMPETEES-QTSSDSIELEKSQDSSLLDAASSGASNAVPIVLGIIANIVAFVAFIAFLNGLVSWFGYLVGLEQI-DFEWIFSKLFIPLVWAMGVPKEDCDIIAKVVATKTIINEFVAYERLGQYIENNDI 513          

HSP 2 Score: 55.8398 bits (133), Expect = 5.347e-33
Identity = 28/74 (37.84%), Postives = 46/74 (62.16%), Query Frame = 2
Query:  662 NNSD---RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEEKK 874
             N+D   RS  IAT+ +CGF N +S+G+L+G L  +APHR   I+++   + V G++V  ++   AG+L +E  
Sbjct:  509 ENNDITARSAGIATFAICGFANPSSLGILIGSLSAMAPHRRSTITAVAFRAFVVGSIVCFVSASFAGILIQEDD 582          
BLAST of slc28a-2 vs. Ensembl Fly
Match: CNT1 (gene:FBgn0033371 transcript:FBtr0300173)

HSP 1 Score: 100.138 bits (248), Expect = 6.092e-31
Identity = 53/151 (35.10%), Postives = 99/151 (65.56%), Query Frame = 3
Query:  117 ANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQI 569
            A+ L+ AS+M APGSLA +KL YPET+ SLT S ++ K+  ST  ++++A    A  +  ++  +  N++ F+ ++ F++++ +WI   + L++I +  YI S +F PI F++G+ + DC  +  +   K F+NEF+AY+ LG ++++K++
Sbjct:  369 ASFLIAASVMAAPGSLAFAKLFYPETEESLTRSDNI-KLESSTDTSILDAAASGAAAALLIVLGIVSNIIAFLAIVFFLDAVTEWIFELIGLHNI-TLLYILSQIFIPIVFVMGVPWHDCQAIGLVVAQKSFINEFVAYRNLGILVSDKKV 517          

HSP 2 Score: 53.1434 bits (126), Expect = 6.092e-31
Identity = 26/66 (39.39%), Postives = 40/66 (60.61%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEEK 871
            RS  IAT+ LCGF N  S+G+++  L  +AP R  DI+ +   S  AG+ VS  +  +AG+L + +
Sbjct:  520 RSAAIATFALCGFANPGSLGIVIASLSAMAPSRRSDITRVAFRSYFAGSFVSFTSASLAGILIQNE 585          
BLAST of slc28a-2 vs. Ensembl Zebrafish
Match: slc28a1 (solute carrier family 28 member 1 [Source:ZFIN;Acc:ZDB-GENE-050419-117])

HSP 1 Score: 145.206 bits (365), Expect = 2.037e-44
Identity = 73/151 (48.34%), Postives = 105/151 (69.54%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNK 563
            I A+ L++AS+M AP +LAISKL YPET+ S  TS    K+      NV+EA++  A  S GL+A +A NL+ F+ +L F+N+ L+W+G  +    + +FE ICS++F P+AF++GI Y + FKVAEL G K+FLNEFIAY+KL  + NN+
Sbjct:  344 IDASSLISASVMAAPCALAISKLSYPETEKSKFTSKSQIKVDSGGEQNVLEAVSGGASASIGLVANIAANLIAFLAILGFINATLRWLGGMVGYPDV-TFELICSFVFMPVAFMMGIPYDESFKVAELIGTKLFLNEFIAYEKLSELKNNR 493          

HSP 2 Score: 53.9138 bits (128), Expect = 2.037e-44
Identity = 29/61 (47.54%), Postives = 40/61 (65.57%), Query Frame = 2
Query:  668 SDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIA 850
            S RS +I TY LCGF N +S+G+++G L +I P +   ISS++  +L  G  VSLI  CIA
Sbjct:  508 SVRSEIICTYALCGFANFSSLGIVIGGLSSICPPKKGVISSLVLRALFTGTCVSLINACIA 568          
BLAST of slc28a-2 vs. Ensembl Zebrafish
Match: slc28a1 (solute carrier family 28 member 1 [Source:ZFIN;Acc:ZDB-GENE-050419-117])

HSP 1 Score: 82.8037 bits (203), Expect = 3.881e-17
Identity = 45/109 (41.28%), Postives = 68/109 (62.39%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHI---LSFEYICSY 428
            I A+ L++AS+M AP +LAISKL YPET+ S  TS    K+      NV+EA++  A  S GL+A +A NL+ F+ +L F+N+ L+W+G  +    +   +  E IC+Y
Sbjct:  358 IDASSLISASVMAAPCALAISKLSYPETEKSKFTSKSQIKVDSGGEQNVLEAVSGGASASIGLVANIAANLIAFLAILGFINATLRWLGGMVGYPDVTFEVRSEIICTY 466          

HSP 2 Score: 58.5362 bits (140), Expect = 3.656e-9
Identity = 30/63 (47.62%), Postives = 43/63 (68.25%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLY 862
            RS +I TY LCGF N +S+G+++G L +I P +   ISS++  +L  G  VSLI  CIAG+L+
Sbjct:  459 RSEIICTYALCGFANFSSLGIVIGGLSSICPPKKGVISSLVLRALFTGTCVSLINACIAGILF 521          
BLAST of slc28a-2 vs. Ensembl Zebrafish
Match: slc28a1 (solute carrier family 28 member 1 [Source:ZFIN;Acc:ZDB-GENE-050419-117])

HSP 1 Score: 82.8037 bits (203), Expect = 3.921e-17
Identity = 45/109 (41.28%), Postives = 68/109 (62.39%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHI---LSFEYICSY 428
            I A+ L++AS+M AP +LAISKL YPET+ S  TS    K+      NV+EA++  A  S GL+A +A NL+ F+ +L F+N+ L+W+G  +    +   +  E IC+Y
Sbjct:  359 IDASSLISASVMAAPCALAISKLSYPETEKSKFTSKSQIKVDSGGEQNVLEAVSGGASASIGLVANIAANLIAFLAILGFINATLRWLGGMVGYPDVTFEVRSEIICTY 467          

HSP 2 Score: 58.5362 bits (140), Expect = 3.759e-9
Identity = 30/63 (47.62%), Postives = 43/63 (68.25%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLY 862
            RS +I TY LCGF N +S+G+++G L +I P +   ISS++  +L  G  VSLI  CIAG+L+
Sbjct:  460 RSEIICTYALCGFANFSSLGIVIGGLSSICPPKKGVISSLVLRALFTGTCVSLINACIAGILF 522          
BLAST of slc28a-2 vs. Ensembl Zebrafish
Match: slc28a1 (solute carrier family 28 member 1 [Source:ZFIN;Acc:ZDB-GENE-050419-117])

HSP 1 Score: 82.8037 bits (203), Expect = 3.921e-17
Identity = 45/109 (41.28%), Postives = 68/109 (62.39%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHI---LSFEYICSY 428
            I A+ L++AS+M AP +LAISKL YPET+ S  TS    K+      NV+EA++  A  S GL+A +A NL+ F+ +L F+N+ L+W+G  +    +   +  E IC+Y
Sbjct:  359 IDASSLISASVMAAPCALAISKLSYPETEKSKFTSKSQIKVDSGGEQNVLEAVSGGASASIGLVANIAANLIAFLAILGFINATLRWLGGMVGYPDVTFEVRSEIICTY 467          

HSP 2 Score: 58.5362 bits (140), Expect = 3.759e-9
Identity = 30/63 (47.62%), Postives = 43/63 (68.25%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLY 862
            RS +I TY LCGF N +S+G+++G L +I P +   ISS++  +L  G  VSLI  CIAG+L+
Sbjct:  460 RSEIICTYALCGFANFSSLGIVIGGLSSICPPKKGVISSLVLRALFTGTCVSLINACIAGILF 522          
BLAST of slc28a-2 vs. Ensembl Xenopus
Match: SLC28A3 (solute carrier family 28 (concentrative nucleoside transporter), member 3 [Source:NCBI gene;Acc:100492606])

HSP 1 Score: 133.65 bits (335), Expect = 1.651e-42
Identity = 65/152 (42.76%), Postives = 98/152 (64.47%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQ 566
            + ++HLLTAS+M AP +LA+SKL +PET+          K+      N++EA ++ A  S  L+A +A+NL+ F+ LL+F N+ L W+GN       LSFE ICSY+F P +F++G+D+ D F V +L G K F NEF+AY+ L  +IN ++
Sbjct:  312 VSSSHLLTASVMSAPAALAVSKLFWPETEPIKVNMKHGMKLEKGEARNILEAASQGASASIPLVANIAVNLMAFLSLLAFFNAALSWLGNMFDYPQ-LSFEVICSYVFMPFSFMMGVDWEDSFIVGKLIGYKTFFNEFVAYEYLAGLINKRK 462          

HSP 2 Score: 59.3066 bits (142), Expect = 1.651e-42
Identity = 31/66 (46.97%), Postives = 43/66 (65.15%), Query Frame = 2
Query:  668 SDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYE 865
            S RS  IATY LCGF N  S+G+ +G L ++AP R  DI+S    +++AG +   +T CIAGLL +
Sbjct:  477 SIRSETIATYALCGFANFGSLGITIGGLSSMAPSRKGDIASGAIRAMIAGTVACFMTACIAGLLTQ 542          
BLAST of slc28a-2 vs. Ensembl Xenopus
Match: SLC28A3 (solute carrier family 28 (concentrative nucleoside transporter), member 3 [Source:NCBI gene;Acc:100492606])

HSP 1 Score: 134.806 bits (338), Expect = 2.523e-42
Identity = 65/152 (42.76%), Postives = 98/152 (64.47%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQ 566
            + ++HLLTAS+M AP +LA+SKL +PET+          K+      N++EA ++ A  S  L+A +A+NL+ F+ LL+F N+ L W+GN       LSFE ICSY+F P +F++G+D+ D F V +L G K F NEF+AY+ L  +IN ++
Sbjct:  273 VSSSHLLTASVMSAPAALAVSKLFWPETEPIKVNMKHGMKLEKGEARNILEAASQGASASIPLVANIAVNLMAFLSLLAFFNAALSWLGNMFDYPQ-LSFEVICSYVFMPFSFMMGVDWEDSFIVGKLIGYKTFFNEFVAYEYLAGLINKRK 423          

HSP 2 Score: 57.7658 bits (138), Expect = 2.523e-42
Identity = 30/64 (46.88%), Postives = 42/64 (65.62%), Query Frame = 2
Query:  668 SDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLL 859
            S RS  IATY LCGF N  S+G+ +G L ++AP R  DI+S    +++AG +   +T CIAG+L
Sbjct:  438 SIRSETIATYALCGFANFGSLGITIGGLSSMAPSRKGDIASGAIRAMIAGTVACFMTACIAGIL 501          
BLAST of slc28a-2 vs. Ensembl Xenopus
Match: SLC28A3 (solute carrier family 28 (concentrative nucleoside transporter), member 3 [Source:NCBI gene;Acc:100492606])

HSP 1 Score: 134.42 bits (337), Expect = 2.977e-42
Identity = 65/152 (42.76%), Postives = 98/152 (64.47%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQ 566
            + ++HLLTAS+M AP +LA+SKL +PET+          K+      N++EA ++ A  S  L+A +A+NL+ F+ LL+F N+ L W+GN       LSFE ICSY+F P +F++G+D+ D F V +L G K F NEF+AY+ L  +IN ++
Sbjct:  228 VSSSHLLTASVMSAPAALAVSKLFWPETEPIKVNMKHGMKLEKGEARNILEAASQGASASIPLVANIAVNLMAFLSLLAFFNAALSWLGNMFDYPQ-LSFEVICSYVFMPFSFMMGVDWEDSFIVGKLIGYKTFFNEFVAYEYLAGLINKRK 378          

HSP 2 Score: 57.7658 bits (138), Expect = 2.977e-42
Identity = 30/64 (46.88%), Postives = 42/64 (65.62%), Query Frame = 2
Query:  668 SDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLL 859
            S RS  IATY LCGF N  S+G+ +G L ++AP R  DI+S    +++AG +   +T CIAG+L
Sbjct:  393 SIRSETIATYALCGFANFGSLGITIGGLSSMAPSRKGDIASGAIRAMIAGTVACFMTACIAGIL 456          
BLAST of slc28a-2 vs. Ensembl Xenopus
Match: SLC28A3 (solute carrier family 28 (concentrative nucleoside transporter), member 3 [Source:NCBI gene;Acc:100492606])

HSP 1 Score: 134.42 bits (337), Expect = 3.147e-42
Identity = 65/152 (42.76%), Postives = 98/152 (64.47%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQ 566
            + ++HLLTAS+M AP +LA+SKL +PET+          K+      N++EA ++ A  S  L+A +A+NL+ F+ LL+F N+ L W+GN       LSFE ICSY+F P +F++G+D+ D F V +L G K F NEF+AY+ L  +IN ++
Sbjct:  340 VSSSHLLTASVMSAPAALAVSKLFWPETEPIKVNMKHGMKLEKGEARNILEAASQGASASIPLVANIAVNLMAFLSLLAFFNAALSWLGNMFDYPQ-LSFEVICSYVFMPFSFMMGVDWEDSFIVGKLIGYKTFFNEFVAYEYLAGLINKRK 490          

HSP 2 Score: 57.7658 bits (138), Expect = 3.147e-42
Identity = 30/64 (46.88%), Postives = 42/64 (65.62%), Query Frame = 2
Query:  668 SDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLL 859
            S RS  IATY LCGF N  S+G+ +G L ++AP R  DI+S    +++AG +   +T CIAG+L
Sbjct:  505 SIRSETIATYALCGFANFGSLGITIGGLSSMAPSRKGDIASGAIRAMIAGTVACFMTACIAGIL 568          
BLAST of slc28a-2 vs. Ensembl Xenopus
Match: SLC28A3 (solute carrier family 28 (concentrative nucleoside transporter), member 3 [Source:NCBI gene;Acc:100492606])

HSP 1 Score: 134.42 bits (337), Expect = 3.228e-42
Identity = 65/152 (42.76%), Postives = 98/152 (64.47%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQ 566
            + ++HLLTAS+M AP +LA+SKL +PET+          K+      N++EA ++ A  S  L+A +A+NL+ F+ LL+F N+ L W+GN       LSFE ICSY+F P +F++G+D+ D F V +L G K F NEF+AY+ L  +IN ++
Sbjct:  297 VSSSHLLTASVMSAPAALAVSKLFWPETEPIKVNMKHGMKLEKGEARNILEAASQGASASIPLVANIAVNLMAFLSLLAFFNAALSWLGNMFDYPQ-LSFEVICSYVFMPFSFMMGVDWEDSFIVGKLIGYKTFFNEFVAYEYLAGLINKRK 447          

HSP 2 Score: 57.7658 bits (138), Expect = 3.228e-42
Identity = 30/64 (46.88%), Postives = 42/64 (65.62%), Query Frame = 2
Query:  668 SDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLL 859
            S RS  IATY LCGF N  S+G+ +G L ++AP R  DI+S    +++AG +   +T CIAG+L
Sbjct:  462 SIRSETIATYALCGFANFGSLGITIGGLSSMAPSRKGDIASGAIRAMIAGTVACFMTACIAGIL 525          
BLAST of slc28a-2 vs. Ensembl Mouse
Match: Slc28a2 (solute carrier family 28 (sodium-coupled nucleoside transporter), member 2 [Source:MGI Symbol;Acc:MGI:1913105])

HSP 1 Score: 139.043 bits (349), Expect = 1.482e-45
Identity = 68/159 (42.77%), Postives = 106/159 (66.67%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNW 587
            I A+ L++AS+M AP +LA+SKLVYPE + S   S +  K+P     N++EA +  A D+  L+A VA NL+ F+ +L+F+N+ L W+G  + + H LSF+ ICSY+  P+ F++G+ + DC  VAE+ G+K F+NEF+AYQ+L +   NK++     W
Sbjct:  359 IDASSLISASVMAAPCALALSKLVYPEVEESKFKSKEGLKLPRGEERNILEAASNGATDAISLVANVAANLIAFLAVLAFINATLSWLGEMVDI-HGLSFQVICSYVLRPMVFMMGVQWADCPLVAEIVGVKFFINEFVAYQQL-SQYKNKRLSGVEEW 515          

HSP 2 Score: 63.5438 bits (153), Expect = 1.482e-45
Identity = 34/89 (38.20%), Postives = 54/89 (60.67%), Query Frame = 2
Query:  632 WIE*NCPKEWNNSDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEEKK*NSLCLLF 898
            WI  N  K+W  S ++ +I T+ LCGF N++S+G+ LG L ++ P R  D+  I+  +L  G  VS I+ C+AG+LY  +   + C+ F
Sbjct:  515 WI--NGEKQWI-SVKAEIITTFSLCGFANLSSIGITLGGLTSMIPQRKSDLCKIVVRALFTGACVSFISACMAGILYVPRGAETDCVSF 600          
BLAST of slc28a-2 vs. Ensembl Mouse
Match: Slc28a2 (solute carrier family 28 (sodium-coupled nucleoside transporter), member 2 [Source:MGI Symbol;Acc:MGI:1913105])

HSP 1 Score: 139.043 bits (349), Expect = 1.482e-45
Identity = 68/159 (42.77%), Postives = 106/159 (66.67%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNW 587
            I A+ L++AS+M AP +LA+SKLVYPE + S   S +  K+P     N++EA +  A D+  L+A VA NL+ F+ +L+F+N+ L W+G  + + H LSF+ ICSY+  P+ F++G+ + DC  VAE+ G+K F+NEF+AYQ+L +   NK++     W
Sbjct:  359 IDASSLISASVMAAPCALALSKLVYPEVEESKFKSKEGLKLPRGEERNILEAASNGATDAISLVANVAANLIAFLAVLAFINATLSWLGEMVDI-HGLSFQVICSYVLRPMVFMMGVQWADCPLVAEIVGVKFFINEFVAYQQL-SQYKNKRLSGVEEW 515          

HSP 2 Score: 63.5438 bits (153), Expect = 1.482e-45
Identity = 34/89 (38.20%), Postives = 54/89 (60.67%), Query Frame = 2
Query:  632 WIE*NCPKEWNNSDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEEKK*NSLCLLF 898
            WI  N  K+W  S ++ +I T+ LCGF N++S+G+ LG L ++ P R  D+  I+  +L  G  VS I+ C+AG+LY  +   + C+ F
Sbjct:  515 WI--NGEKQWI-SVKAEIITTFSLCGFANLSSIGITLGGLTSMIPQRKSDLCKIVVRALFTGACVSFISACMAGILYVPRGAETDCVSF 600          
BLAST of slc28a-2 vs. Ensembl Mouse
Match: Slc28a2 (solute carrier family 28 (sodium-coupled nucleoside transporter), member 2 [Source:MGI Symbol;Acc:MGI:1913105])

HSP 1 Score: 139.043 bits (349), Expect = 1.482e-45
Identity = 68/159 (42.77%), Postives = 106/159 (66.67%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNW 587
            I A+ L++AS+M AP +LA+SKLVYPE + S   S +  K+P     N++EA +  A D+  L+A VA NL+ F+ +L+F+N+ L W+G  + + H LSF+ ICSY+  P+ F++G+ + DC  VAE+ G+K F+NEF+AYQ+L +   NK++     W
Sbjct:  359 IDASSLISASVMAAPCALALSKLVYPEVEESKFKSKEGLKLPRGEERNILEAASNGATDAISLVANVAANLIAFLAVLAFINATLSWLGEMVDI-HGLSFQVICSYVLRPMVFMMGVQWADCPLVAEIVGVKFFINEFVAYQQL-SQYKNKRLSGVEEW 515          

HSP 2 Score: 63.5438 bits (153), Expect = 1.482e-45
Identity = 34/89 (38.20%), Postives = 54/89 (60.67%), Query Frame = 2
Query:  632 WIE*NCPKEWNNSDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEEKK*NSLCLLF 898
            WI  N  K+W  S ++ +I T+ LCGF N++S+G+ LG L ++ P R  D+  I+  +L  G  VS I+ C+AG+LY  +   + C+ F
Sbjct:  515 WI--NGEKQWI-SVKAEIITTFSLCGFANLSSIGITLGGLTSMIPQRKSDLCKIVVRALFTGACVSFISACMAGILYVPRGAETDCVSF 600          
BLAST of slc28a-2 vs. Ensembl Mouse
Match: Slc28a3 (solute carrier family 28 (sodium-coupled nucleoside transporter), member 3 [Source:MGI Symbol;Acc:MGI:2137361])

HSP 1 Score: 138.272 bits (347), Expect = 2.204e-45
Identity = 68/152 (44.74%), Postives = 99/152 (65.13%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQ 566
            + + HLLTAS+M AP +LA++KL +PET+    T     K+ +    N++EA ++ A  S  L+A +A NL+ F+ LLSFVNS L W G+       LSFE ICSY+F P +F++G+D++D F VA+L G K F NEF+AY  L  +IN ++
Sbjct:  399 VSSTHLLTASVMSAPAALAVAKLFWPETEKPKITLKSAMKMENGDSRNLLEAASQGASSSIPLVANIAANLIAFLALLSFVNSALSWFGSMFNYPE-LSFELICSYIFMPFSFMMGVDWQDSFMVAKLIGYKTFFNEFVAYDHLSKLINLRK 549          

HSP 2 Score: 63.5438 bits (153), Expect = 2.204e-45
Identity = 31/62 (50.00%), Postives = 43/62 (69.35%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLL 859
            RS  IATY LCGF N  S+G+++G L +IAP R +DI+S    +L+AG +   +T CIAG+L
Sbjct:  566 RSETIATYALCGFANFGSLGIVIGGLTSIAPSRKRDIASGAMRALIAGTIACFMTACIAGIL 627          
BLAST of slc28a-2 vs. Ensembl Mouse
Match: Slc28a1 (solute carrier family 28 (sodium-coupled nucleoside transporter), member 1 [Source:MGI Symbol;Acc:MGI:3605073])

HSP 1 Score: 132.88 bits (333), Expect = 2.668e-45
Identity = 68/159 (42.77%), Postives = 105/159 (66.04%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNW 587
            I A+ L+ AS+M AP +LA+SKLVYPE + S   S +  K+      N++EA +  A  S  ++A +A NL+ F+ +L+F+N+ L W+G+ + +   LSF+ ICSY+  P+AFL+G+ + DC  VAEL GIK+FLNEF+AYQ+L +    +++  A  W
Sbjct:  362 IDASSLIAASVMAAPCALALSKLVYPEVEESKFRSEEGVKLTYGDAQNLVEAASAGAAISVKVVANIAANLIAFLAVLAFINAALSWLGDMVDIQG-LSFQLICSYVLRPVAFLMGVAWEDCPVVAELLGIKLFLNEFVAYQEL-SQYKQRRLAGAEEW 518          

HSP 2 Score: 68.9366 bits (167), Expect = 2.668e-45
Identity = 31/70 (44.29%), Postives = 47/70 (67.14%), Query Frame = 2
Query:  653 KEWNNSDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLY 862
            K+W  S R+ ++ TY LCGF N +S+G++LG L ++ P R  D S I+  +L+ G  VSL+  C+AG+LY
Sbjct:  523 KQWI-SVRAEILTTYALCGFANFSSIGIMLGGLTSMVPQRRSDFSQIVLRALITGAFVSLVNACVAGILY 591          
BLAST of slc28a-2 vs. UniProt/SwissProt
Match: sp|Q9UA35|S28A3_EPTST (Solute carrier family 28 member 3 OS=Eptatretus stoutii OX=7765 GN=SLC28A3 PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 9.913e-48
Identity = 71/154 (46.10%), Postives = 103/154 (66.88%), Query Frame = 3
Query:  105 LKIPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQ 566
            L IPA HLLTAS+M AP +LAISK  +PETK S  ++    K+     NN++EA ++ A  +  L+A +A NL+ F+ +L+F+N+ L W+G+        SFE ICSY+  P AF++G++Y D F VAEL G+K F NEF+AYQ+L   I+N++
Sbjct:  377 LGIPAAHLLTASVMSAPAALAISKTFWPETKKSKNSTQTSIKLEKGQENNLVEAASQGASAAVPLVANIAANLIAFLAVLAFINATLSWLGSMFNYPQ-FSFEIICSYVLMPFAFMMGVNYDDSFLVAELLGMKTFFNEFVAYQRLSEYIHNRE 529          

HSP 2 Score: 65.855 bits (159), Expect = 9.913e-48
Identity = 32/63 (50.79%), Postives = 43/63 (68.25%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLY 862
            RS  IATY LCGF N  S+G+++G L ++APHR  DI+S    +L+AG +    T CIAG+LY
Sbjct:  546 RSEAIATYALCGFANFGSLGIMIGGLSSLAPHRKSDIASCGIRALIAGTIACFSTACIAGVLY 608          
BLAST of slc28a-2 vs. UniProt/SwissProt
Match: sp|O43868|S28A2_HUMAN (Sodium/nucleoside cotransporter 2 OS=Homo sapiens OX=9606 GN=SLC28A2 PE=2 SV=2)

HSP 1 Score: 136.732 bits (343), Expect = 7.919e-47
Identity = 67/159 (42.14%), Postives = 104/159 (65.41%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNW 587
            + A+ L++AS+M AP +LA SKL YPE + S   S +  K+P     NV+EA +  A+D+ GL   VA NL+ F+ +L+F+N+ L W+G  + +   L+F+ ICSYL  P+ F++G+++ DC  VAE+ GIK F+NEF+AYQ+L +   NK++     W
Sbjct:  357 VDASSLISASVMAAPCALASSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLATNVAANLIAFLAVLAFINAALSWLGELVDIQG-LTFQVICSYLLRPMVFMMGVEWTDCPMVAEMVGIKFFINEFVAYQQL-SQYKNKRLSGMEEW 513          

HSP 2 Score: 72.7886 bits (177), Expect = 7.919e-47
Identity = 41/97 (42.27%), Postives = 60/97 (61.86%), Query Frame = 2
Query:  632 WIE*NCPKEWNNSDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEEKK*NSLCLLF--TKFCAR 916
            WIE    K+W  S R+ +I T+ LCGF N++S+G+ LG L +I PHR  D+S ++  +L  G  VSLI+ C+AG+LY  +   + C+ F  T F  R
Sbjct:  513 WIE--GEKQWI-SVRAEIITTFSLCGFANLSSIGITLGGLTSIVPHRKSDLSKVVVRALFTGACVSLISACMAGILYVPRGAEADCVSFPNTSFTNR 606          
BLAST of slc28a-2 vs. UniProt/SwissProt
Match: sp|Q9MZT2|S28A1_RABIT (Sodium/nucleoside cotransporter 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC28A1 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 3.513e-46
Identity = 67/159 (42.14%), Postives = 106/159 (66.67%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNW 587
            I A+ L++AS+MGAP +LA+SKLVYPE + S   S +  K+P    +NV+EA +  A D+  L+A VA NL+ F+ +L+F+N+ L W+G  + +   L+F+ ICSY+  P+ +++G+++ DC  VAE+ GIK F NEF+AYQ+L +    K++     W
Sbjct:  357 IDASSLISASVMGAPCALALSKLVYPEEEESKFKSKEGVKLPRGKESNVLEAASNGATDAIALVANVAANLVAFLAVLAFINAALSWLGELVDIQG-LTFQVICSYILRPMVYMMGVEWTDCPMVAEMVGIKFFTNEFVAYQQL-SQYKKKRLSGMEEW 513          

HSP 2 Score: 71.2478 bits (173), Expect = 3.513e-46
Identity = 39/98 (39.80%), Postives = 60/98 (61.22%), Query Frame = 2
Query:  632 WIE*NCPKEWNNSDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEEKK*NSLCLLF--TKFCARD 919
            WI  +  K+W  S R+ VI T+ LCGF N++S+G+ LG L ++ PHR  D+S ++  +L  G+ VS I+ C+AG+LY  +   + C+ F  T F  R 
Sbjct:  513 WI--DGQKQWI-SVRAEVITTFSLCGFANLSSIGITLGGLTSMVPHRKSDLSKVVIRALFTGSCVSFISACVAGILYVPRGAETDCVSFLSTSFTNRS 607          
BLAST of slc28a-2 vs. UniProt/SwissProt
Match: sp|Q9HAS3|S28A3_HUMAN (Solute carrier family 28 member 3 OS=Homo sapiens OX=9606 GN=SLC28A3 PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 8.443e-46
Identity = 69/152 (45.39%), Postives = 100/152 (65.79%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQ 566
            +P++HLLTAS+M AP SLA +KL +PET+    T  +  K+      N++EA T+ A  S  L+A +A+NL+ F+ LLSF+NS L W GN       LSFE ICSY+F P +F++G++++D F VA L G K F NEF+AY+ L   I+ ++
Sbjct:  384 VPSSHLLTASVMSAPASLAAAKLFWPETEKPKITLKNAMKMESGDSGNLLEAATQGASSSISLVANIAVNLIAFLALLSFMNSALSWFGNMFDYPQ-LSFELICSYIFMPFSFMMGVEWQDSFMVARLIGYKTFFNEFVAYEHLSKWIHLRK 534          

HSP 2 Score: 64.6994 bits (156), Expect = 8.443e-46
Identity = 31/62 (50.00%), Postives = 45/62 (72.58%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLL 859
            RS +IATY LCGF NI S+G+++G L ++AP R +DI+S    +L+AG +   +T CIAG+L
Sbjct:  551 RSEIIATYALCGFANIGSLGIVIGGLTSMAPSRKRDIASGAVRALIAGTVACFMTACIAGIL 612          
BLAST of slc28a-2 vs. UniProt/SwissProt
Match: sp|Q8VIH3|S28A3_RAT (Solute carrier family 28 member 3 OS=Rattus norvegicus OX=10116 GN=Slc28a3 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 2.645e-45
Identity = 69/152 (45.39%), Postives = 100/152 (65.79%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQ 566
            + + HLLTAS+M AP +LA++KL +PET+    T  +  K+ +    N++EA T+ A  S  L+A +A NL+ F+ LLSFVNS L W G+       LSFE ICSY+F P +F++G+D++D F VA+L G K F NEF+AY+ L   IN ++
Sbjct:  401 VSSTHLLTASVMSAPAALAVAKLFWPETEKPKITLKNAMKMENGDSRNLLEAATQGASSSIPLVANIAANLIAFLALLSFVNSALSWFGSMFDYPQ-LSFELICSYIFMPFSFMMGVDWQDRFMVAKLIGYKTFFNEFVAYEHLSKFINLRK 551          

HSP 2 Score: 64.3142 bits (155), Expect = 2.645e-45
Identity = 31/62 (50.00%), Postives = 43/62 (69.35%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLL 859
            RS  IATY LCGF N  S+G+++G L +IAP R +DI+S    +L+AG +   +T CIAG+L
Sbjct:  568 RSETIATYALCGFANFGSLGIVIGGLTSIAPSRKRDIASGAMRALIAGTIACFMTACIAGML 629          
BLAST of slc28a-2 vs. TrEMBL
Match: A0A0H3YFH6 (Slc28a-2 OS=Schmidtea mediterranea OX=79327 GN=slc28a-2 PE=2 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 4.330e-129
Identity = 199/199 (100.00%), Postives = 199/199 (100.00%), Query Frame = 3
Query:  144 MGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNWSITTAEQMGDDLVLFGLNKTVLKNGXXXXXXXXXXXXFFAVLEILRLLECY 740
            MGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNWSITTAEQMGDDLVLFGLNKTVLKNGIILIVQLLLQHIFFAVLEILRLLECY
Sbjct:    1 MGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNWSITTAEQMGDDLVLFGLNKTVLKNGIILIVQLLLQHIFFAVLEILRLLECY 199          
BLAST of slc28a-2 vs. TrEMBL
Match: A0A0H3YJA0 (Slc28a-1 OS=Schmidtea mediterranea OX=79327 GN=slc28a-1 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 8.826e-66
Identity = 91/178 (51.12%), Postives = 131/178 (73.60%), Query Frame = 3
Query:  114 PANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNWSITTAEQMGDDLVLFGLNKT 647
            PANHL++AS+M AP +LA+SKL+ PETK S  T  D++ +P S Y N++EA T  A DS  L+A +A+NL+ F+ +L+F N+ LKWIG  +C++ ILSFE ICSY+FWP+A  +G+  +DC K+AEL GIK FLNEFIAY++LG +INN++IYD++N ++       DD+ ++  N T
Sbjct:  384 PANHLISASVMSAPAALAVSKLMCPETKKSKNTKKDLKYLPKSPYKNIVEATTAGASDSIPLVANIAVNLIAFVAILAFFNATLKWIGERICMSRILSFELICSYIFWPLALSMGVYIQDCRKIAELMGIKTFLNEFIAYERLGILINNRKIYDSLNKTLEKTIVQNDDIFIYYQNGT 561          

HSP 2 Score: 78.1814 bits (191), Expect = 8.826e-66
Identity = 35/67 (52.24%), Postives = 47/67 (70.15%), Query Frame = 2
Query:  668 SDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEE 868
             +RSVVIATY LCGF N  S+G+LL  L  + PHR  D+S +I  +++AGN+   +T CIAGL Y+E
Sbjct:  572 QNRSVVIATYALCGFANFGSMGILLSSLSTMIPHRRPDLSKLIVRAMIAGNIACFLTACIAGLFYKE 638          
BLAST of slc28a-2 vs. TrEMBL
Match: A0A0H3YKD8 (Slc28a-3 OS=Schmidtea mediterranea OX=79327 GN=slc28a-3 PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 3.702e-63
Identity = 88/178 (49.44%), Postives = 126/178 (70.79%), Query Frame = 3
Query:  114 PANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNWSITTAEQMGDDLVLFGLNKT 647
            PANHL++AS+M AP +LAISKL+YPETK S  T  D+R +P S Y N++EA T  A +S  L+A +A+NL+ F+ +L+F+NSIL W+G   C++  LSFE +CS+ FWP++  +G+   DC KVAEL G+K FLNEFIA+QKLG +++N++I D+VN +        DD+ +   N T
Sbjct:  385 PANHLISASVMSAPAALAISKLMYPETKKSKNTKKDIRNLPKSPYKNIVEATTAGASESIPLVANIAVNLIAFVAILAFLNSILAWLGERACMSKKLSFELLCSFFFWPLSLFMGVHIGDCRKVAELIGVKTFLNEFIAFQKLGILLSNRKILDSVNQTFAKVAYGYDDVFIHYNNGT 562          

HSP 2 Score: 78.5666 bits (192), Expect = 3.702e-63
Identity = 36/68 (52.94%), Postives = 47/68 (69.12%), Query Frame = 2
Query:  665 NSDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEE 868
              +RSVVIATY LCGF N  SVG+LL  L  + PHR  D+S +I  +++AGN+   +T CIAGL Y+E
Sbjct:  572 QQNRSVVIATYALCGFANFGSVGILLSSLGTMIPHRRSDLSKMIIRAMIAGNIACFLTACIAGLFYKE 639          
BLAST of slc28a-2 vs. TrEMBL
Match: A0A1S3K8G4 (Sodium/nucleoside cotransporter OS=Lingula unguis OX=7574 GN=LOC106179738 PE=3 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 1.263e-59
Identity = 88/181 (48.62%), Postives = 128/181 (70.72%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNWSITTAEQMGDDLVLFGLNKTVL 653
            +PANHLL+AS+M AP +LA++KL YPET+ S+TT AD++ I  S   N ++A +  A +S  L+A +A+NL+ F+ LL FVN  L W+GN + L   L+ + ICSY+ WP AF++G D  DC KVAEL GIK  +NEF AY++LG +INN+++Y+  N ++    + GDDL L G+NKT++
Sbjct:  436 VPANHLLSASVMSAPAALAMAKLFYPETRVSITTMADIKNIEKSPERNALQAASNGASNSVKLVANIAVNLIAFLALLDFVNGTLTWMGNRVGLEK-LTVQIICSYVLWPFAFVMGTDTVDCRKVAELIGIKTLVNEFAAYEELGVLINNRKVYNTYNGTVI---ENGDDLFLEGINKTLI 612          

HSP 2 Score: 75.0998 bits (183), Expect = 1.263e-59
Identity = 31/65 (47.69%), Postives = 45/65 (69.23%), Query Frame = 2
Query:  671 DRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYE 865
            +RS VI+TY LCGF N +S+G++LG    +AP R  D + ++  +++AGN+ S  T CIAGL YE
Sbjct:  618 ERSEVISTYALCGFANFSSIGIMLGAFAAMAPRRKSDCAKVVVRAMIAGNVASFTTACIAGLFYE 682          
BLAST of slc28a-2 vs. TrEMBL
Match: A0A1S3HW29 (Sodium/nucleoside cotransporter OS=Lingula unguis OX=7574 GN=LOC106158708 PE=3 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 1.430e-59
Identity = 88/181 (48.62%), Postives = 128/181 (70.72%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNWSITTAEQMGDDLVLFGLNKTVL 653
            +PANHLL+AS+M AP +LA++KL YPET+ S+TT AD++ I  S   N ++A +  A +S  L+A +A+NL+ F+ LL FVN  L W+GN + L   L+ + ICSY+ WP AF++G D  DC KVAEL GIK  +NEF AY++LG +INN+++Y+  N ++    + GDDL L G+NKT++
Sbjct:  417 VPANHLLSASVMSAPAALAMAKLFYPETRVSITTMADIKNIEKSPERNALQAASNGASNSVKLVANIAVNLIAFLALLDFVNGTLTWMGNRVGLEK-LTVQIICSYVLWPFAFVMGTDTVDCRKVAELIGIKTLVNEFAAYEELGVLINNRKVYNTYNGTVI---ENGDDLFLEGINKTLI 593          

HSP 2 Score: 75.0998 bits (183), Expect = 1.430e-59
Identity = 31/65 (47.69%), Postives = 45/65 (69.23%), Query Frame = 2
Query:  671 DRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYE 865
            +RS VI+TY LCGF N +S+G++LG    +AP R  D + ++  +++AGN+ S  T CIAGL YE
Sbjct:  599 ERSEVISTYALCGFANFSSIGIMLGAFAAMAPRRKSDCAKVVVRAMIAGNVASFTTACIAGLFYE 663          
BLAST of slc28a-2 vs. Ensembl Cavefish
Match: slc28a1 (sodium/nucleoside cotransporter 2 [Source:NCBI gene;Acc:103041999])

HSP 1 Score: 130.954 bits (328), Expect = 6.390e-44
Identity = 70/151 (46.36%), Postives = 101/151 (66.89%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNK 563
            I A+ L++AS+M AP +LA++KL YPET+ S   S    K+      N++EA +  A  S GL+A +A NL+ F+ +L F+N+ LKW+G  +    I +FE ICSY+F P+AF++GI   + F VAEL G K+FLNEFIAY+KL  + NN+
Sbjct:  354 IDASSLISASVMAAPCALAVAKLSYPETEESKFKSKANIKVDGGGEQNILEAASAGASASIGLVANIAANLIAFLAILDFINAALKWLGGMVGYPDI-TFEIICSYVFMPVAFMMGIPVEESFTVAELIGTKLFLNEFIAYEKLSKLKNNR 503          

HSP 2 Score: 65.855 bits (159), Expect = 6.390e-44
Identity = 32/65 (49.23%), Postives = 46/65 (70.77%), Query Frame = 2
Query:  668 SDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLY 862
            S RS +I+TY LCGF N +S+G+++G L +I P R  DIS+++  +L  G  VSLI  C+AGLL+
Sbjct:  515 SVRSEIISTYALCGFANFSSLGIVIGGLSSICPSRKSDISALVLRALFTGTCVSLINACVAGLLF 579          
BLAST of slc28a-2 vs. Ensembl Sea Lamprey
Match: SLC28A3 (solute carrier family 28 member 3 [Source:HGNC Symbol;Acc:HGNC:16484])

HSP 1 Score: 146.362 bits (368), Expect = 1.935e-49
Identity = 71/151 (47.02%), Postives = 102/151 (67.55%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNK 563
            +PA HLLTAS+M AP +LAISK+ +PET+ S        K+   T +N++EA +  A  S  L+A +A NL+ F+ LL+F+N+IL W+G        LSFE ICSY+F P+AF++G+D+ D F VAEL G+K F NEF+AY++L  +I  +
Sbjct:  371 VPAAHLLTASVMSAPAALAISKVFWPETQKSKFKVKGSLKLEKGTESNLVEAASHGASASIPLVANIAANLIAFLALLAFINAILSWLGGMFNYPD-LSFELICSYVFMPLAFMMGVDWADAFMVAELLGVKTFFNEFVAYERLSLLIKAR 520          

HSP 2 Score: 67.0106 bits (162), Expect = 1.935e-49
Identity = 31/68 (45.59%), Postives = 46/68 (67.65%), Query Frame = 2
Query:  668 SDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEEK 871
            S RS  IATY LCGF N+ S+G+++G L ++APHR  DI+     +L++G +   +T CIAG+LY  +
Sbjct:  536 SVRSEAIATYALCGFANLGSIGIMIGGLSSMAPHRRSDIAKCAVRALISGTVACFMTACIAGILYTPQ 603          
BLAST of slc28a-2 vs. Ensembl Nematostella
Match: EDO31905 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWL3])

HSP 1 Score: 133.265 bits (334), Expect = 7.420e-42
Identity = 72/151 (47.68%), Postives = 106/151 (70.20%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNK 563
            + A+HLL+AS+M AP +LAISKL+YPET++  T    +  +P+    NVIEA  + A  +  L+A VA NL+ F+  L+F N++L W+G S+  +  LSFE+ICSY+  P+A+L+G+ ++DC  VAEL GIK FLNEF+AY +L  +I N+
Sbjct:  281 VSASHLLSASVMSAPAALAISKLLYPETETPETIEEAI-DLPEGGERNVIEAAAKGASTAIALVANVAANLIAFLAFLAFFNAMLSWLG-SMVGHPELSFEFICSYVLRPVAYLMGVQWKDCDVVAELLGIKTFLNEFVAYIRLSALIKNR 429          

HSP 2 Score: 55.0694 bits (131), Expect = 7.420e-42
Identity = 26/60 (43.33%), Postives = 40/60 (66.67%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAG 853
            RS +I TY LCGF N +S+G+ +G L  +AP R +D++ I   +L+AG +   +T C+AG
Sbjct:  444 RSEIITTYALCGFANFSSIGIQIGGLGPMAPTRIRDMAKIAMRALLAGTIACFMTACVAG 503          
BLAST of slc28a-2 vs. Ensembl Nematostella
Match: EDO32279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVI0])

HSP 1 Score: 62.003 bits (149), Expect = 1.325e-17
Identity = 24/56 (42.86%), Postives = 39/56 (69.64%), Query Frame = 3
Query:  411 EYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDA 578
            + ICSY+F P+AF++G+++ DC  VA+  GIK+FLNE I+Y  +   I ++ + D 
Sbjct:   17 QTICSYVFMPLAFVMGVEWADCGPVAKFLGIKVFLNELISYINMSPFIKDRDLKDG 72          

HSP 2 Score: 44.669 bits (104), Expect = 1.325e-17
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAG 853
            +S +IATY LCGF N   +G+LLG L  +AP+R  D++ +   SLVA N+   +T  IAG
Sbjct:   79 QSEIIATYALCGFSNFLGLGVLLGGLGPMAPNRRGDMAKLAIRSLVAANIACFMTASIAG 138          
BLAST of slc28a-2 vs. Ensembl Nematostella
Match: EDO29843 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2H3])

HSP 1 Score: 61.6178 bits (148), Expect = 2.091e-17
Identity = 24/56 (42.86%), Postives = 39/56 (69.64%), Query Frame = 3
Query:  411 EYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDA 578
            + ICSY+F P+AF++G+++ DC  VA+  GIK+FLNE I+Y  +   I ++ + D 
Sbjct:   17 QTICSYVFMPLAFVMGVEWADCGPVAKFLGIKVFLNELISYINMSPFIKDRDLKDG 72          

HSP 2 Score: 44.669 bits (104), Expect = 2.091e-17
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAG 853
            +S +IATY LCGF N   +G+LLG L  +AP+R  D++ +   SLVA N+   +T  IAG
Sbjct:   79 QSEIIATYALCGFSNFLGLGVLLGGLGPMAPNRRGDMAKLAIRSLVASNIACFMTASIAG 138          
BLAST of slc28a-2 vs. Ensembl Nematostella
Match: EDO42082 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2R0])

HSP 1 Score: 69.707 bits (169), Expect = 3.166e-13
Identity = 32/65 (49.23%), Postives = 45/65 (69.23%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEE 868
            RS +I+TY LCGF N+ S+G+ LG L  +APHR  D+S I   +L AG +   +T C+AG+LY+E
Sbjct:   69 RSEIISTYALCGFANLGSIGVQLGGLGPMAPHRVTDMSKIAIRALFAGTIACFMTACVAGVLYDE 133          

HSP 2 Score: 62.003 bits (149), Expect = 1.053e-10
Identity = 29/60 (48.33%), Postives = 40/60 (66.67%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAG 853
            RS +I+TY LCGF N+ S+G+ LG L  +APHR  D+S I   +L AG +   +T C+AG
Sbjct:    6 RSEIISTYALCGFANLGSIGVQLGGLGPMAPHRVTDMSKIAIRALFAGTIACFMTACVAG 65          
BLAST of slc28a-2 vs. Ensembl Nematostella
Match: EDO31906 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWL4])

HSP 1 Score: 67.0106 bits (162), Expect = 2.045e-12
Identity = 31/65 (47.69%), Postives = 44/65 (67.69%), Query Frame = 2
Query:  674 RSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEE 868
            RS +I+TY LCGF N+  +G+ LG L  +APHR  D+S I   +L AG +   +T C+AG+LY+E
Sbjct:  374 RSEIISTYALCGFANLGFIGVQLGGLGPMAPHRVTDMSKIAIRALFAGTIACFMTACVAGVLYDE 438          
BLAST of slc28a-2 vs. Ensembl Medaka
Match: slc28a1 (solute carrier family 28 member 1 [Source:NCBI gene;Acc:101157695])

HSP 1 Score: 129.413 bits (324), Expect = 5.895e-44
Identity = 68/151 (45.03%), Postives = 101/151 (66.89%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNK 563
            I A+ L++AS+M AP +LAISKL YPET+ S   +    K+      N++EA +  A  S GL+A +A NL+ F+ +L+F+N  L W+G  +    I +F+ ICSY+F P+AF++GI Y + F VAEL G K+FLNEF+AY+KL  + +N+
Sbjct:  355 IDASSLISASVMAAPCALAISKLSYPETEESPFKAEKNIKVACGDEQNILEAASSGASASIGLVANIAANLIAFLAILAFINQALSWLGGMVGYPEI-TFQLICSYVFMPVAFMMGIPYDESFTVAELIGTKVFLNEFVAYEKLSELKSNR 504          

HSP 2 Score: 67.781 bits (164), Expect = 5.895e-44
Identity = 33/70 (47.14%), Postives = 50/70 (71.43%), Query Frame = 2
Query:  653 KEWNNSDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLY 862
            ++W  S RS +I TY LCGF N +S+G+++G L +I+P R  DISS++  +++ G  VSLI  C+AGLL+
Sbjct:  516 RQWI-SVRSEIITTYALCGFANFSSLGIVIGGLSSISPSRRSDISSLVLRAMITGTCVSLINACVAGLLF 584          
BLAST of slc28a-2 vs. Ensembl Medaka
Match: SLC28A3 (solute carrier family 28 member 3 [Source:NCBI gene;Acc:101171996])

HSP 1 Score: 127.487 bits (319), Expect = 5.688e-43
Identity = 63/154 (40.91%), Postives = 97/154 (62.99%), Query Frame = 3
Query:  105 LKIPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQ 566
            L + A HLLTAS+M AP SLAI+K  +PE   ++  S    K+ +    N++EA ++ A  +  L+  +  N++ F+ LL+F++ IL W+G        LSF  ICSY+F P++F++G+ + D F VAEL G+K FLNEF+AYQ+L   I  ++
Sbjct:  321 LGVDATHLLTASLMSAPASLAIAKTFWPERNKTVLISIKDLKLINGENKNLLEAASQGASRTVRLVGSIITNIIAFLALLAFLDCILSWLGGLFDYPQ-LSFSLICSYVFMPLSFMMGVSWDDSFLVAELIGLKTFLNEFVAYQRLSEFIKRRE 473          

HSP 2 Score: 66.6254 bits (161), Expect = 5.688e-43
Identity = 33/65 (50.77%), Postives = 46/65 (70.77%), Query Frame = 2
Query:  668 SDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLY 862
            S  S +IATY LCGF NIAS+GM +G L  +AP++  DIS +   +L+AG++   +T CIAG+LY
Sbjct:  488 SVHSEMIATYALCGFSNIASLGMSIGALTAMAPNKRSDISRVGLRALIAGSVACFMTACIAGMLY 552          
BLAST of slc28a-2 vs. Planmine SMEST
Match: SMESG000077408.1 (SMESG000077408.1)

HSP 1 Score: 374.785 bits (961), Expect = 8.783e-139
Identity = 184/184 (100.00%), Postives = 184/184 (100.00%), Query Frame = 3
Query:  111 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNWSITTAEQMGDDLVLFGLNKTVLKNG 662
            IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNWSITTAEQMGDDLVLFGLNKTVLKNG
Sbjct:  380 IPANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNWSITTAEQMGDDLVLFGLNKTVLKNG 563          

HSP 2 Score: 138.272 bits (347), Expect = 8.783e-139
Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 2
Query:  668 SDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEEKK 874
            SDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEEKK
Sbjct:  567 SDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEEKK 635          
BLAST of slc28a-2 vs. Planmine SMEST
Match: SMESG000057282.1 (SMESG000057282.1)

HSP 1 Score: 202.601 bits (514), Expect = 4.581e-69
Identity = 91/178 (51.12%), Postives = 131/178 (73.60%), Query Frame = 3
Query:  114 PANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNWSITTAEQMGDDLVLFGLNKT 647
            PANHL++AS+M AP +LA+SKL+ PETK S  T  D++ +P S Y N++EA T  A DS  L+A +A+NL+ F+ +L+F N+ LKWIG  +C++ ILSFE ICSY+FWP+A  +G+  +DC K+AEL GIK FLNEFIAY++LG +INN++IYD++N ++       DD+ ++  N T
Sbjct:  384 PANHLISASVMSAPAALAVSKLMCPETKKSKNTKKDLKYLPKSPYKNIVEATTAGASDSIPLVANIAVNLIAFVAILAFFNATLKWIGERICMSRILSFELICSYIFWPLALSMGVYIQDCRKIAELMGIKTFLNEFIAYERLGILINNRKIYDSLNKTLEKTIVQNDDIFIYYQNGT 561          

HSP 2 Score: 78.1814 bits (191), Expect = 4.581e-69
Identity = 35/67 (52.24%), Postives = 47/67 (70.15%), Query Frame = 2
Query:  668 SDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEE 868
             +RSVVIATY LCGF N  S+G+LL  L  + PHR  D+S +I  +++AGN+   +T CIAGL Y+E
Sbjct:  572 QNRSVVIATYALCGFANFGSMGILLSSLSTMIPHRRPDLSKLIVRAMIAGNIACFLTACIAGLFYKE 638          
BLAST of slc28a-2 vs. Planmine SMEST
Match: SMESG000057286.1 (SMESG000057286.1)

HSP 1 Score: 193.356 bits (490), Expect = 2.194e-66
Identity = 88/178 (49.44%), Postives = 126/178 (70.79%), Query Frame = 3
Query:  114 PANHLLTASIMGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSAGLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPIAFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNWSITTAEQMGDDLVLFGLNKT 647
            PANHL++AS+M AP +LAISKL+YPETK S  T  D+R +P S Y N++EA T  A +S  L+A +A+NL+ F+ +L+F+NSIL W+G   C++  LSFE +CS+ FWP++  +G+   DC KVAEL G+K FLNEFIA+QKLG +++N++I D+VN +        DD+ +   N T
Sbjct:  385 PANHLISASVMSAPAALAISKLMYPETKKSKNTKKDIRNLPKSPYKNIVEATTAGASESIPLVANIAVNLIAFVAILAFLNSILAWLGERACMSKKLSFELLCSFFFWPLSLFMGVHIGDCRKVAELIGVKTFLNEFIAFQKLGILLSNRKILDSVNQTFAKVAYGYDDVFIHYNNGT 562          

HSP 2 Score: 78.5666 bits (192), Expect = 2.194e-66
Identity = 36/68 (52.94%), Postives = 47/68 (69.12%), Query Frame = 2
Query:  665 NSDRSVVIATYILCGFGNIASVGMLLGVLINIAPHRSKDISSIIPISLVAGNMVSLITGCIAGLLYEE 868
              +RSVVIATY LCGF N  SVG+LL  L  + PHR  D+S +I  +++AGN+   +T CIAGL Y+E
Sbjct:  572 QQNRSVVIATYALCGFANFGSVGILLSSLGTMIPHRRSDLSKMIIRAMIAGNIACFLTACIAGLFYKE 639          
The following BLAST results are available for this feature:
BLAST of slc28a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC28A21.857e-4742.14solute carrier family 28 member 2 [Source:HGNC Sym... [more]
SLC28A31.980e-4645.39solute carrier family 28 member 3 [Source:HGNC Sym... [more]
SLC28A12.583e-4342.77solute carrier family 28 member 1 [Source:HGNC Sym... [more]
SLC28A12.583e-4342.77solute carrier family 28 member 1 [Source:HGNC Sym... [more]
SLC28A18.770e-1144.44solute carrier family 28 member 1 [Source:HGNC Sym... [more]
back to top
BLAST of slc28a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc-28.16.642e-2231.25Sodium/nucleoside cotransporter [Source:UniProtKB... [more]
slc-28.22.764e-1531.03Sodium/nucleoside cotransporter [Source:UniProtKB... [more]
slc-28.22.764e-1531.03Sodium/nucleoside cotransporter [Source:UniProtKB... [more]
slc-28.13.915e-834.72Sodium/nucleoside cotransporter [Source:UniProtKB... [more]
back to top
BLAST of slc28a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CNT25.303e-3335.76gene:FBgn0025709 transcript:FBtr0088562[more]
CNT25.303e-3335.76gene:FBgn0025709 transcript:FBtr0088560[more]
CNT25.347e-3335.76gene:FBgn0025709 transcript:FBtr0088561[more]
CNT16.092e-3135.10gene:FBgn0033371 transcript:FBtr0300173[more]
back to top
BLAST of slc28a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc28a12.037e-4448.34solute carrier family 28 member 1 [Source:ZFIN;Acc... [more]
slc28a13.881e-1741.28solute carrier family 28 member 1 [Source:ZFIN;Acc... [more]
slc28a13.921e-1741.28solute carrier family 28 member 1 [Source:ZFIN;Acc... [more]
slc28a13.921e-1741.28solute carrier family 28 member 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc28a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC28A31.651e-4242.76solute carrier family 28 (concentrative nucleoside... [more]
SLC28A32.523e-4242.76solute carrier family 28 (concentrative nucleoside... [more]
SLC28A32.977e-4242.76solute carrier family 28 (concentrative nucleoside... [more]
SLC28A33.147e-4242.76solute carrier family 28 (concentrative nucleoside... [more]
SLC28A33.228e-4242.76solute carrier family 28 (concentrative nucleoside... [more]
back to top
BLAST of slc28a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc28a21.482e-4542.77solute carrier family 28 (sodium-coupled nucleosid... [more]
Slc28a21.482e-4542.77solute carrier family 28 (sodium-coupled nucleosid... [more]
Slc28a21.482e-4542.77solute carrier family 28 (sodium-coupled nucleosid... [more]
Slc28a32.204e-4544.74solute carrier family 28 (sodium-coupled nucleosid... [more]
Slc28a12.668e-4542.77solute carrier family 28 (sodium-coupled nucleosid... [more]
back to top
BLAST of slc28a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UA35|S28A3_EPTST9.913e-4846.10Solute carrier family 28 member 3 OS=Eptatretus st... [more]
sp|O43868|S28A2_HUMAN7.919e-4742.14Sodium/nucleoside cotransporter 2 OS=Homo sapiens ... [more]
sp|Q9MZT2|S28A1_RABIT3.513e-4642.14Sodium/nucleoside cotransporter 1 OS=Oryctolagus c... [more]
sp|Q9HAS3|S28A3_HUMAN8.443e-4645.39Solute carrier family 28 member 3 OS=Homo sapiens ... [more]
sp|Q8VIH3|S28A3_RAT2.645e-4545.39Solute carrier family 28 member 3 OS=Rattus norveg... [more]
back to top
BLAST of slc28a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFH64.330e-129100.00Slc28a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YJA08.826e-6651.12Slc28a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YKD83.702e-6349.44Slc28a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A1S3K8G41.263e-5948.62Sodium/nucleoside cotransporter OS=Lingula unguis ... [more]
A0A1S3HW291.430e-5948.62Sodium/nucleoside cotransporter OS=Lingula unguis ... [more]
back to top
BLAST of slc28a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc28a16.390e-4446.36sodium/nucleoside cotransporter 2 [Source:NCBI gen... [more]
back to top
BLAST of slc28a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SLC28A31.935e-4947.02solute carrier family 28 member 3 [Source:HGNC Sym... [more]
back to top
BLAST of slc28a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc28a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO319057.420e-4247.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322791.325e-1742.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298432.091e-1742.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420823.166e-1349.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319062.045e-1247.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc28a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc28a15.895e-4445.03solute carrier family 28 member 1 [Source:NCBI gen... [more]
SLC28A35.688e-4340.91solute carrier family 28 member 3 [Source:NCBI gen... [more]
back to top
BLAST of slc28a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000077408.18.783e-139100.00SMESG000077408.1[more]
SMESG000057282.14.581e-6951.12SMESG000057282.1[more]
SMESG000057286.12.194e-6649.44SMESG000057286.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30025137
GenBankAKN21617.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025137 ID=SMED30025137|Name=slc28a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=959bp
AACCGGGAAAGGCCGAGCGAGCCCAGCTTCGAGTAATGCGAGTCAAACCG
AAGTTGGTTGATGAAGCACCAAAATTCACTTTTTGAAATCTACAATAAAA
ATAATTAAAGATTCCAGCTAATCATTTATTAACCGCTAGCATTATGGGAG
CCCCTGGATCTTTAGCAATATCAAAACTTGTGTATCCTGAAACCAAAAGT
TCTTTAACAACATCAGCAGATGTTAGAAAAATACCTGATAGTACTTATAA
TAATGTAATCGAAGCAATTACCGAAAGTGCTATAGACAGTGCTGGCTTGA
TTGCATGCGTTGCTCTTAATCTTTTAGTTTTCATTTGTCTTTTATCTTTT
GTGAATTCGATTTTGAAATGGATTGGGAACAGTTTATGCCTGAACCATAT
TTTATCTTTTGAATATATTTGTTCGTATTTATTCTGGCCCATCGCATTTT
TAATAGGAATAGATTATAGAGATTGCTTTAAAGTCGCAGAACTATTCGGT
ATTAAGATTTTCCTCAATGAATTTATTGCTTATCAAAAACTAGGTACTAT
GATAAATAATAAACAAATATATGATGCCGTGAATTGGTCAATAACAACAG
CTGAACAAATGGGAGATGATTTAGTGCTATTTGGATTGAATAAAACTGTC
CTAAAGAATGGAATAATTCTGATCGTTCAGTTGTTATTGCAACATATATT
CTTTGCGGTTTTGGAAATATTGCGTCTGTTGGAATGCTACTAGGAGTTTT
AATAAACATTGCTCCTCACAGGTCTAAGGATATCTCCTCCATAATACCCA
TATCTCTTGTTGCGGGTAACATGGTGAGTTTGATAACTGGATGCATTGCA
GGACTACTTTATGAAGAAAAGAAATAAAATTCTTTATGTTTATTATTTAC
CAAATTTTGTGCTAGAGATCCATTTACAAAAAATAGACAAACTTTCAATT
ATTCAACCG
back to top

protein sequence of SMED30025137-orf-1

>SMED30025137-orf-1 ID=SMED30025137-orf-1|Name=SMED30025137-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=200bp
MGAPGSLAISKLVYPETKSSLTTSADVRKIPDSTYNNVIEAITESAIDSA
GLIACVALNLLVFICLLSFVNSILKWIGNSLCLNHILSFEYICSYLFWPI
AFLIGIDYRDCFKVAELFGIKIFLNEFIAYQKLGTMINNKQIYDAVNWSI
TTAEQMGDDLVLFGLNKTVLKNGIILIVQLLLQHIFFAVLEILRLLECY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000047collecting duct
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR008276C_nuclsd_transpt
IPR011657CNT_C_dom
Vocabulary: molecular function
TermDefinition
GO:0005337nucleoside transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:1901642nucleoside transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011657Concentrative nucleoside transporter C-terminal domainPFAMPF07662Nucleos_tra2_Ccoord: 1..145
e-value: 1.4E-41
score: 142.7
IPR008276Concentrative nucleoside transporterPANTHERPTHR10590SODIUM/NUCLEOSIDE COTRANSPORTERcoord: 1..142
NoneNo IPR availableTMHMMTMhelixcoord: 86..108
NoneNo IPR availableTMHMMTMhelixcoord: 52..74
NoneNo IPR availableTMHMMTMhelixcoord: 174..196