SMED30025135

Overview
NameSMED30025135
Smed IDSMED30025135
Length (bp)585
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30025135 (SMED30025135) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30025135 (SMED30025135) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30025135 (SMED30025135) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30025135 (SMED30025135) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025135

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025135SMESG000042667.1 SmedASXL_017529SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30025135SMESG000042667.1 SMESG000042664.1 SMESG000042670.1 dd_Smed_v4_11981_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025135SMESG000042667.1 SMESG000042664.1 SMESG000042670.1 dd_Smed_v4_11981_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30025135SMESG000042667.1 SMESG000042664.1 SMESG000042670.1 dd_Smed_v6_11981_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30025135 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000347:171516..175064 +2794
Homology
BLAST of SMED30025135 vs. Ensembl Human
Match: UNC13B (unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:12566])

HSP 1 Score: 51.9878 bits (123), Expect = 7.113e-11
Identity = 20/60 (33.33%), Postives = 41/60 (68.33%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN---NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A +L  ++G+ N   + +A   Q+++ +LRPLM++ D +L+   ++CEKTV KR++
Sbjct: 1614 VRQMADILGQVRGTGNASPDARASAAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVL 1673          

HSP 2 Score: 33.113 bits (74), Expect = 7.113e-11
Identity = 12/27 (44.44%), Postives = 20/27 (74.07%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELW++ M+ +E+ +VLPPL+D    +L
Sbjct: 1675 ELWRVVMNTMERMIVLPPLTDQTGTQL 1701          
BLAST of SMED30025135 vs. Ensembl Human
Match: UNC13B (unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:12566])

HSP 1 Score: 51.6026 bits (122), Expect = 1.054e-10
Identity = 20/60 (33.33%), Postives = 41/60 (68.33%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN---NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A +L  ++G+ N   + +A   Q+++ +LRPLM++ D +L+   ++CEKTV KR++
Sbjct: 3983 VRQMADILGQVRGTGNASPDARASAAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVL 4042          

HSP 2 Score: 33.113 bits (74), Expect = 1.054e-10
Identity = 12/27 (44.44%), Postives = 20/27 (74.07%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELW++ M+ +E+ +VLPPL+D    +L
Sbjct: 4044 ELWRVVMNTMERMIVLPPLTDQTGTQL 4070          
BLAST of SMED30025135 vs. Ensembl Human
Match: UNC13B (unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:12566])

HSP 1 Score: 49.2914 bits (116), Expect = 5.024e-10
Identity = 20/60 (33.33%), Postives = 41/60 (68.33%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN---NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A +L  ++G+ N   + +A   Q+++ +LRPLM++ D +L+   ++CEKTV KR++
Sbjct: 1246 VRQMADILGQVRGTGNASPDARASAAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVL 1305          

HSP 2 Score: 33.113 bits (74), Expect = 5.024e-10
Identity = 12/27 (44.44%), Postives = 20/27 (74.07%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELW++ M+ +E+ +VLPPL+D    +L
Sbjct: 1307 ELWRVVMNTMERMIVLPPLTDQTGTQL 1333          
BLAST of SMED30025135 vs. Ensembl Human
Match: UNC13B (unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:12566])

HSP 1 Score: 48.9062 bits (115), Expect = 5.322e-10
Identity = 20/60 (33.33%), Postives = 41/60 (68.33%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN---NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A +L  ++G+ N   + +A   Q+++ +LRPLM++ D +L+   ++CEKTV KR++
Sbjct:  821 VRQMADILGQVRGTGNASPDARASAAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVL 880          

HSP 2 Score: 33.4982 bits (75), Expect = 5.322e-10
Identity = 12/27 (44.44%), Postives = 20/27 (74.07%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELW++ M+ +E+ +VLPPL+D    +L
Sbjct:  882 ELWRVVMNTMERMIVLPPLTDQTGTQL 908          
BLAST of SMED30025135 vs. Ensembl Human
Match: UNC13B (unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:12566])

HSP 1 Score: 48.9062 bits (115), Expect = 5.410e-10
Identity = 20/60 (33.33%), Postives = 41/60 (68.33%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN---NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A +L  ++G+ N   + +A   Q+++ +LRPLM++ D +L+   ++CEKTV KR++
Sbjct:  821 VRQMADILGQVRGTGNASPDARASAAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVL 880          

HSP 2 Score: 33.113 bits (74), Expect = 5.410e-10
Identity = 12/27 (44.44%), Postives = 20/27 (74.07%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELW++ M+ +E+ +VLPPL+D    +L
Sbjct:  882 ELWRVVMNTMERMIVLPPLTDQTGTQL 908          
BLAST of SMED30025135 vs. Ensembl Celegans
Match: unc-13 (Phorbol ester/diacylglycerol-binding protein unc-13 [Source:UniProtKB/Swiss-Prot;Acc:P27715])

HSP 1 Score: 40.4318 bits (93), Expect = 1.622e-9
Identity = 21/55 (38.18%), Postives = 32/55 (58.18%), Query Frame = -3
Query:  389 ELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 553
            +L  LL  +KG Q  QK  ++ E++ +L PLM+  + SL      CEKTV K ++
Sbjct: 1088 KLGMLLVKIKGPQL-QKTQVQPEADAVLEPLMDLLEGSLRRYADQCEKTVLKYIL 1141          

HSP 2 Score: 38.891 bits (89), Expect = 1.622e-9
Identity = 17/21 (80.95%), Postives = 20/21 (95.24%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWKIT+ N+EK+VVLPPLSD
Sbjct: 1143 ELWKITIVNMEKRVVLPPLSD 1163          
BLAST of SMED30025135 vs. Ensembl Celegans
Match: unc-13 (Phorbol ester/diacylglycerol-binding protein unc-13 [Source:UniProtKB/Swiss-Prot;Acc:P27715])

HSP 1 Score: 40.4318 bits (93), Expect = 1.622e-9
Identity = 21/55 (38.18%), Postives = 32/55 (58.18%), Query Frame = -3
Query:  389 ELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 553
            +L  LL  +KG Q  QK  ++ E++ +L PLM+  + SL      CEKTV K ++
Sbjct: 1085 KLGMLLVKIKGPQL-QKTQVQPEADAVLEPLMDLLEGSLRRYADQCEKTVLKYIL 1138          

HSP 2 Score: 38.891 bits (89), Expect = 1.622e-9
Identity = 17/21 (80.95%), Postives = 20/21 (95.24%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWKIT+ N+EK+VVLPPLSD
Sbjct: 1140 ELWKITIVNMEKRVVLPPLSD 1160          
BLAST of SMED30025135 vs. Ensembl Celegans
Match: unc-13 (Phorbol ester/diacylglycerol-binding protein unc-13 [Source:UniProtKB/Swiss-Prot;Acc:P27715])

HSP 1 Score: 40.4318 bits (93), Expect = 1.834e-9
Identity = 21/55 (38.18%), Postives = 32/55 (58.18%), Query Frame = -3
Query:  389 ELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 553
            +L  LL  +KG Q  QK  ++ E++ +L PLM+  + SL      CEKTV K ++
Sbjct: 1436 KLGMLLVKIKGPQL-QKTQVQPEADAVLEPLMDLLEGSLRRYADQCEKTVLKYIL 1489          

HSP 2 Score: 38.891 bits (89), Expect = 1.834e-9
Identity = 17/21 (80.95%), Postives = 20/21 (95.24%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWKIT+ N+EK+VVLPPLSD
Sbjct: 1491 ELWKITIVNMEKRVVLPPLSD 1511          
BLAST of SMED30025135 vs. Ensembl Celegans
Match: unc-13 (Phorbol ester/diacylglycerol-binding protein unc-13 [Source:UniProtKB/Swiss-Prot;Acc:P27715])

HSP 1 Score: 40.4318 bits (93), Expect = 1.849e-9
Identity = 21/55 (38.18%), Postives = 32/55 (58.18%), Query Frame = -3
Query:  389 ELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 553
            +L  LL  +KG Q  QK  ++ E++ +L PLM+  + SL      CEKTV K ++
Sbjct: 1433 KLGMLLVKIKGPQL-QKTQVQPEADAVLEPLMDLLEGSLRRYADQCEKTVLKYIL 1486          

HSP 2 Score: 38.891 bits (89), Expect = 1.849e-9
Identity = 17/21 (80.95%), Postives = 20/21 (95.24%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWKIT+ N+EK+VVLPPLSD
Sbjct: 1488 ELWKITIVNMEKRVVLPPLSD 1508          
BLAST of SMED30025135 vs. Ensembl Celegans
Match: unc-13 (Phorbol ester/diacylglycerol-binding protein unc-13 [Source:UniProtKB/Swiss-Prot;Acc:P27715])

HSP 1 Score: 40.4318 bits (93), Expect = 1.880e-9
Identity = 21/55 (38.18%), Postives = 32/55 (58.18%), Query Frame = -3
Query:  389 ELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 553
            +L  LL  +KG Q  QK  ++ E++ +L PLM+  + SL      CEKTV K ++
Sbjct: 1436 KLGMLLVKIKGPQL-QKTQVQPEADAVLEPLMDLLEGSLRRYADQCEKTVLKYIL 1489          

HSP 2 Score: 38.891 bits (89), Expect = 1.880e-9
Identity = 17/21 (80.95%), Postives = 20/21 (95.24%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWKIT+ N+EK+VVLPPLSD
Sbjct: 1491 ELWKITIVNMEKRVVLPPLSD 1511          
BLAST of SMED30025135 vs. Ensembl Fly
Match: unc-13 (gene:FBgn0025726 transcript:FBtr0344971)

HSP 1 Score: 46.2098 bits (108), Expect = 1.374e-9
Identity = 24/70 (34.29%), Postives = 38/70 (54.29%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGSQNN--------QKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            +I  ++ EL  +L ++KG            Q+  +  E++ +LRPLM+  D SL+     CEKTV KRL+
Sbjct: 2476 RITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVEADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLL 2545          

HSP 2 Score: 33.4982 bits (75), Expect = 1.374e-9
Identity = 14/21 (66.67%), Postives = 17/21 (80.95%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWKI M  LEK +VLPP++D
Sbjct: 2547 ELWKIVMRILEKTIVLPPMTD 2567          
BLAST of SMED30025135 vs. Ensembl Fly
Match: unc-13 (gene:FBgn0025726 transcript:FBtr0089246)

HSP 1 Score: 46.2098 bits (108), Expect = 1.466e-9
Identity = 24/70 (34.29%), Postives = 38/70 (54.29%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGSQNN--------QKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            +I  ++ EL  +L ++KG            Q+  +  E++ +LRPLM+  D SL+     CEKTV KRL+
Sbjct: 2479 RITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVEADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLL 2548          

HSP 2 Score: 33.4982 bits (75), Expect = 1.466e-9
Identity = 14/21 (66.67%), Postives = 17/21 (80.95%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWKI M  LEK +VLPP++D
Sbjct: 2550 ELWKIVMRILEKTIVLPPMTD 2570          
BLAST of SMED30025135 vs. Ensembl Fly
Match: unc-13 (gene:FBgn0025726 transcript:FBtr0308805)

HSP 1 Score: 46.2098 bits (108), Expect = 1.466e-9
Identity = 24/70 (34.29%), Postives = 38/70 (54.29%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGSQNN--------QKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            +I  ++ EL  +L ++KG            Q+  +  E++ +LRPLM+  D SL+     CEKTV KRL+
Sbjct: 2476 RITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVEADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLL 2545          

HSP 2 Score: 33.4982 bits (75), Expect = 1.466e-9
Identity = 14/21 (66.67%), Postives = 17/21 (80.95%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWKI M  LEK +VLPP++D
Sbjct: 2547 ELWKIVMRILEKTIVLPPMTD 2567          
BLAST of SMED30025135 vs. Ensembl Fly
Match: unc-13 (gene:FBgn0025726 transcript:FBtr0089245)

HSP 1 Score: 46.2098 bits (108), Expect = 1.466e-9
Identity = 24/70 (34.29%), Postives = 38/70 (54.29%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGSQNN--------QKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            +I  ++ EL  +L ++KG            Q+  +  E++ +LRPLM+  D SL+     CEKTV KRL+
Sbjct: 2476 RITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVEADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLL 2545          

HSP 2 Score: 33.4982 bits (75), Expect = 1.466e-9
Identity = 14/21 (66.67%), Postives = 17/21 (80.95%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWKI M  LEK +VLPP++D
Sbjct: 2547 ELWKIVMRILEKTIVLPPMTD 2567          
BLAST of SMED30025135 vs. Ensembl Fly
Match: unc-13 (gene:FBgn0025726 transcript:FBtr0334487)

HSP 1 Score: 46.2098 bits (108), Expect = 1.618e-9
Identity = 24/70 (34.29%), Postives = 38/70 (54.29%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGSQNN--------QKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            +I  ++ EL  +L ++KG            Q+  +  E++ +LRPLM+  D SL+     CEKTV KRL+
Sbjct: 2316 RITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVEADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLL 2385          

HSP 2 Score: 33.4982 bits (75), Expect = 1.618e-9
Identity = 14/21 (66.67%), Postives = 17/21 (80.95%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWKI M  LEK +VLPP++D
Sbjct: 2387 ELWKIVMRILEKTIVLPPMTD 2407          
BLAST of SMED30025135 vs. Ensembl Zebrafish
Match: CR769778.1 (protein unc-13 homolog C-like [Source:NCBI gene;Acc:110437876])

HSP 1 Score: 46.9802 bits (110), Expect = 1.216e-11
Identity = 21/57 (36.84%), Postives = 36/57 (63.16%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++ + L  +KG+  N K++   ++E +LRPLM+  D +L     ICEKTV KR++
Sbjct:  385 VKQMNQELVQMKGNAGN-KSNAAMDAETVLRPLMDLLDKNLMLFAKICEKTVLKRVL 440          

HSP 2 Score: 40.4318 bits (93), Expect = 1.216e-11
Identity = 15/24 (62.50%), Postives = 20/24 (83.33%), Query Frame = -2
Query:  300 ELWKITMHNLEKQVVLPPLSDPRQ 371
            ELWKI ++ +E+Q+VLPPLSD  Q
Sbjct:  442 ELWKIVLNTIERQIVLPPLSDQTQ 465          
BLAST of SMED30025135 vs. Ensembl Zebrafish
Match: CR769778.1 (protein unc-13 homolog C-like [Source:NCBI gene;Acc:110437876])

HSP 1 Score: 46.9802 bits (110), Expect = 1.216e-11
Identity = 21/57 (36.84%), Postives = 36/57 (63.16%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++ + L  +KG+  N K++   ++E +LRPLM+  D +L     ICEKTV KR++
Sbjct:  376 VKQMNQELVQMKGNAGN-KSNAAMDAETVLRPLMDLLDKNLMLFAKICEKTVLKRVL 431          

HSP 2 Score: 40.4318 bits (93), Expect = 1.216e-11
Identity = 15/24 (62.50%), Postives = 20/24 (83.33%), Query Frame = -2
Query:  300 ELWKITMHNLEKQVVLPPLSDPRQ 371
            ELWKI ++ +E+Q+VLPPLSD  Q
Sbjct:  433 ELWKIVLNTIERQIVLPPLSDQTQ 456          
BLAST of SMED30025135 vs. Ensembl Zebrafish
Match: UNC13B (unc-13 homolog Bb (C. elegans) [Source:NCBI gene;Acc:100329499])

HSP 1 Score: 56.225 bits (134), Expect = 4.984e-11
Identity = 28/64 (43.75%), Postives = 43/64 (67.19%), Query Frame = -3
Query:  389 SQIVANISELAKLLQNLKGSQN-NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 577
            S+I   + ++A LL  +KG  N N K  +E +S+ +LRPLM++ DA+L    S+CEKTV KR++
Sbjct: 1214 SRIDDCMRQMASLLYQIKGPVNTNNKNQVEADSDNMLRPLMDFLDANLMLFASVCEKTVLKRVL 1277          

HSP 2 Score: 29.261 bits (64), Expect = 4.984e-11
Identity = 11/21 (52.38%), Postives = 17/21 (80.95%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELW+I M++LEK ++LP  +D
Sbjct: 1279 ELWRIVMNSLEKTIILPQGND 1299          
BLAST of SMED30025135 vs. Ensembl Zebrafish
Match: unc13a (unc-13 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-140722-1])

HSP 1 Score: 48.1358 bits (113), Expect = 9.783e-11
Identity = 20/64 (31.25%), Postives = 42/64 (65.62%), Query Frame = -3
Query:  389 IVANISELAKLLQNLKGSQN---NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 571
            I  N+ ++  +L  +KG+ N   +  + + Q+++ +L+P+M++ D++L+    ICEKTV KR++
Sbjct:  806 IEENVKQMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDFLDSNLTLFAKICEKTVLKRVL 869          

HSP 2 Score: 36.1946 bits (82), Expect = 9.783e-11
Identity = 16/30 (53.33%), Postives = 23/30 (76.67%), Query Frame = -2
Query:  285 ELWKITMHNLEKQVVLPPLSD-PRQVRLNC 371
            ELWK+ M+ +EK +VLPPL+D   +V+L C
Sbjct:  871 ELWKLVMNTMEKTIVLPPLTDQTGRVKLAC 900          
BLAST of SMED30025135 vs. Ensembl Zebrafish
Match: unc13a (unc-13 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-140722-1])

HSP 1 Score: 48.1358 bits (113), Expect = 1.176e-10
Identity = 20/64 (31.25%), Postives = 42/64 (65.62%), Query Frame = -3
Query:  389 IVANISELAKLLQNLKGSQN---NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 571
            I  N+ ++  +L  +KG+ N   +  + + Q+++ +L+P+M++ D++L+    ICEKTV KR++
Sbjct: 1370 IEENVKQMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDFLDSNLTLFAKICEKTVLKRVL 1433          

HSP 2 Score: 35.8094 bits (81), Expect = 1.176e-10
Identity = 16/30 (53.33%), Postives = 23/30 (76.67%), Query Frame = -2
Query:  285 ELWKITMHNLEKQVVLPPLSD-PRQVRLNC 371
            ELWK+ M+ +EK +VLPPL+D   +V+L C
Sbjct: 1435 ELWKLVMNTMEKTIVLPPLTDQTGRVKLAC 1464          
BLAST of SMED30025135 vs. Ensembl Xenopus
Match: acaa1 (acetyl-CoA acyltransferase 1 [Source:Xenbase;Acc:XB-GENE-963068])

HSP 1 Score: 48.521 bits (114), Expect = 2.020e-10
Identity = 24/55 (43.64%), Postives = 35/55 (63.64%), Query Frame = -3
Query:  389 ELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 553
            EL ++  N   S N   A ++  +EI+LRPLM++ D +LS    ICEKTV KR++
Sbjct: 1366 ELNQMKGNGNASTNRNNAAMD--AEIVLRPLMDFLDKTLSVSAKICEKTVLKRVL 1418          

HSP 2 Score: 35.4242 bits (80), Expect = 2.020e-10
Identity = 13/21 (61.90%), Postives = 19/21 (90.48%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWK+ ++ +EKQ+VLPPL+D
Sbjct: 1420 ELWKLVLNRIEKQIVLPPLTD 1440          
BLAST of SMED30025135 vs. Ensembl Xenopus
Match: acaa1 (acetyl-CoA acyltransferase 1 [Source:Xenbase;Acc:XB-GENE-963068])

HSP 1 Score: 48.521 bits (114), Expect = 2.039e-10
Identity = 24/55 (43.64%), Postives = 35/55 (63.64%), Query Frame = -3
Query:  389 ELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 553
            EL ++  N   S N   A ++  +EI+LRPLM++ D +LS    ICEKTV KR++
Sbjct: 1863 ELNQMKGNGNASTNRNNAAMD--AEIVLRPLMDFLDKTLSVSAKICEKTVLKRVL 1915          

HSP 2 Score: 35.039 bits (79), Expect = 2.039e-10
Identity = 13/21 (61.90%), Postives = 19/21 (90.48%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWK+ ++ +EKQ+VLPPL+D
Sbjct: 1917 ELWKLVLNRIEKQIVLPPLTD 1937          
BLAST of SMED30025135 vs. Ensembl Xenopus
Match: acaa1 (acetyl-CoA acyltransferase 1 [Source:Xenbase;Acc:XB-GENE-963068])

HSP 1 Score: 48.521 bits (114), Expect = 2.332e-10
Identity = 24/55 (43.64%), Postives = 35/55 (63.64%), Query Frame = -3
Query:  389 ELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 553
            EL ++  N   S N   A ++  +EI+LRPLM++ D +LS    ICEKTV KR++
Sbjct: 1510 ELNQMKGNGNASTNRNNAAMD--AEIVLRPLMDFLDKTLSVSAKICEKTVLKRVL 1562          

HSP 2 Score: 35.039 bits (79), Expect = 2.332e-10
Identity = 13/21 (61.90%), Postives = 19/21 (90.48%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWK+ ++ +EKQ+VLPPL+D
Sbjct: 1564 ELWKLVLNRIEKQIVLPPLTD 1584          
BLAST of SMED30025135 vs. Ensembl Xenopus
Match: acaa1 (acetyl-CoA acyltransferase 1 [Source:Xenbase;Acc:XB-GENE-963068])

HSP 1 Score: 48.521 bits (114), Expect = 2.457e-10
Identity = 24/55 (43.64%), Postives = 35/55 (63.64%), Query Frame = -3
Query:  389 ELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 553
            EL ++  N   S N   A ++  +EI+LRPLM++ D +LS    ICEKTV KR++
Sbjct:  882 ELNQMKGNGNASTNRNNAAMD--AEIVLRPLMDFLDKTLSVSAKICEKTVLKRVL 934          

HSP 2 Score: 35.039 bits (79), Expect = 2.457e-10
Identity = 13/21 (61.90%), Postives = 19/21 (90.48%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWK+ ++ +EKQ+VLPPL+D
Sbjct:  936 ELWKLVLNRIEKQIVLPPLTD 956          
BLAST of SMED30025135 vs. Ensembl Xenopus
Match: acaa1 (acetyl-CoA acyltransferase 1 [Source:Xenbase;Acc:XB-GENE-963068])

HSP 1 Score: 48.1358 bits (113), Expect = 2.616e-10
Identity = 24/55 (43.64%), Postives = 35/55 (63.64%), Query Frame = -3
Query:  389 ELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 553
            EL ++  N   S N   A ++  +EI+LRPLM++ D +LS    ICEKTV KR++
Sbjct: 1026 ELNQMKGNGNASTNRNNAAMD--AEIVLRPLMDFLDKTLSVSAKICEKTVLKRVL 1078          

HSP 2 Score: 35.039 bits (79), Expect = 2.616e-10
Identity = 13/21 (61.90%), Postives = 19/21 (90.48%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWK+ ++ +EKQ+VLPPL+D
Sbjct: 1080 ELWKLVLNRIEKQIVLPPLTD 1100          
BLAST of SMED30025135 vs. Ensembl Mouse
Match: Unc13b (unc-13 homolog B [Source:MGI Symbol;Acc:MGI:1342278])

HSP 1 Score: 55.0694 bits (131), Expect = 9.809e-12
Identity = 21/60 (35.00%), Postives = 42/60 (70.00%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN---NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A +L  ++G+ N   N +A + Q+++ +LRPLM++ D +L+   ++CEKTV KR++
Sbjct: 1606 VRQMADILGQVRGTGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVL 1665          

HSP 2 Score: 32.3426 bits (72), Expect = 9.809e-12
Identity = 12/27 (44.44%), Postives = 20/27 (74.07%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELW++ M+ +E+ +VLPPL+D    +L
Sbjct: 1667 ELWRVVMNTMERVIVLPPLTDQTGTQL 1693          
BLAST of SMED30025135 vs. Ensembl Mouse
Match: Unc13b (unc-13 homolog B [Source:MGI Symbol;Acc:MGI:1342278])

HSP 1 Score: 54.6842 bits (130), Expect = 1.565e-11
Identity = 21/60 (35.00%), Postives = 42/60 (70.00%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN---NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A +L  ++G+ N   N +A + Q+++ +LRPLM++ D +L+   ++CEKTV KR++
Sbjct: 4033 VRQMADILGQVRGTGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVL 4092          

HSP 2 Score: 32.3426 bits (72), Expect = 1.565e-11
Identity = 12/27 (44.44%), Postives = 20/27 (74.07%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELW++ M+ +E+ +VLPPL+D    +L
Sbjct: 4094 ELWRVVMNTMERVIVLPPLTDQTGTQL 4120          
BLAST of SMED30025135 vs. Ensembl Mouse
Match: Unc13b (unc-13 homolog B [Source:MGI Symbol;Acc:MGI:1342278])

HSP 1 Score: 52.373 bits (124), Expect = 6.455e-11
Identity = 21/60 (35.00%), Postives = 42/60 (70.00%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN---NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A +L  ++G+ N   N +A + Q+++ +LRPLM++ D +L+   ++CEKTV KR++
Sbjct: 1244 VRQMADILGQVRGTGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVL 1303          

HSP 2 Score: 32.3426 bits (72), Expect = 6.455e-11
Identity = 12/27 (44.44%), Postives = 20/27 (74.07%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELW++ M+ +E+ +VLPPL+D    +L
Sbjct: 1305 ELWRVVMNTMERVIVLPPLTDQTGTQL 1331          
BLAST of SMED30025135 vs. Ensembl Mouse
Match: Unc13b (unc-13 homolog B [Source:MGI Symbol;Acc:MGI:1342278])

HSP 1 Score: 52.373 bits (124), Expect = 6.560e-11
Identity = 21/60 (35.00%), Postives = 42/60 (70.00%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN---NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A +L  ++G+ N   N +A + Q+++ +LRPLM++ D +L+   ++CEKTV KR++
Sbjct: 1245 VRQMADILGQVRGTGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVL 1304          

HSP 2 Score: 32.3426 bits (72), Expect = 6.560e-11
Identity = 12/27 (44.44%), Postives = 20/27 (74.07%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELW++ M+ +E+ +VLPPL+D    +L
Sbjct: 1306 ELWRVVMNTMERVIVLPPLTDQTGTQL 1332          
BLAST of SMED30025135 vs. Ensembl Mouse
Match: Unc13b (unc-13 homolog B [Source:MGI Symbol;Acc:MGI:1342278])

HSP 1 Score: 52.373 bits (124), Expect = 7.057e-11
Identity = 21/60 (35.00%), Postives = 42/60 (70.00%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN---NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A +L  ++G+ N   N +A + Q+++ +LRPLM++ D +L+   ++CEKTV KR++
Sbjct: 1233 VRQMADILGQVRGTGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVL 1292          

HSP 2 Score: 32.3426 bits (72), Expect = 7.057e-11
Identity = 12/27 (44.44%), Postives = 20/27 (74.07%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELW++ M+ +E+ +VLPPL+D    +L
Sbjct: 1294 ELWRVVMNTMERVIVLPPLTDQTGTQL 1320          
BLAST of SMED30025135 vs. UniProt/SwissProt
Match: sp|Q9Z1N9|UN13B_MOUSE (Protein unc-13 homolog B OS=Mus musculus OX=10090 GN=Unc13b PE=1 SV=2)

HSP 1 Score: 52.373 bits (124), Expect = 3.576e-10
Identity = 21/60 (35.00%), Postives = 42/60 (70.00%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN---NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A +L  ++G+ N   N +A + Q+++ +LRPLM++ D +L+   ++CEKTV KR++
Sbjct: 1245 VRQMADILGQVRGTGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVL 1304          

HSP 2 Score: 32.3426 bits (72), Expect = 3.576e-10
Identity = 12/27 (44.44%), Postives = 20/27 (74.07%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELW++ M+ +E+ +VLPPL+D    +L
Sbjct: 1306 ELWRVVMNTMERVIVLPPLTDQTGTQL 1332          
BLAST of SMED30025135 vs. UniProt/SwissProt
Match: sp|Q62769|UN13B_RAT (Protein unc-13 homolog B OS=Rattus norvegicus OX=10116 GN=Unc13b PE=1 SV=2)

HSP 1 Score: 52.7582 bits (125), Expect = 1.011e-9
Identity = 21/60 (35.00%), Postives = 42/60 (70.00%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN---NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A +L  ++G+ N   N +A + Q+++ +LRPLM++ D +L+   ++CEKTV KR++
Sbjct: 1246 VRQMADILGQVRGTGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVL 1305          

HSP 2 Score: 30.8018 bits (68), Expect = 1.011e-9
Identity = 12/27 (44.44%), Postives = 19/27 (70.37%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELW++ M+ +E+ +VLPPL D    +L
Sbjct: 1307 ELWRVVMNTMERVIVLPPLIDQTGTQL 1333          
BLAST of SMED30025135 vs. UniProt/SwissProt
Match: sp|Q8K0T7|UN13C_MOUSE (Protein unc-13 homolog C OS=Mus musculus OX=10090 GN=Unc13c PE=1 SV=3)

HSP 1 Score: 46.9802 bits (110), Expect = 2.239e-9
Identity = 23/56 (41.07%), Postives = 36/56 (64.29%), Query Frame = -3
Query:  389 SELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 556
            +EL ++  N   + N   A ++  +EI+LRPLM++ D +LS    ICEKTV KR++
Sbjct: 1859 AELNQMRANGNSTANKNSAAMD--AEIVLRPLMDFLDKTLSLSAKICEKTVLKRVL 1912          

HSP 2 Score: 35.039 bits (79), Expect = 2.239e-9
Identity = 13/21 (61.90%), Postives = 19/21 (90.48%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWK+ ++ +EKQ+VLPPL+D
Sbjct: 1914 ELWKLVLNKIEKQIVLPPLTD 1934          
BLAST of SMED30025135 vs. UniProt/SwissProt
Match: sp|O14795|UN13B_HUMAN (Protein unc-13 homolog B OS=Homo sapiens OX=9606 GN=UNC13B PE=1 SV=2)

HSP 1 Score: 48.9062 bits (115), Expect = 2.242e-9
Identity = 20/60 (33.33%), Postives = 41/60 (68.33%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN---NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A +L  ++G+ N   + +A   Q+++ +LRPLM++ D +L+   ++CEKTV KR++
Sbjct: 1234 VRQMADILGQVRGTGNASPDARASAAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVL 1293          

HSP 2 Score: 33.113 bits (74), Expect = 2.242e-9
Identity = 12/27 (44.44%), Postives = 20/27 (74.07%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELW++ M+ +E+ +VLPPL+D    +L
Sbjct: 1295 ELWRVVMNTMERMIVLPPLTDQTGTQL 1321          
BLAST of SMED30025135 vs. UniProt/SwissProt
Match: sp|P27715|UNC13_CAEEL (Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4)

HSP 1 Score: 40.0466 bits (92), Expect = 1.905e-8
Identity = 21/55 (38.18%), Postives = 32/55 (58.18%), Query Frame = -3
Query:  389 ELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 553
            +L  LL  +KG Q  QK  ++ E++ +L PLM+  + SL      CEKTV K ++
Sbjct: 1775 KLGMLLVKIKGPQL-QKTQVQPEADAVLEPLMDLLEGSLRRYADQCEKTVLKYIL 1828          

HSP 2 Score: 38.891 bits (89), Expect = 1.905e-8
Identity = 17/21 (80.95%), Postives = 20/21 (95.24%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWKIT+ N+EK+VVLPPLSD
Sbjct: 1830 ELWKITIVNMEKRVVLPPLSD 1850          
BLAST of SMED30025135 vs. TrEMBL
Match: A0A0L8G286 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22001872mg PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.399e-16
Identity = 34/68 (50.00%), Postives = 47/68 (69.12%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGS------QNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            QI  +I EL KLL N+KG+      Q +Q+++I+ ES++ILRPLM+  D SLS  +  CEKTV KRL+
Sbjct:  223 QIQQSIQELGKLLSNVKGTGQVSLAQPSQRSNIQGESDMILRPLMDLLDGSLSMFSQACEKTVLKRLL 290          

HSP 2 Score: 47.3654 bits (111), Expect = 1.399e-16
Identity = 21/27 (77.78%), Postives = 23/27 (85.19%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELWKI MH +EK VVLPPLSDPRQ+ L
Sbjct:  292 ELWKIVMHTMEKTVVLPPLSDPRQLLL 318          
BLAST of SMED30025135 vs. TrEMBL
Match: A0A0L8G1T3 (Uncharacterized protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22001872mg PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.453e-16
Identity = 34/68 (50.00%), Postives = 47/68 (69.12%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGS------QNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            QI  +I EL KLL N+KG+      Q +Q+++I+ ES++ILRPLM+  D SLS  +  CEKTV KRL+
Sbjct:  585 QIQQSIQELGKLLSNVKGTGQVSLAQPSQRSNIQGESDMILRPLMDLLDGSLSMFSQACEKTVLKRLL 652          

HSP 2 Score: 47.3654 bits (111), Expect = 1.453e-16
Identity = 21/27 (77.78%), Postives = 23/27 (85.19%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELWKI MH +EK VVLPPLSDPRQ+ L
Sbjct:  654 ELWKIVMHTMEKTVVLPPLSDPRQLLL 680          
BLAST of SMED30025135 vs. TrEMBL
Match: A0A0L8G1T7 (Uncharacterized protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22001872mg PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.503e-16
Identity = 34/68 (50.00%), Postives = 47/68 (69.12%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGS------QNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            QI  +I EL KLL N+KG+      Q +Q+++I+ ES++ILRPLM+  D SLS  +  CEKTV KRL+
Sbjct:  585 QIQQSIQELGKLLSNVKGTGQVSLAQPSQRSNIQGESDMILRPLMDLLDGSLSMFSQACEKTVLKRLL 652          

HSP 2 Score: 47.3654 bits (111), Expect = 1.503e-16
Identity = 21/27 (77.78%), Postives = 23/27 (85.19%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELWKI MH +EK VVLPPLSDPRQ+ L
Sbjct:  654 ELWKIVMHTMEKTVVLPPLSDPRQLLL 680          
BLAST of SMED30025135 vs. TrEMBL
Match: A0A0L8G247 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22001872mg PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.584e-16
Identity = 34/68 (50.00%), Postives = 47/68 (69.12%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGS------QNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            QI  +I EL KLL N+KG+      Q +Q+++I+ ES++ILRPLM+  D SLS  +  CEKTV KRL+
Sbjct:  223 QIQQSIQELGKLLSNVKGTGQVSLAQPSQRSNIQGESDMILRPLMDLLDGSLSMFSQACEKTVLKRLL 290          

HSP 2 Score: 47.3654 bits (111), Expect = 1.584e-16
Identity = 21/27 (77.78%), Postives = 23/27 (85.19%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELWKI MH +EK VVLPPLSDPRQ+ L
Sbjct:  292 ELWKIVMHTMEKTVVLPPLSDPRQLLL 318          
BLAST of SMED30025135 vs. TrEMBL
Match: A0A5K3F6A9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 9.421e-16
Identity = 31/62 (50.00%), Postives = 45/62 (72.58%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            QI+A + E+ KLL  +    +N KA IE E+++ILRPLM++F++SLS    ICEKTV KR++
Sbjct:  543 QILAKVKEVNKLLHQI---SSNSKASIESEADLILRPLMDHFESSLSVYADICEKTVLKRIL 601          

HSP 2 Score: 46.9802 bits (110), Expect = 9.421e-16
Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = -2
Query:  288 ELWKITMHNLEKQVVLPPLSDPRQVRLN 371
            ELWKITM+  EKQVVLPP+SDP  + LN
Sbjct:  603 ELWKITMYTFEKQVVLPPVSDPSALFLN 630          
BLAST of SMED30025135 vs. Ensembl Cavefish
Match: ENSAMXT00000045754.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:15823441:15932673:1 gene:ENSAMXG00000017447.2 transcript:ENSAMXT00000045754.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 8.623e-11
Identity = 24/64 (37.50%), Postives = 43/64 (67.19%), Query Frame = -3
Query:  389 SQIVANISELAKLLQNLKGSQN-NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 577
            ++I   + ++A LL  +KG  N N +  +E +++ +LRPLM++ D +L+   S+CEKTV KR++
Sbjct: 1342 TRIDECMRQMASLLYQIKGPVNANSRNQVEGDADNVLRPLMDFLDGNLTLFASVCEKTVLKRVL 1405          

HSP 2 Score: 29.6462 bits (65), Expect = 8.623e-11
Identity = 12/21 (57.14%), Postives = 17/21 (80.95%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELW+I M++LEK +VLP  +D
Sbjct: 1407 ELWRIVMNSLEKTIVLPQGND 1427          
BLAST of SMED30025135 vs. Ensembl Cavefish
Match: ENSAMXT00000036882.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:15877557:15935246:1 gene:ENSAMXG00000017447.2 transcript:ENSAMXT00000036882.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 1.602e-10
Identity = 23/58 (39.66%), Postives = 40/58 (68.97%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN-NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A LL  +KG  N N +  +E +++ +LRPLM++ D +L+   S+CEKTV KR++
Sbjct: 1702 MRQMASLLYQIKGPVNANSRNQVEGDADNVLRPLMDFLDGNLTLFASVCEKTVLKRVL 1759          

HSP 2 Score: 30.4166 bits (67), Expect = 1.602e-10
Identity = 12/21 (57.14%), Postives = 17/21 (80.95%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELW+I M++LEK +VLP  +D
Sbjct: 1761 ELWRIVMNSLEKTIVLPQGND 1781          
BLAST of SMED30025135 vs. Ensembl Cavefish
Match: ENSAMXT00000049675.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:15823549:15937399:1 gene:ENSAMXG00000017447.2 transcript:ENSAMXT00000049675.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 1.912e-10
Identity = 23/58 (39.66%), Postives = 40/58 (68.97%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN-NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A LL  +KG  N N +  +E +++ +LRPLM++ D +L+   S+CEKTV KR++
Sbjct: 1218 MRQMASLLYQIKGPVNANSRNQVEGDADNVLRPLMDFLDGNLTLFASVCEKTVLKRVL 1275          

HSP 2 Score: 29.6462 bits (65), Expect = 1.912e-10
Identity = 12/21 (57.14%), Postives = 17/21 (80.95%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELW+I M++LEK +VLP  +D
Sbjct: 1277 ELWRIVMNSLEKTIVLPQGND 1297          
BLAST of SMED30025135 vs. Ensembl Cavefish
Match: ENSAMXT00000017969.2 (pep primary_assembly:Astyanax_mexicanus-2.0:20:15794227:15935246:1 gene:ENSAMXG00000017447.2 transcript:ENSAMXT00000017969.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 2.525e-10
Identity = 23/58 (39.66%), Postives = 40/58 (68.97%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN-NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A LL  +KG  N N +  +E +++ +LRPLM++ D +L+   S+CEKTV KR++
Sbjct: 1227 MRQMASLLYQIKGPVNANSRNQVEGDADNVLRPLMDFLDGNLTLFASVCEKTVLKRVL 1284          

HSP 2 Score: 29.6462 bits (65), Expect = 2.525e-10
Identity = 12/21 (57.14%), Postives = 17/21 (80.95%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELW+I M++LEK +VLP  +D
Sbjct: 1286 ELWRIVMNSLEKTIVLPQGND 1306          
BLAST of SMED30025135 vs. Ensembl Cavefish
Match: UNC13C (unc-13 homolog C [Source:HGNC Symbol;Acc:HGNC:23149])

HSP 1 Score: 44.2838 bits (103), Expect = 9.081e-10
Identity = 21/57 (36.84%), Postives = 36/57 (63.16%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++ + L  +KG+  N K++   ++E +LRPLM+  D +L     ICEKTV KR++
Sbjct: 1794 VKQMNQELVQMKGTAGN-KSNAAMDAETVLRPLMDLLDKNLILFAKICEKTVLKRVL 1849          

HSP 2 Score: 36.5798 bits (83), Expect = 9.081e-10
Identity = 14/24 (58.33%), Postives = 20/24 (83.33%), Query Frame = -2
Query:  300 ELWKITMHNLEKQVVLPPLSDPRQ 371
            ELWKI ++ +E+Q+VLPPL+D  Q
Sbjct: 1851 ELWKIVLNTIERQIVLPPLTDQTQ 1874          
BLAST of SMED30025135 vs. Ensembl Nematostella
Match: EDO30233 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1D8])

HSP 1 Score: 45.0542 bits (105), Expect = 1.226e-7
Identity = 20/39 (51.28%), Postives = 29/39 (74.36%), Query Frame = -3
Query:  389 KAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 505
            +A +EQES +IL+PLM+  + +LS L   CEK+V KRL+
Sbjct:  162 RAAVEQESAMILQPLMDILEGTLSLLNRACEKSVLKRLL 200          

HSP 2 Score: 26.5646 bits (57), Expect = 1.226e-7
Identity = 11/21 (52.38%), Postives = 15/21 (71.43%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            +LWK  + N E+ VVLPP +D
Sbjct:  203 QLWKSLLANFERIVVLPPPND 223          
BLAST of SMED30025135 vs. Ensembl Medaka
Match: ENSORLT00000005973.2 (unc-13 homolog A [Source:NCBI gene;Acc:101164968])

HSP 1 Score: 50.0618 bits (118), Expect = 4.855e-11
Identity = 21/63 (33.33%), Postives = 40/63 (63.49%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGSQN-NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
             I  N+ ++  +L  +KG  N    + + Q+++ +L+P+ME+ D++L+    ICEKTV KR++
Sbjct: 1159 HIEENVKQMGDILAQVKGGSNVGNASSVAQDADNVLQPIMEFLDSNLTLFAKICEKTVLKRVL 1221          

HSP 2 Score: 35.039 bits (79), Expect = 4.855e-11
Identity = 14/27 (51.85%), Postives = 20/27 (74.07%), Query Frame = -2
Query:  291 ELWKITMHNLEKQVVLPPLSDPRQVRL 371
            ELWK+ M+ +EK +VLPPL+D    +L
Sbjct: 1223 ELWKLVMNTMEKTIVLPPLTDQTGTQL 1249          
BLAST of SMED30025135 vs. Ensembl Medaka
Match: UNC13A (protein unc-13 homolog A [Source:NCBI gene;Acc:105356230])

HSP 1 Score: 51.9878 bits (123), Expect = 1.681e-10
Identity = 22/62 (35.48%), Postives = 39/62 (62.90%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            QI  N+ ++  +L  +KG        + QE++ +L+P+M++ D++LS    ICEKTV KR++
Sbjct: 1174 QIEDNVRQMGDILAQVKGQTVPANGSVVQEADNVLQPIMDFLDSNLSLFAKICEKTVLKRVL 1235          

HSP 2 Score: 31.187 bits (69), Expect = 1.681e-10
Identity = 12/21 (57.14%), Postives = 17/21 (80.95%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWK+ M+ +EK +VLP L+D
Sbjct: 1237 ELWKLVMNTMEKTIVLPTLTD 1257          
BLAST of SMED30025135 vs. Ensembl Medaka
Match: UNC13A (protein unc-13 homolog A [Source:NCBI gene;Acc:105356230])

HSP 1 Score: 51.6026 bits (122), Expect = 3.072e-10
Identity = 22/62 (35.48%), Postives = 39/62 (62.90%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            QI  N+ ++  +L  +KG        + QE++ +L+P+M++ D++LS    ICEKTV KR++
Sbjct: 1498 QIEDNVRQMGDILAQVKGQTVPANGSVVQEADNVLQPIMDFLDSNLSLFAKICEKTVLKRVL 1559          

HSP 2 Score: 30.8018 bits (68), Expect = 3.072e-10
Identity = 12/21 (57.14%), Postives = 17/21 (80.95%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELWK+ M+ +EK +VLP L+D
Sbjct: 1561 ELWKLVMNTMEKTIVLPTLTD 1581          
BLAST of SMED30025135 vs. Ensembl Medaka
Match: UNC13B (unc-13 homolog B [Source:NCBI gene;Acc:101167071])

HSP 1 Score: 53.1434 bits (126), Expect = 4.315e-10
Identity = 23/58 (39.66%), Postives = 39/58 (67.24%), Query Frame = -3
Query:  389 ISELAKLLQNLKGSQN-NQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 559
            + ++A LL  +KG  N N K  ++ +S+ +LRPLM++ D  L+   ++CEKTV KR++
Sbjct: 1147 MRQMASLLYQIKGPLNGNTKNQVDADSDNMLRPLMDFLDGKLTLFATVCEKTVLKRVL 1204          

HSP 2 Score: 28.4906 bits (62), Expect = 4.315e-10
Identity = 12/21 (57.14%), Postives = 16/21 (76.19%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            ELW+I M +LEK +VLP  +D
Sbjct: 1206 ELWRIVMTSLEKTIVLPQGND 1226          
BLAST of SMED30025135 vs. Ensembl Medaka
Match: unc13ba (protein unc-13 homolog B-like [Source:NCBI gene;Acc:101159330])

HSP 1 Score: 54.299 bits (129), Expect = 1.257e-9
Identity = 24/63 (38.10%), Postives = 40/63 (63.49%), Query Frame = -3
Query:  389 SQIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 577
             +I   + ++A+LL  ++G  N   A  E +++++LRPLME+ D +LS     CEKTV KR++
Sbjct:  834 GRINGCMRQMAELLYQMRGPPNRDTA--EADADVMLRPLMEFLDGNLSIFADACEKTVLKRIL 894          

HSP 2 Score: 25.7942 bits (55), Expect = 1.257e-9
Identity = 10/21 (47.62%), Postives = 15/21 (71.43%), Query Frame = -2
Query:  309 ELWKITMHNLEKQVVLPPLSD 371
            +LWK  + +LEK +VLP  +D
Sbjct:  896 DLWKTVLCSLEKTIVLPQCND 916          
BLAST of SMED30025135 vs. Planmine SMEST
Match: SMESG000042667.1 (SMESG000042667.1)

HSP 1 Score: 124.405 bits (311), Expect = 2.152e-39
Identity = 61/62 (98.39%), Postives = 62/62 (100.00%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRL+
Sbjct:  802 QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLL 863          

HSP 2 Score: 55.8398 bits (133), Expect = 2.152e-39
Identity = 25/28 (89.29%), Postives = 27/28 (96.43%), Query Frame = -2
Query:  288 ELWKITMHNLEKQVVLPPLSDPRQVRLN 371
            ELWKITMHNLEKQVVLPPLSDPRQ+ L+
Sbjct:  865 ELWKITMHNLEKQVVLPPLSDPRQLFLS 892          
BLAST of SMED30025135 vs. Planmine SMEST
Match: SMESG000042667.1 (SMESG000042667.1)

HSP 1 Score: 124.79 bits (312), Expect = 2.229e-39
Identity = 61/62 (98.39%), Postives = 62/62 (100.00%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRL+
Sbjct: 1763 QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLL 1824          

HSP 2 Score: 55.4546 bits (132), Expect = 2.229e-39
Identity = 25/28 (89.29%), Postives = 27/28 (96.43%), Query Frame = -2
Query:  288 ELWKITMHNLEKQVVLPPLSDPRQVRLN 371
            ELWKITMHNLEKQVVLPPLSDPRQ+ L+
Sbjct: 1826 ELWKITMHNLEKQVVLPPLSDPRQLFLS 1853          
BLAST of SMED30025135 vs. Planmine SMEST
Match: SMESG000042667.1 (SMESG000042667.1)

HSP 1 Score: 124.79 bits (312), Expect = 2.401e-39
Identity = 61/62 (98.39%), Postives = 62/62 (100.00%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRL+
Sbjct: 1725 QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLL 1786          

HSP 2 Score: 55.4546 bits (132), Expect = 2.401e-39
Identity = 25/28 (89.29%), Postives = 27/28 (96.43%), Query Frame = -2
Query:  288 ELWKITMHNLEKQVVLPPLSDPRQVRLN 371
            ELWKITMHNLEKQVVLPPLSDPRQ+ L+
Sbjct: 1788 ELWKITMHNLEKQVVLPPLSDPRQLFLS 1815          
BLAST of SMED30025135 vs. Planmine SMEST
Match: SMESG000042667.1 (SMESG000042667.1)

HSP 1 Score: 124.405 bits (311), Expect = 2.436e-39
Identity = 61/62 (98.39%), Postives = 62/62 (100.00%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRL+
Sbjct:  802 QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLL 863          

HSP 2 Score: 55.8398 bits (133), Expect = 2.436e-39
Identity = 25/28 (89.29%), Postives = 27/28 (96.43%), Query Frame = -2
Query:  288 ELWKITMHNLEKQVVLPPLSDPRQVRLN 371
            ELWKITMHNLEKQVVLPPLSDPRQ+ L+
Sbjct:  865 ELWKITMHNLEKQVVLPPLSDPRQLFLS 892          
BLAST of SMED30025135 vs. Planmine SMEST
Match: SMESG000042667.1 (SMESG000042667.1)

HSP 1 Score: 124.79 bits (312), Expect = 2.462e-39
Identity = 61/62 (98.39%), Postives = 62/62 (100.00%), Query Frame = -3
Query:  389 QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLI 574
            QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRL+
Sbjct: 1719 QIVANISELAKLLQNLKGSQNNQKAHIEQESEIILRPLMEYFDASLSTLTSICEKTVFKRLL 1780          

HSP 2 Score: 55.4546 bits (132), Expect = 2.462e-39
Identity = 25/28 (89.29%), Postives = 27/28 (96.43%), Query Frame = -2
Query:  288 ELWKITMHNLEKQVVLPPLSDPRQVRLN 371
            ELWKITMHNLEKQVVLPPLSDPRQ+ L+
Sbjct: 1782 ELWKITMHNLEKQVVLPPLSDPRQLFLS 1809          
The following BLAST results are available for this feature:
BLAST of SMED30025135 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UNC13B7.113e-1133.33unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:1256... [more]
UNC13B1.054e-1033.33unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:1256... [more]
UNC13B5.024e-1033.33unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:1256... [more]
UNC13B5.322e-1033.33unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:1256... [more]
UNC13B5.410e-1033.33unc-13 homolog B [Source:HGNC Symbol;Acc:HGNC:1256... [more]
back to top
BLAST of SMED30025135 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-131.622e-938.18Phorbol ester/diacylglycerol-binding protein unc-1... [more]
unc-131.622e-938.18Phorbol ester/diacylglycerol-binding protein unc-1... [more]
unc-131.834e-938.18Phorbol ester/diacylglycerol-binding protein unc-1... [more]
unc-131.849e-938.18Phorbol ester/diacylglycerol-binding protein unc-1... [more]
unc-131.880e-938.18Phorbol ester/diacylglycerol-binding protein unc-1... [more]
back to top
BLAST of SMED30025135 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-131.374e-934.29gene:FBgn0025726 transcript:FBtr0344971[more]
unc-131.466e-934.29gene:FBgn0025726 transcript:FBtr0089246[more]
unc-131.466e-934.29gene:FBgn0025726 transcript:FBtr0308805[more]
unc-131.466e-934.29gene:FBgn0025726 transcript:FBtr0089245[more]
unc-131.618e-934.29gene:FBgn0025726 transcript:FBtr0334487[more]
back to top
BLAST of SMED30025135 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR769778.11.216e-1136.84protein unc-13 homolog C-like [Source:NCBI gene;Ac... [more]
CR769778.11.216e-1136.84protein unc-13 homolog C-like [Source:NCBI gene;Ac... [more]
UNC13B4.984e-1143.75unc-13 homolog Bb (C. elegans) [Source:NCBI gene;A... [more]
unc13a9.783e-1131.25unc-13 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB... [more]
unc13a1.176e-1031.25unc-13 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of SMED30025135 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acaa12.020e-1043.64acetyl-CoA acyltransferase 1 [Source:Xenbase;Acc:X... [more]
acaa12.039e-1043.64acetyl-CoA acyltransferase 1 [Source:Xenbase;Acc:X... [more]
acaa12.332e-1043.64acetyl-CoA acyltransferase 1 [Source:Xenbase;Acc:X... [more]
acaa12.457e-1043.64acetyl-CoA acyltransferase 1 [Source:Xenbase;Acc:X... [more]
acaa12.616e-1043.64acetyl-CoA acyltransferase 1 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of SMED30025135 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Unc13b9.809e-1235.00unc-13 homolog B [Source:MGI Symbol;Acc:MGI:134227... [more]
Unc13b1.565e-1135.00unc-13 homolog B [Source:MGI Symbol;Acc:MGI:134227... [more]
Unc13b6.455e-1135.00unc-13 homolog B [Source:MGI Symbol;Acc:MGI:134227... [more]
Unc13b6.560e-1135.00unc-13 homolog B [Source:MGI Symbol;Acc:MGI:134227... [more]
Unc13b7.057e-1135.00unc-13 homolog B [Source:MGI Symbol;Acc:MGI:134227... [more]
back to top
BLAST of SMED30025135 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z1N9|UN13B_MOUSE3.576e-1035.00Protein unc-13 homolog B OS=Mus musculus OX=10090 ... [more]
sp|Q62769|UN13B_RAT1.011e-935.00Protein unc-13 homolog B OS=Rattus norvegicus OX=1... [more]
sp|Q8K0T7|UN13C_MOUSE2.239e-941.07Protein unc-13 homolog C OS=Mus musculus OX=10090 ... [more]
sp|O14795|UN13B_HUMAN2.242e-933.33Protein unc-13 homolog B OS=Homo sapiens OX=9606 G... [more]
sp|P27715|UNC13_CAEEL1.905e-838.18Phorbol ester/diacylglycerol-binding protein unc-1... [more]
back to top
BLAST of SMED30025135 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8G2861.399e-1650.00Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A0L8G1T31.453e-1650.00Uncharacterized protein (Fragment) OS=Octopus bima... [more]
A0A0L8G1T71.503e-1650.00Uncharacterized protein (Fragment) OS=Octopus bima... [more]
A0A0L8G2471.584e-1650.00Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A5K3F6A99.421e-1650.00Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of SMED30025135 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000045754.18.623e-1137.50pep primary_assembly:Astyanax_mexicanus-2.0:20:158... [more]
ENSAMXT00000036882.11.602e-1039.66pep primary_assembly:Astyanax_mexicanus-2.0:20:158... [more]
ENSAMXT00000049675.11.912e-1039.66pep primary_assembly:Astyanax_mexicanus-2.0:20:158... [more]
ENSAMXT00000017969.22.525e-1039.66pep primary_assembly:Astyanax_mexicanus-2.0:20:157... [more]
UNC13C9.081e-1036.84unc-13 homolog C [Source:HGNC Symbol;Acc:HGNC:2314... [more]
back to top
BLAST of SMED30025135 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025135 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025135 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO302331.226e-751.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30025135 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000005973.24.855e-1133.33unc-13 homolog A [Source:NCBI gene;Acc:101164968][more]
UNC13A1.681e-1035.48protein unc-13 homolog A [Source:NCBI gene;Acc:105... [more]
UNC13A3.072e-1035.48protein unc-13 homolog A [Source:NCBI gene;Acc:105... [more]
UNC13B4.315e-1039.66unc-13 homolog B [Source:NCBI gene;Acc:101167071][more]
unc13ba1.257e-938.10protein unc-13 homolog B-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of SMED30025135 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042667.12.152e-3998.39SMESG000042667.1[more]
SMESG000042667.12.229e-3998.39SMESG000042667.1[more]
SMESG000042667.12.401e-3998.39SMESG000042667.1[more]
SMESG000042667.12.436e-3998.39SMESG000042667.1[more]
SMESG000042667.12.462e-3998.39SMESG000042667.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025135 ID=SMED30025135|Name=SMED30025135|organism=Schmidtea mediterranea sexual|type=transcript|length=585bp
TTTAATTATTGTCAGTTAATTAATTTATTTATGTTCAAATTAAGCATTTG
GAAAACAAAGGAAAAAACTCCAATTCTGTTCTGTTCCAACGCAATATGCG
AACAAAGTACACAGAAATTACGATCCAAAAAAAGTAGAATAATGAATATT
TTCGCAGAGAAATTCATGTGTTTGGATAATGCTAATAAATGCCGAGTTCC
AGCACTTGGACTTCGATTCCTCACTGACAATCAATGCAACTCCAAAAATT
TTCAAAACAACAGAATTAAAAAAAACATTTATTTACAATTTAATCTTACT
TGTCTTGGATCACTTAAAGGTGGAAGAACAACTTGCTTTTCTAAATTATG
CATTGTAATTTTCCATAATTCCTAAAAGTTCAGAATTAAATTAATCGCTT
GAAAACCGTTTTCTCACAAATGGAGGTCAACGTAGATAAACTCGCATCGA
AATACTCCATTAATGGCCGAAGGATAATTTCCGACTCTTGTTCAATATGA
GCTTTCTGATTATTTTGGCTGCCTTTAAGATTCTGTAATAATTTTGCTAA
TTCAGAGATGTTGGCTACAATCTGAGAGATCGGAA
back to top

protein sequence of SMED30025135-orf-1

>SMED30025135-orf-1 ID=SMED30025135-orf-1|Name=SMED30025135-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
FNYCQLINLFMFKLSIWKTKEKTPILFCSNAICEQSTQKLRSKKSRIMNI
FAEKFMCLDNANKCRVPALGLRFLTDNQCNSKNFQNNRIKKNIYLQFNLT
CLGSLKGGRTTCFSKLCIVIFHNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR014772Munc13_dom-2