Tigger transposable element-derived protein 1

Overview
NameTigger transposable element-derived protein 1
Smed IDSMED30025127
Length (bp)2788
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tigger transposable element-derived protein 1 (SMED30025127) t-SNE clustered cells

Violin plots show distribution of expression levels for Tigger transposable element-derived protein 1 (SMED30025127) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tigger transposable element-derived protein 1 (SMED30025127) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tigger transposable element-derived protein 1 (SMED30025127) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025127

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30025127 dd_Smed_v4_40170_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025127 dd_Smed_v4_40170_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025127 dd_Smed_v4_6797_0_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD1 (tigger transposable element derived 1 [Source:HGNC Symbol;Acc:HGNC:14523])

HSP 1 Score: 322.013 bits (824), Expect = 2.449e-98
Identity = 170/334 (50.90%), Postives = 224/334 (67.07%), Query Frame = 2
Query:  689 SLIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLN--HPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSN-----PNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            SLI  MEK L++WIED  ++ +P+S + I+ KAL ++  +K     A    +A++++F AS+GWF  FK R   HNIK QGE  SADVEAA  YP+ LAKII+EGGY  +QIFN DET   WKKMP RT+I++ EK  PGFKA+KDR+TLLL +NA+GD+  KP+ I  S NPRALKN  KS LPV ++ N KA +T+ +F  WF   F P VE Y   K I FK+LL++DNAP HP+ L   +  + + F+P NTTSI+QP+DQG+ISTFK +Y+R TF   L  MDS+         +   WK FTIL+ IK +  S +E+K STL G WK+
Sbjct:   77 SLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFNSMK-----AERGVEAAEEKFEASRGWFMRFKERSHFHNIKAQGEAASADVEAAASYPEALAKIIDEGGYTKQQIFNVDETAFYWKKMPSRTFIAREEKSVPGFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRALKNYTKSTLPVLYKWNSKARMTAHLFTAWFTEYFKPTVETYCSEKKIPFKILLLIDNAPSHPRALMEIYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKALAAMDSDVSDGSGQSKLKTFWKGFTILDAIKNIRDSWEEVKLSTLTGVWKK 405          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 187.578 bits (475), Expect = 2.812e-50
Identity = 104/331 (31.42%), Postives = 176/331 (53.17%), Query Frame = 2
Query:  689 SLIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKD----LNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            S  E++++ ++ W     T  +P+S   I  K  K +        DA+      + +F AS GW   FK R G+     +G     D  AAR +  +  + +E+   + EQI+ AD+TGL WK +P RT   + ++   G +++++RI ++ C+NA+G +      + ++  PRA K  D S LPV + +   AW+  S+FR WF   FVP+V+ +LK K +  K +L+LD  P  P +     +   + + +LPPN TS+IQP+ QG+++T K +Y     Q  +D+  ++P +     WKN T+L+ I  V  +   +K ST+  +WK+
Sbjct:   74 STYEELDRVMIEWFNQQKTDGIPVS-GTICAKQAKFFF-------DAL----GMEGDFNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAAREFCGSFQEFVEKENLQPEQIYGADQTGLFWKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDLSNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPNEEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKYMDE-GNDPKI----FWKNLTVLDAIYEVSRAWNMVKSSTITKAWKK 387          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 187.578 bits (475), Expect = 2.812e-50
Identity = 104/331 (31.42%), Postives = 176/331 (53.17%), Query Frame = 2
Query:  689 SLIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKD----LNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            S  E++++ ++ W     T  +P+S   I  K  K +        DA+      + +F AS GW   FK R G+     +G     D  AAR +  +  + +E+   + EQI+ AD+TGL WK +P RT   + ++   G +++++RI ++ C+NA+G +      + ++  PRA K  D S LPV + +   AW+  S+FR WF   FVP+V+ +LK K +  K +L+LD  P  P +     +   + + +LPPN TS+IQP+ QG+++T K +Y     Q  +D+  ++P +     WKN T+L+ I  V  +   +K ST+  +WK+
Sbjct:   74 STYEELDRVMIEWFNQQKTDGIPVS-GTICAKQAKFFF-------DAL----GMEGDFNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAAREFCGSFQEFVEKENLQPEQIYGADQTGLFWKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDLSNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPNEEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKYMDE-GNDPKI----FWKNLTVLDAIYEVSRAWNMVKSSTITKAWKK 387          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: JRKL (JRK like [Source:HGNC Symbol;Acc:HGNC:6200])

HSP 1 Score: 184.882 bits (468), Expect = 2.506e-49
Identity = 107/331 (32.33%), Postives = 171/331 (51.66%), Query Frame = 2
Query:  689 SLIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKD--LNHPNVEI--AFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            S+ E++++A++ W      K  PIS   I  K  + + Y    + D           F  S GW   FK R  +  I ++ E  + D  A   +       IE    + EQI+NADETGL WK +P R  + K +   PG K+ ++R+T++ C+NA+G +  K   + ++  PR+ K+ D   LPV + +   AW+  SIFR WF   FVP+V  YL+ K +  K +L+LDN+P HP +  L   + +I   +LPPN  S+IQP DQG+I+T K  Y     Q  L++ +      +   WK  T+L+ +  +  +   +K  T++ +WK+
Sbjct:   74 SMYEELDRAMLEWFNQQRAKGNPIS-GPICAKRAEFFFYALGMDGD-----------FNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRISVIKGKCTVPGHKSIEERVTIMCCANATGLHKLKLCVVGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQNNLEEGND-----LKSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKK 387          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: JRK (Jrk helix-turn-helix protein [Source:HGNC Symbol;Acc:HGNC:6199])

HSP 1 Score: 165.236 bits (417), Expect = 1.750e-42
Identity = 93/276 (33.70%), Postives = 143/276 (51.81%), Query Frame = 2
Query:  695 IEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNI--DFKVLLILDNAPGHPK--DLNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYI 1510
            +E +++ L  W     ++ +P+S   +  KA   Y  ++ + P             + S GW   FK+R G+  +    E  SAD +AA  +      +  E G   EQ++NADETGL W+ +P+ T         PG K  KDR+T+L+C+NA+G +  KPL I +   PRA K +    LPV ++A   AWV   IF DWF + FVP V  + +   +  D K +L+LD++  HP+  +L   NV   FLP +  S++QP++QGI   F   +I
Sbjct:   86 LEHLDRVLYEWFLGKRSEGVPVSGPMLIEKAKDFYEQMQLTEP------------CVFSGGWLWRFKARHGIKKLDASSEKQSADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETGLFWRCLPNPT---PEGGAVPGPKQGKDRLTVLMCANATGSHRLKPLAIGKCSGPRAFKGIQ--HLPVAYKAQGNAWVDKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAVLLLDSSRAHPQEAELVSSNVFTIFLPASVASLVQPMEQGIRRDFMRNFI 344          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: kif6 (kinesin family member 6 [Source:Xenbase;Acc:XB-GENE-1014042])

HSP 1 Score: 169.859 bits (429), Expect = 4.399e-43
Identity = 107/325 (32.92%), Postives = 159/325 (48.92%), Query Frame = 2
Query:  704 MEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNI--DFKVLLILDNAPGHPKD--LNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWK 1666
            ++K LM WI     +  P+S + I  +A K +  L  S P               S GW+  FK R GL  + + GE  S +   A  + K L K++ +     EQ++NA +  L W+ +P +   +  +  + G +  K+R+T+L CSNA+G +  + L I +S NPRA K V     PV + AN +A +T  IF+DWF N FVPE   +     +  D KV+LILD+ P HP    L   NV    LPP+ TS IQPLDQGI+  FK  Y  +  Q +L   + N  M   +      I + I     +  ++ +  L   W+
Sbjct:  256 VDKVLMEWIRQRRRENFPLSRSLIMAQAKKFHVLLNISTPCEY------------SSGWYGKFKKRNGLSILSINGEKASEEYNVADNFVKKLNKLVSDEHLSAEQVYNAAKASLFWRHLPQKLVATAQKPPSSGLEDPKERLTVLACSNAAGTHKARLLVIGKSRNPRAFKGV--RVFPVTYTANKQAGITREIFQDWFENHFVPEARAHCMSVGLSQDAKVMLILDHCPTHPSAEFLVKDNVFAVCLPPDCTSFIQPLDQGILRLFKSNYKSEFLQRML--TECNKGMAGAQFQAKANIKDAIWTAALAWDKVDKQALIHGWR 564          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000046714.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460367.1:582927:585046:-1 gene:ENSXETG00000018570.1 transcript:ENSXETT00000046714.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 2.045e-30
Identity = 83/250 (33.20%), Postives = 125/250 (50.00%), Query Frame = 2
Query:  689 SLIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLNHPNVEIAFL 1438
            S  E+MEK L  W        +PIS   ++ KA+ I   L   N             F AS GW + FK R+ +    V GE+ S D++    +         EG Y+ + IFN DETGL +  +P +T+  + E    G K +K R+T+L  +NA G    KPL I +S+ PR  KNV+   LP  + AN KAW+T+ +F +      +  ++N ++++    K+LL LD  P HP  L+  NV++ F 
Sbjct:   74 SKYEQMEKLLQEWFAGLHASNVPISGIMLREKAVHIATRLGIDN-------------FTASNGWIDRFKKRYNVVYKAVCGESKSVDIDTVTNWKTNQLPCYLEG-YELKNIFNTDETGLFFNVLPGKTFCFRGEDCHGG-KLSKLRLTVLFTTNADGSEKLKPLVIGKSVKPRCFKNVN--TLPTNYTANTKAWMTTKLFEEQ-----MHLLDNRMRLQK--HKILLFLDRCPAHPPSLHLHNVKLVFF 299          

HSP 2 Score: 30.4166 bits (67), Expect = 2.045e-30
Identity = 21/42 (50.00%), Postives = 28/42 (66.67%), Query Frame = 3
Query:  489 KRKFITLDDKIKILDRLSS--GEKAALIAKSLSLNESTIRTI 608
            KRK ++L++KI ILDR  S  G + AL AK L +  ST+ TI
Sbjct:    7 KRKSLSLEEKIAILDRADSYHGTRVAL-AKELGIPVSTLGTI 47          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: apmapl (adipocyte plasma membrane associated protein LIKE [Source:Xenbase;Acc:XB-GENE-5754317])

HSP 1 Score: 119.398 bits (298), Expect = 6.310e-29
Identity = 83/328 (25.30%), Postives = 154/328 (46.95%), Query Frame = 2
Query:  698 EKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETG--SADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHP--KDLN--HPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSW 1663
            E++++A+  W      + +P+S   I+ +A    A+ K+   D           F AS GWF  ++ R G+ + ++ GE+     +++   ++P+     + + GY                                      D +T+LL +N +G +  KPL + +  +P +L++ ++ K P  +  +  AWVT  + R+WFL  FVP V+ YLK   +  K +L+++  PG P  +DL     N+ + FL   T S I  +DQG+IS+FK+ Y R+  +L++   DS+P+  VT    +F + + I +   S   ++  ++   W
Sbjct:   78 EEIDRAVYSWFISLRQQGIPLSGPIIQAQA---EAFAKQIYGDECT--------FKASHGWFWRWQKRHGISSQRIYGESEVRQTEMDPVIIFPEQPNTPVADSGYG-------------------------------------DEVTVLLAANLTGSHKLKPLVVGKLRDPPSLRHHNQDKFPAVYHYSRNAWVTQELLREWFLEEFVPAVKRYLKRCCLQQKAVLLVNQCPGKPPEEDLQTADGNIRVLFLSKTTRSKIPSMDQGVISSFKQLYRRELLKLMV-SCDSSPSDFVT----SFRLKDMIYLAGQSWNMIQAGSIEKCW 352          

HSP 2 Score: 30.0314 bits (66), Expect = 6.310e-29
Identity = 17/67 (25.37%), Postives = 36/67 (53.73%), Query Frame = 3
Query:  480 PTLKRKFITLD--DKIKILDRLSSGEKAALIAKSLSLNESTIRTIKQIENKIRNSVIA-GSSISTKR 671
            P  K++ +T    DK++ ++R+ +GE+ A +++   +   T+R   + E K+R  +   G  + T R
Sbjct:    3 PFSKKQILTYSIKDKLEAIERVKNGERQASVSRDFGVPGGTLRGWLKDEQKLRWFLDQLGGDVGTHR 69          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Jrkl (Jrk-like [Source:MGI Symbol;Acc:MGI:1924782])

HSP 1 Score: 182.956 bits (463), Expect = 7.985e-49
Identity = 107/331 (32.33%), Postives = 171/331 (51.66%), Query Frame = 2
Query:  689 SLIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKD--LNHPNVEI--AFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            S+ E+++KA++ W      K  PIS   I  K  + + Y    + D           F  S GW   FK R  +  I ++ E  + D  A   +       IE+   + EQI+NADETGL WK +P RT + K +   PG    ++RIT++ C+NA+G +  K   + ++  PR+ K+ D   LPV + +   AW+  SIFR WF   FVP+V  YL+ K +  K +L+LDN+P HP +  L   + +I   +LPPN  S+IQPL QG+I+  K  Y      L+ + ++   ++     WK  T+L+ +  +  +   +K  T++ +WK+
Sbjct:   74 SMYEELDKAMLEWFNQQRAKGNPIS-GPICAKRAEFFFYALGMDGD-----------FNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIEQENLQPEQIYNADETGLFWKCLPSRTTVIKGKCTVPGHNLGEERITVMCCTNATGLHKLKLCVVGKARKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPLGQGVIAAMKRNY---RAGLLHNNLEEGNDL--KSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKQ 387          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Tigd2 (tigger transposable element derived 2 [Source:MGI Symbol;Acc:MGI:1915390])

HSP 1 Score: 178.333 bits (451), Expect = 3.527e-47
Identity = 95/331 (28.70%), Postives = 166/331 (50.15%), Query Frame = 2
Query:  689 SLIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKD----LNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            S  E++++ ++ W     T  +P+S      +A   +  L              + +F AS GW   FK R G+     +G     D  AA  +     + +E      EQI+ AD+TGL WK +P RT     ++    ++ +++RI ++ C+NA+G +      + ++  PRA K  D S LPV + +   AW+  S+ + WF  CFVP+V+ +LK K +  K +L+LD    HP +     +   + + +LPPN TS+IQP+ QG+++T K +Y     Q  +D+  ++P       WKN T+L+ I     +  +++ +T+  +WK+
Sbjct:   74 STYEELDRVMIEWFNQQKTDGIPVSGTICAKQARFFFDAL------------GMEGDFNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAASEFCGNFQEFVERENLLPEQIYGADQTGLFWKCLPTRTLAFDTDQSTCEYRTSRERIIIMCCANATGSHKLNLCVVGKAKRPRAFKGTDLSNLPVTYFSQKSAWIEPSVLKQWFEKCFVPQVQKHLKSKGLREKAVLLLDFPAAHPAEELLSSDDGRIIVKYLPPNVTSLIQPMSQGVLTTVKRYYRAGLIQKYMDE-GNDPKT----FWKNLTVLDAIYEASRAWNQIRSNTITRAWKK 387          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Jrk (jerky [Source:MGI Symbol;Acc:MGI:106214])

HSP 1 Score: 160.999 bits (406), Expect = 3.691e-41
Identity = 88/276 (31.88%), Postives = 143/276 (51.81%), Query Frame = 2
Query:  695 IEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNI--DFKVLLILDNAPGHPK--DLNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYI 1510
            +E +++ L  W      + +P+S   +  KA   Y  ++ + P             + S GW   FK+R G+  +    E  +AD +AA  +      +  E G   EQ+++ADETGL W+ +P+    + ++   P FK  KDR+T+L+C+NA+G +  KPL I +   PRA + +    LP+ ++A   AWV   IF DWF + FVP V  + +   +  D K +L+LD++  H +  +L   NV   FLP + TS++QP +QGI   F   +I
Sbjct:   86 LEHLDRVLYEWFLVKRAEGIPVSGPMLIEKAKDFYKQMRLTEP------------CVFSGGWLWRFKARHGIKKLDASSEKQAADHQAAEQFCGFFRSLAAEHGLSPEQVYSADETGLVWRCLPNS---APDDGTVPHFKQGKDRLTVLMCANATGSHRIKPLAIGKGGGPRAFRGIQ--HLPIAYKAQGNAWVDKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAILLLDHSRAHSQESELVSENVFTIFLPSSVTSLLQPTEQGIRRAFMRLFI 344          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Tigd5 (tigger transposable element derived 5 [Source:MGI Symbol;Acc:MGI:2145902])

HSP 1 Score: 126.331 bits (316), Expect = 2.956e-32
Identity = 92/373 (24.66%), Postives = 167/373 (44.77%), Query Frame = 2
Query:  698 EKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKE-SNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARV----------------YPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYI-SKNEKVAPGFKAAK---DRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAP--------------------------GHPKDLNHPN--VEIAFLPPNTT--SIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSW 1663
            E++++A+  W        +P+S   I+ +A    A+ ++   P+           F AS GWF  ++ R G+ + ++ GE  S     A V                 P TL     EGGY  EQI+NA+ TGL W+ +P +       +   PG  + +   DR+T+LL +N +G +  KPL I +  +P +L++ ++ K P  +R +  AW++  + R WF   FVP V+ YL+   +  K +L++ + P                          G P++L  P+  V + FL   T+   I  PL+ G+++ FK  Y R+  +L +     +P     +  ++F + + + +   S   ++  ++   W
Sbjct:  132 EEIDRAVYSWFLTLRQHGVPLSGPVIQAQA---EAFARQIYGPECT---------FKASHGWFWRWQKRHGISSQRIYGEAESPVAGPAPVKEEPAQSPGAVLVPDGAPATLPH--SEGGYGDEQIYNANVTGLYWRLLPEQASTPGTGDSKEPGGCSRRWRSDRVTVLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDKFPASYRYSPDAWLSRPLLRGWFFEEFVPGVKRYLRRSCLQQKAVLLVAHPPCPSWATSMPPLEESEETPRQCQPELLGSPEELQTPDGAVRVLFLSKGTSRAHIPAPLEHGVVAAFKHLYKRELLRLAVSCASGSP----LDFMRSFVLKDMLYLAGLSWDLVQAGSIERCW 486          

HSP 2 Score: 33.8834 bits (76), Expect = 2.956e-32
Identity = 16/61 (26.23%), Postives = 33/61 (54.10%), Query Frame = 3
Query:  492 RKFITLDDKIKILDRLSSGEKAALIAKSLSLNESTIRTIKQIENKIRNSVIA-GSSISTKR 671
            RK  ++ DK++ ++R+  GE+ A + +   +   T+R   + E K+R  +   G  + T+R
Sbjct:   63 RKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLRGWLKDEPKLRWFLDQLGGEVGTQR 123          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Tigd4 (tigger transposable element derived 4 [Source:MGI Symbol;Acc:MGI:2685264])

HSP 1 Score: 116.316 bits (290), Expect = 1.454e-27
Identity = 88/327 (26.91%), Postives = 148/327 (45.26%), Query Frame = 2
Query:  704 MEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARV-YPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKRYSRR 1681
            +E+ALM W        +P++   ++ KA                  K    +F  S GW + FKSR+GL       E     ++ + V Y   L   + +  Y  + +FN  ETGL ++ +P  T+  K E  + G K  KDRITL L +N  G      L I ++  PR  K +    LPVY+ AN  AW+T++IF  W     + E     K +    +V++ +D+ P HP+  N  ++E+AF P   +S    ++QG+I + K  Y     +  L  ++S+   T       F++L+ +  +    + +   T+  S++    R
Sbjct:   87 LEEALMRWYRIAQCLNVPVNGPMLRLKAND-------------FAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGISIDPSTVWYQNVLPYYLND--YHPKNVFNVKETGLLYRMLPTNTFAFKGETCSVG-KLCKDRITLALGTNMDGSEKLPLLIIGKNRAPRCFKGI--KSLPVYYEANRTAWMTAAIFEQWMQK--LDE-----KFQAQKRRVVIFVDSCPAHPEVKNLKSIELAFFPSCLSSGFAAMNQGVIKSLKIKYRHCLIKKFLSSVESSKEFT-------FSLLDAVDTLHLCWRAVTPETIVKSYEEAGFR 381          

HSP 2 Score: 27.7202 bits (60), Expect = 1.454e-27
Identity = 13/47 (27.66%), Postives = 33/47 (70.21%), Query Frame = 3
Query:  489 KRKFITLDDKIKILDRLSSGEKAALIAKSLSLNESTIRTIKQIENKI 629
            K+K +++++KI I++ + SG+K A IA    + ++++ +I + ++K+
Sbjct:   17 KKKSLSIEEKIDIINAVESGKKKAEIAAEYGIKKNSLSSIMKNKDKV 63          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q96MW7|TIGD1_HUMAN (Tigger transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=TIGD1 PE=1 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 1.176e-97
Identity = 170/334 (50.90%), Postives = 224/334 (67.07%), Query Frame = 2
Query:  689 SLIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLN--HPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSN-----PNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            SLI  MEK L++WIED  ++ +P+S + I+ KAL ++  +K     A    +A++++F AS+GWF  FK R   HNIK QGE  SADVEAA  YP+ LAKII+EGGY  +QIFN DET   WKKMP RT+I++ EK  PGFKA+KDR+TLLL +NA+GD+  KP+ I  S NPRALKN  KS LPV ++ N KA +T+ +F  WF   F P VE Y   K I FK+LL++DNAP HP+ L   +  + + F+P NTTSI+QP+DQG+ISTFK +Y+R TF   L  MDS+         +   WK FTIL+ IK +  S +E+K STL G WK+
Sbjct:   77 SLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFNSMK-----AERGVEAAEEKFEASRGWFMRFKERSHFHNIKAQGEAASADVEAAASYPEALAKIIDEGGYTKQQIFNVDETAFYWKKMPSRTFIAREEKSVPGFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRALKNYTKSTLPVLYKWNSKARMTAHLFTAWFTEYFKPTVETYCSEKKIPFKILLLIDNAPSHPRALMEIYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKALAAMDSDVSDGSGQSKLKTFWKGFTILDAIKNIRDSWEEVKLSTLTGVWKK 405          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q4W5G0|TIGD2_HUMAN (Tigger transposable element-derived protein 2 OS=Homo sapiens OX=9606 GN=TIGD2 PE=3 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.350e-49
Identity = 104/331 (31.42%), Postives = 176/331 (53.17%), Query Frame = 2
Query:  689 SLIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKD----LNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            S  E++++ ++ W     T  +P+S   I  K  K +        DA+      + +F AS GW   FK R G+     +G     D  AAR +  +  + +E+   + EQI+ AD+TGL WK +P RT   + ++   G +++++RI ++ C+NA+G +      + ++  PRA K  D S LPV + +   AW+  S+FR WF   FVP+V+ +LK K +  K +L+LD  P  P +     +   + + +LPPN TS+IQP+ QG+++T K +Y     Q  +D+  ++P +     WKN T+L+ I  V  +   +K ST+  +WK+
Sbjct:   74 STYEELDRVMIEWFNQQKTDGIPVS-GTICAKQAKFFF-------DAL----GMEGDFNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAAREFCGSFQEFVEKENLQPEQIYGADQTGLFWKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDLSNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPNEEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKYMDE-GNDPKI----FWKNLTVLDAIYEVSRAWNMVKSSTITKAWKK 387          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q9Y4A0|JERKL_HUMAN (Jerky protein homolog-like OS=Homo sapiens OX=9606 GN=JRKL PE=2 SV=2)

HSP 1 Score: 184.882 bits (468), Expect = 1.204e-48
Identity = 107/331 (32.33%), Postives = 171/331 (51.66%), Query Frame = 2
Query:  689 SLIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKD--LNHPNVEI--AFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            S+ E++++A++ W      K  PIS   I  K  + + Y    + D           F  S GW   FK R  +  I ++ E  + D  A   +       IE    + EQI+NADETGL WK +P R  + K +   PG K+ ++R+T++ C+NA+G +  K   + ++  PR+ K+ D   LPV + +   AW+  SIFR WF   FVP+V  YL+ K +  K +L+LDN+P HP +  L   + +I   +LPPN  S+IQP DQG+I+T K  Y     Q  L++ +      +   WK  T+L+ +  +  +   +K  T++ +WK+
Sbjct:   74 SMYEELDRAMLEWFNQQRAKGNPIS-GPICAKRAEFFFYALGMDGD-----------FNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRISVIKGKCTVPGHKSIEERVTIMCCANATGLHKLKLCVVGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQNNLEEGND-----LKSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKK 387          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|B2RRL2|JERKL_MOUSE (Jerky protein homolog-like OS=Mus musculus OX=10090 GN=Jrkl PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 5.585e-48
Identity = 107/331 (32.33%), Postives = 171/331 (51.66%), Query Frame = 2
Query:  689 SLIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKD--LNHPNVEI--AFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            S+ E+++KA++ W      K  PIS   I  K  + + Y    + D           F  S GW   FK R  +  I ++ E  + D  A   +       IE+   + EQI+NADETGL WK +P RT + K +   PG    ++RIT++ C+NA+G +  K   + ++  PR+ K+ D   LPV + +   AW+  SIFR WF   FVP+V  YL+ K +  K +L+LDN+P HP +  L   + +I   +LPPN  S+IQPL QG+I+  K  Y      L+ + ++   ++     WK  T+L+ +  +  +   +K  T++ +WK+
Sbjct:   74 SMYEELDKAMLEWFNQQRAKGNPIS-GPICAKRAEFFFYALGMDGD-----------FNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIEQENLQPEQIYNADETGLFWKCLPSRTTVIKGKCTVPGHNLGEERITVMCCTNATGLHKLKLCVVGKARKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPLGQGVIAAMKRNY---RAGLLHNNLEEGNDL--KSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKQ 387          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q0VBL1|TIGD2_MOUSE (Tigger transposable element-derived protein 2 OS=Mus musculus OX=10090 GN=Tigd2 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.467e-46
Identity = 95/331 (28.70%), Postives = 166/331 (50.15%), Query Frame = 2
Query:  689 SLIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKD----LNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            S  E++++ ++ W     T  +P+S      +A   +  L              + +F AS GW   FK R G+     +G     D  AA  +     + +E      EQI+ AD+TGL WK +P RT     ++    ++ +++RI ++ C+NA+G +      + ++  PRA K  D S LPV + +   AW+  S+ + WF  CFVP+V+ +LK K +  K +L+LD    HP +     +   + + +LPPN TS+IQP+ QG+++T K +Y     Q  +D+  ++P       WKN T+L+ I     +  +++ +T+  +WK+
Sbjct:   74 STYEELDRVMIEWFNQQKTDGIPVSGTICAKQARFFFDAL------------GMEGDFNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAASEFCGNFQEFVERENLLPEQIYGADQTGLFWKCLPTRTLAFDTDQSTCEYRTSRERIIIMCCANATGSHKLNLCVVGKAKRPRAFKGTDLSNLPVTYFSQKSAWIEPSVLKQWFEKCFVPQVQKHLKSKGLREKAVLLLDFPAAHPAEELLSSDDGRIIVKYLPPNVTSLIQPMSQGVLTTVKRYYRAGLIQKYMDE-GNDPKT----FWKNLTVLDAIYEASRAWNQIRSNTITRAWKK 387          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A4Y2B316 (Tigger transposable element-derived protein 1 OS=Araneus ventricosus OX=182803 GN=TIGD1_66 PE=4 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 2.183e-134
Identity = 169/326 (51.84%), Postives = 242/326 (74.23%), Query Frame = 2
Query:  689 SLIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWK 1666
            + +E MEKAL+ W+E+   KK+PI  +AI+ KA++I+  +K   P     T     EF  SKGW E FK RF L N K++GE    D +AA  YPK  +KII++G Y  +Q+FNA+E GL WKKMP RTY+S++E+   GFKA+K+RIT+LLCSNASGDY+ KP+ I+RSLNPRA+K++DK  LPVYW+A+ K  VT  IFRDWF NCFV +VE Y+K KN+ FKVLL++D+AP HP DL+H NV++ FLPPNT S+IQPL++ I +TF  +YI+  F+ I+D+++S   ++VT +W+N++I++C+++++ ++ E+K+STLN  WK
Sbjct:   76 TTLELMEKALIHWVEENIQKKIPIEGDAIRQKAVEIFNNIKAKQP----ATSNQATEFSGSKGWLERFKKRFSLCNAKIRGEVAITDEKAATEYPKEFSKIIQDGAYTPDQVFNANEMGLFWKKMPRRTYLSQSERSNAGFKASKERITVLLCSNASGDYLMKPMVISRSLNPRAMKSLDKGNLPVYWKADNKTCVTVPIFRDWFYNCFVSDVELYVKEKNLSFKVLLLIDSAPRHPTDLHHDNVKVVFLPPNTASLIQPLERSIFTTFNAYYIKHIFKRIVDEVNSGNTLSVTRVWENYSIVDCVELIKLAITEIKKSTLNACWK 397          

HSP 2 Score: 82.4185 bits (202), Expect = 2.183e-134
Identity = 46/143 (32.17%), Postives = 82/143 (57.34%), Query Frame = 1
Query: 1642 VHAKWLMEKI*PEIVAKNNPVPPLRVEVSRILTLGQRFSGEGFDDMNEDDIYEIMNEGTELTETDLIQLTTESPSVSNLAQDDVTSVEDISESIPSFTLKCIREGLSLVEKMKSFFTTNDPSLERSSKLMREIDINLAPYYEI 2070
            ++A W  + I P++V   + VP L  E S I+ L  R  GEGFDDM  +++ E+M + +E      +++  +S S    ++D+     D  E +P  TL  I +GL++ +++++FF  NDP+++RS K  RE+   +A Y ++
Sbjct:  392 LNACW--KSIWPDVVVSGHDVPALENEYSEIMRLAHRVGGEGFDDMASNELEELMTD-SEFNAAKQVEVVFDSTS----SEDET----DCDEKVPRLTLCTIDKGLAMAKELENFFIQNDPNMDRSLKFARELHNCMASYKKL 523          

HSP 3 Score: 78.1814 bits (191), Expect = 2.183e-134
Identity = 42/71 (59.15%), Postives = 52/71 (73.24%), Query Frame = 3
Query:  477 KPTLKRKFITLDDKIKILDRLSSGEKAALIAKSLSLNESTIRTIKQIENKIRNSVIAGSSISTKRVARVRD 689
            K  LKRK ITL+ KI+ILDRL +GE ++ +AK   LNE+T+RTIK+ E KIR SV AG S S KR + VRD
Sbjct:    5 KQGLKRKRITLETKIQILDRLKTGEGSSSVAKHFELNEATVRTIKKNEEKIRASVAAGCSESLKRTSHVRD 75          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A2P2I463 (Tigger transposable element-derived protein 1-like (Fragment) OS=Hirondellea gigas OX=1518452 PE=2 SV=1)

HSP 1 Score: 402.905 bits (1034), Expect = 6.238e-126
Identity = 186/328 (56.71%), Postives = 243/328 (74.09%), Query Frame = 2
Query:  692 LIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPK---DLNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWK 1666
            ++EKMEKAL +WIED   K+ P+S   I+TKAL +Y Y+++ + DA   +KA+   F AS+GWF+ F+ R  LHN+K+ GE  SAD + A  Y     ++IEE GYK EQ+FNADETGL WKKMP RTYIS+ EKVAPGFKAAKDR+TL++C+NASGD++ KP+ + RSLNPRAL   +K  LPV+WR+N KAWVT+ +F DWF NCFV EVE YL  KN+ FKVLL+LDNAPGHP       HPNVE+ FLPPNTTS+IQP+DQG+I+TFK +Y R+TF  + + M+ N ++T+   WK + I  CI+ V  S++E+K +TLNG WK
Sbjct:   87 VLEKMEKALNIWIEDQTQKRAPLSTALIRTKALNLYQYMQQ-DSDAEEASKATP--FSASRGWFDRFRKRACLHNVKLAGEAASADTDGAEKYKAVFKEMIEEKGYKPEQVFNADETGLFWKKMPQRTYISQEEKVAPGFKAAKDRLTLMMCANASGDFVVKPMMLYRSLNPRALAGKNKQHLPVFWRSNKKAWVTADVFMDWFNNCFVHEVEKYLVSKNLAFKVLLLLDNAPGHPSQRLQFAHPNVEVQFLPPNTTSLIQPMDQGVIATFKAYYTRRTFSRLFNAMELNESLTIINAWKKYDIAACIENVRESVEEMKVTTLNGCWK 411          

HSP 2 Score: 66.2402 bits (160), Expect = 2.533e-7
Identity = 33/66 (50.00%), Postives = 45/66 (68.18%), Query Frame = 3
Query:  492 RKFITLDDKIKILDRLSSGEKAALIAKSLSLNESTIRTIKQIENKIRNSVIAGSSISTKRVARVRD 689
            RK ++L  K+++LDRL++GE  A + +S  +NEST+RTIKQ E KIR SV AG +   K V   RD
Sbjct:   20 RKVLSLQSKVELLDRLANGESVASVGRSFEINESTVRTIKQNEVKIRASVSAGGTPGAKSVHTTRD 85          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A2A4JVK0 (HTH CENPB-type domain-containing protein OS=Heliothis virescens OX=7102 GN=B5V51_10937 PE=4 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 6.523e-126
Identity = 193/327 (59.02%), Postives = 245/327 (74.92%), Query Frame = 2
Query:  695 IEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLN--HPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            IEKME AL LWIED   K++P+S   I+ KA ++YA+ KE  P A    + + + F AS+GWF  FK R  LHNIK+ GE   AD  AA  YP+  A ++ +GGY  EQIFNADETGL WK+MP++ +ISK+EK APGFKAAKDR+TLLLCSNASGD + KPL + R LNPRAL+N +K  LPV+WRA+ KAWVTS++F DWF NCFVPEVE YLK KN+DFK +L+LDNAPGHP++L   HPN+++ FLPPNTT+++QP+DQGII  FK +YIR+TF+ ILD M+ NP+M+V E WK F I  CI  ++ SL+ELK  TL   WK+
Sbjct:   79 IEKMEVALSLWIEDRNQKRVPLSGPMIREKAKRLYAHFKE--PGASSGGECTDRGFQASEGWFNKFKMRQSLHNIKIVGEAAYADTAAAERYPEEFANLVADGGYTPEQIFNADETGLFWKRMPNKIFISKSEKSAPGFKAAKDRVTLLLCSNASGDCVIKPLMLYRCLNPRALQNQNKDNLPVFWRADKKAWVTSAVFCDWFRNCFVPEVETYLKSKNLDFKAVLVLDNAPGHPRELGTMHPNIKVTFLPPNTTALLQPMDQGIIQAFKLYYIRRTFKFILDNMECNPDMSVMECWKKFDIAKCIINIKESLQELKPHTLKSCWKK 403          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A4C1YWZ6 (Tigger transposable element-derived protein 1 OS=Eumeta variegata OX=151549 GN=TIGD1 PE=4 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 2.942e-125
Identity = 194/327 (59.33%), Postives = 244/327 (74.62%), Query Frame = 2
Query:  695 IEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLN--HPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            +EKME AL LWIED   K+MP+S   ++ KA ++YA+ KE  PD     + +   F AS+GWF  FK R  LHNIK+ GE  SAD  AA  YP+  A ++ +G YK EQ+FNADET L WK+MP++T+ISK+EK APGFKAAKDR+TLLLCSNASGD + KPL + RS NPRALKN +K  LPV+WRAN KAWVTS+IF DWF NCFV EVE YLK +N+DFK LL+LDNAPGHP++L   HPN+++ FLPPNTT+++QP+DQGII  FK +YIR+TF++ILD M+ NP+M V E WK F I  CI  ++ SL+ELK  TL   WK+
Sbjct:   54 VEKMEVALSLWIEDRNQKRMPLSGPMVREKAKRLYAHFKE--PDGSFSGECTDGGFQASEGWFNKFKVRQSLHNIKIIGEAASADTAAAGRYPEEFANLVADGEYKPEQVFNADETALFWKRMPNKTFISKSEKSAPGFKAAKDRVTLLLCSNASGDCVIKPLMLYRSFNPRALKNQNKDNLPVFWRANKKAWVTSAIFCDWFRNCFVSEVETYLKKQNLDFKALLVLDNAPGHPRELETMHPNIKVTFLPPNTTALLQPMDQGIIQAFKLYYIRRTFKIILDNMECNPDMNVMECWKKFDIAKCIVNIKESLEELKLHTLKCCWKK 378          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A212FGJ6 (Putative Tigger transposable element-derived protein 2 OS=Danaus plexippus plexippus OX=278856 GN=KGM_205246 PE=4 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 2.718e-116
Identity = 169/297 (56.90%), Postives = 227/297 (76.43%), Query Frame = 2
Query:  776 KTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWK 1666
            + KA KI+ +LKE      + +   K +F++S G FE F+ RF LH+I++QGE  SAD E+AR + + L KII+EG Y  +Q++NADETGL WK+MP RTY+S+NE+ A G KA+K+RITLL+CSNASGD+ITKP+ INR L+PRA+K +DK+ LPV+WRAN  AWVT+ IF DWF NCFVPEVENY K KN+  K LL++D+AP HP DL HPNV++ FLP NTTSI+QPLDQG++ T K  YIR+T +LI +K +  P+M + E+WK+F+IL C++++  S++ELK STLN  WK
Sbjct:  108 EAKAQKIFTHLKEL---ETVSSDEPKSKFVSSNGCFERFRKRFSLHSIQIQGERASADYESARNFKEELPKIIDEGEYTADQVYNADETGLYWKRMPKRTYLSENERSAGGLKASKERITLLVCSNASGDHITKPMLINRFLSPRAMKGIDKTTLPVHWRANENAWVTADIFHDWFYNCFVPEVENYSKTKNVSSKALLLIDDAPQHPVDLVHPNVKVLFLPANTTSILQPLDQGVMKTIKSHYIRRTLELISEKFECKPDMKLAEMWKDFSILKCVELICLSVRELKSSTLNACWK 401          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005656.1 (pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1 gene:ENSPMAG00000005132.1 transcript:ENSPMAT00000005656.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 263.077 bits (671), Expect = 4.409e-78
Identity = 134/326 (41.10%), Postives = 194/326 (59.51%), Query Frame = 2
Query:  692 LIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            L+E ME++L +WI+     +MP+S   I+ KAL+++   K+   ++     A+ + F AS GW+  FK R+ L ++K+ GET  ADVEAA  +  TL +IIE GGY  EQ+FN +ETGL WK+MP  T++S+ EK APGFKA+KDR+ LL+ +NA+GD   KPL +  S  PRALK   K+ LPV WR+N K W+T+S+F DW  N F P +E Y K KN+D K LL+L+NAPGHP  L                          S   E ++R T + I+   D +   T+ E W+++ I++ I  +  +  E+ Q+TLN  W +
Sbjct:   79 LMENMEESLGMWIKHQNEHRMPLSTALIQAKALRLFNDFKKRAGES-----AANETFGASTGWYAKFKGRYNLRHLKMTGETAGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNETGLFWKRMPASTFLSREEKTAPGFKASKDRLALLVGANAAGDCKLKPLLVYHSKTPRALKGCIKADLPVIWRSNKKGWITASVFLDWLKNHFCPAIEKYCKKKNLDHKALLLLNNAPGHPPTL--------------------------SELSE-HVRGTMEQIVANTDKDV-QTIREFWRSYNIMDAIDNINEAWNEVAQTTLNACWGK 371          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001313.1 (pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gene:ENSPMAG00000001181.1 transcript:ENSPMAT00000001313.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 231.876 bits (590), Expect = 4.451e-68
Identity = 126/326 (38.65%), Postives = 181/326 (55.52%), Query Frame = 2
Query:  692 LIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            L+E ME++L +WI+     +MP+S   I+ KAL     L+       L      + F AS GW+  FK R+ LH++K+ GET  ADVEAA  +  TL +IIE GGY  EQ+FN +ET L WK+MP  T++S+ +K APGFKA+KDR+ LL+ +N +GD   KPL +  S  PR LK   K+ LP+ WR+N K W+T+S+F DW  N F P +E Y K KN+D K LL+ +NAPGHP                T S +    + + +T K+  I                  + E W ++ I++ I  +  +  E+ Q+TLN  W +
Sbjct:   79 LMENMEESLGMWIKHQNEHRMPLSTALIQVKALIQAKALR-------LEESRQAETFGASTGWYAKFKGRYNLHHLKMTGETAGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNETRLFWKRMPASTFLSREKKTAPGFKASKDRLALLVGANGAGDCRLKPLLVYHSKTPRYLKGCIKADLPI-WRSNKKGWITASVFLDWLKNHFCPAIEKYCKKKNLDLKALLLRNNAPGHPP---------------TPSELSEHVKIVANTDKDVQI------------------IREFWHSYNIMDAIDNINEAWNEVAQTTLNAYWGK 363          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010132.1 (pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 gene:ENSPMAG00000009170.1 transcript:ENSPMAT00000010132.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 231.876 bits (590), Expect = 5.741e-68
Identity = 126/326 (38.65%), Postives = 181/326 (55.52%), Query Frame = 2
Query:  692 LIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            L+E ME++L +WI+     +MP+S   I+ KAL     L+       L      + F AS GW+  FK R+ LH++K+ GET  ADVEAA  +  TL +IIE GGY  EQ+FN +ET L WK+MP  T++S+ +K APGFKA+KDR+ LL+ +N +GD   KPL +  S  PR LK   K+ LP+ WR+N K W+T+S+F DW  N F P +E Y K KN+D K LL+ +NAPGHP                T S +    + + +T K+  I                  + E W ++ I++ I  +  +  E+ Q+TLN  W +
Sbjct:   78 LMENMEESLGMWIKHQNEHRMPLSTALIQVKALIQAKALR-------LEESRQAETFGASTGWYAKFKGRYNLHHLKMTGETAGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNETRLFWKRMPASTFLSREKKTAPGFKASKDRLALLVGANGAGDCRLKPLLVYHSKTPRYLKGCIKADLPI-WRSNKKGWITASVFLDWLKNHFCPAIEKYCKKKNLDLKALLLRNNAPGHPP---------------TPSELSEHVKIVANTDKDVQI------------------IREFWHSYNIMDAIDNINEAWNEVAQTTLNAYWGK 362          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003283.1 (pep scaffold:Pmarinus_7.0:GL479064:1419:3178:1 gene:ENSPMAG00000003000.1 transcript:ENSPMAT00000003283.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 222.631 bits (566), Expect = 3.676e-63
Identity = 126/331 (38.07%), Postives = 187/331 (56.50%), Query Frame = 2
Query:  692 LIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKES-NPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPK---DLNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDS-NPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            ++E+ E+ L LWIE    ++   S   IK KAL IY  LK+   PD V       Q F AS  W   FK RF LHN K+  E  SAD   A  +P  L ++I+EGGY                        S +   APG +AAKDR+T++L +NASG Y  KP+ ++ S NPR LK   ++ L V++R++ + W+T  +F D+ L     E+  Y K KN DFK+LL++DNAP HP    DL+   +++ FLPP+TTS++QP+ QG+I+ FK +Y+R+TF ++++  D  N   +VT  W++F I   I I+  +  ++ Q  LNG  ++
Sbjct:   74 IVEETERLLSLWIESQTKRRSGPSFLTIKQKALSIYEDLKKKCKPDNV-------QPFNASSEWLAGFKKRFDLHNAKLTVEAASADAAVAANFPDALNRVIDEGGY------------------------SPDRATAPGLRAAKDRLTVMLGANASGGYRLKPVVVHHSANPRTLKGFVRADLGVHFRSSKRGWMTDQMFTDYVLETLQDELRRYCKRKNQDFKILLVVDNAPSHPPYIVDLSE-QIKVVFLPPHTTSLLQPMGQGVIAAFKAYYLRRTFAMLIEATDGENSQASVT--WRSFNIKQAIDIIVEAWTDITQPCLNGVCRK 370          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004972.1 (pep scaffold:Pmarinus_7.0:GL476545:74372:75575:-1 gene:ENSPMAG00000004517.1 transcript:ENSPMAT00000004972.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 214.542 bits (545), Expect = 3.121e-62
Identity = 133/326 (40.80%), Postives = 184/326 (56.44%), Query Frame = 2
Query:  695 IEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDL--NHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWK 1666
            +E+ME+ L+ W+ED   K+MP+S+  I+ KA  ++  LK+   DA     A           F   K+    H+IK+ G   SAD E A  +   L KII E  Y  EQIFN DETG + K M              GFKA KDR+TLLL  N +  Y  KP  I  S N RAL  + K+ LPV++R N KAW+T+ +F DWF+NCF+PEV+ + +   I FK++LILDNAPGH + +  N PNV + FLPPNTTSIIQP+DQG ++         T Q +L +  +     +  +WK   +LN I+ +  + KE+ +  +NG WK
Sbjct:   66 LEEMEQLLVTWMEDRIQKRMPLSLLTIQAKARMLFYDLKKRYDDATYNVTAG----------FSVSKTCHNFHSIKISGAAASADAEGAERFKGELHKIIVEENYLPEQIFNVDETGTDAKTMA-------------GFKAFKDRLTLLLGGNVAV-YKLKPFMIYHSTNARALARISKNMLPVHYRHNKKAWMTAVLFEDWFVNCFIPEVKEHCRKNGIPFKIMLILDNAPGHLQYIGDNDPNV-VVFLPPNTTSIIQPMDQGAVA---------TSQGLLSEKHATEEKELRMIWKESNVLNAIRNIGRAWKEVTKECMNGIWK 357          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Match: EDO44738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ6])

HSP 1 Score: 145.206 bits (365), Expect = 8.810e-38
Identity = 91/271 (33.58%), Postives = 139/271 (51.29%), Query Frame = 2
Query:  854 QEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIE-EGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLNHPNVEIAFL---PPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKM-DSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTL 1651
            ++F AS GW E F+ R G+      G + S    +  V  +   KI+E   GY+   I+N  ETGL ++ +P +  + + E  +       +R+T+ LC N  G++  KPL I  + NP     +D   LPV WRAN +AW+T+SIF DW             K++  D ++LL LDN+P HP  L   NV++ FL     NT + +QPL QGI+  F+  Y R+     L K+ DSN   +  +L +  T L+    +  +L E+  ST+
Sbjct:  110 KDFRASNGWLEGFRRRHGISF----GASFSGYETSVNVTTEWTEKIMEVTDGYRSTDIYNLVETGLYYRALPDKNLVPETESTS------TERLTVTLCCNMDGEF-EKPLVIGPTANPPCFAKLDSECLPVIWRANRRAWITTSIFADWLRTL-------DRKMRQKDRRILLFLDNSPPHPPTLQLTNVKLVFLIKPSNNTVNQLQPLTQGIVEAFRMAYRRKVLFSTLAKLDDSNSPRSAKQLMQEITELDACFWIAATLDEISGSTM 362          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Match: EDO40000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8J7])

HSP 1 Score: 84.3445 bits (207), Expect = 6.456e-18
Identity = 73/254 (28.74%), Postives = 117/254 (46.06%), Query Frame = 2
Query:  698 EKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPK-TLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLF-INRSLNPRALKNVDKSKLPVYWRANCKAWV-TSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLNHPNVEIAFLPPNT 1450
            E +EKAL  W      + +PIS   +K  A+        +N    +V       F+ S GW + +K R  +    V GE  S  +E    + + TL  ++ +  Y  E +F+ADE GL +K +P +    K +    G K +K R+T L  +++SG+ +  P+F I +S  PR    V    LP  +RA  K W+  S++F +W         E     +     V L++DN P HP   N   +++  LPP +
Sbjct:   30 EDLEKALYTWSVRMKQQGVPISGPVLKETAIHF------ANELISIVLSG----FVGSNGWIDRWKKRQDVAFKTVSGEILSCTLEMTASWEESTLPTLLSK--YALEDMFDADEFGLFYKALPDKLMHLKLQSCVGG-KQSKVRLTGLAAASSSGEKL--PMFVIGKSQKPRCFSGV--RNLPCRYRAPKKGWILDSNLFEEWVR-------EQDRSFERPGRNVALVVDNGPAHPTVSNFKAIDLILLPPTS 259          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000031980.1 (pep primary_assembly:ASM223467v1:3:6881985:6888319:-1 gene:ENSORLG00000025652.1 transcript:ENSORLT00000031980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 284.263 bits (726), Expect = 3.407e-87
Identity = 137/270 (50.74%), Postives = 182/270 (67.41%), Query Frame = 2
Query:  860 FLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            F ASKGWFENFK +  ++N                        IIEEGGYK EQIFN DETGL WK+MP RT+I + E  APGFKA KDR+TL+ C NA+G ++ KP  I RS NPRALKN +K  L V W  N KAW+T ++  DWF NCF+P+V+ YL+ K +DFKVLL++DNA GH  DL +  V+I FLPPNTTS+IQP+DQGII  FK  Y R T Q ++D MDS+ + ++ + W+ +TI +C++ ++ +++E+K  TLN  WK+
Sbjct:   77 FNASKGWFENFKKQAFVNN--------------------KFKAIIEEGGYKPEQIFNIDETGLFWKRMPSRTFIMQEEAKAPGFKAQKDRLTLVKCGNAAG-FMIKPGLIYRSKNPRALKNKNKDDLHVCWMYNAKAWMTKALNLDWFKNCFIPQVKCYLRGKGLDFKVLLLVDNAGGHADDLAYDCVQIKFLPPNTTSLIQPMDQGIIRAFKALYTRNTLQHLVDAMDSDQDSSLKDYWRGYTIASCLQNIQRAIQEMKTETLNACWKK 325          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000036785.1 (pep primary_assembly:ASM223467v1:22:11796267:11802170:-1 gene:ENSORLG00000024024.1 transcript:ENSORLT00000036785.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 277.715 bits (709), Expect = 3.513e-83
Identity = 135/271 (49.82%), Postives = 186/271 (68.63%), Query Frame = 2
Query:  860 FLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAK-IIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWKR 1669
            F ASKGWF+ F+ RFGL ++ +QGE   AD   A  Y KT  K II+EG YK EQ+FN  ETGL WK++P       ++  A GF+  KDR+TL++C NA+G ++ KP  I+R  NPRALKN + S LPVYW  N  AW+T ++  +WF  CF+PEV+ YL  K +DFKVLL++DNA G   DL+H  V+I FLPPNT+S+IQP+DQGII TFK  Y R T Q ++D MDS+ N +  + W+ +TI +C++ ++ + +E+K  TLNG W++
Sbjct:  102 FYASKGWFDKFQKRFGLKSVSLQGEATPADAAGAEAYAKTKFKTIIKEGTYKPEQVFNMGETGLFWKQIP-------SQAKASGFRGQKDRVTLVMCGNAAG-FMIKPGLISRLKNPRALKNKNMSALPVYWMHNTMAWMTKALNLNWFKGCFIPEVKGYLTEKGLDFKVLLLIDNAGGFADDLSHDGVQIEFLPPNTSSLIQPMDQGIIRTFKALYTRNTLQHLVDAMDSDQNFSFKDYWREYTIASCLQHIQRAHQEMKSETLNGCWEK 364          

HSP 2 Score: 50.8322 bits (120), Expect = 6.111e-6
Identity = 26/70 (37.14%), Postives = 39/70 (55.71%), Query Frame = 3
Query:  480 PTLKRKFITLDDKIKILDRLSSGEKAALIAKSLSLNESTIRTIKQIENKIRNSVIAGSSISTKRVARVRD 689
            P  +RK +T+  K+ +LD L  G   + + +   LNEST+R IK+ EN IR +     +   KRV  VR+
Sbjct:    5 PKRQRKMLTVTQKVGLLDMLKEGRSYSAVGRHYGLNESTVRYIKKEENNIRRTAAISFNKDAKRVVTVRN 74          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000029563.1 (pep primary_assembly:ASM223467v1:22:22280271:22280612:-1 gene:ENSORLG00000027274.1 transcript:ENSORLT00000029563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 3.902e-9
Identity = 28/75 (37.33%), Postives = 48/75 (64.00%), Query Frame = 3
Query:  465 STAEKPTLKRKFITLDDKIKILDRLSSGEKAALIAKSLSLNESTIRTIKQIENKIRNSVIAGSSISTKRVARVRD 689
            ++  +P  ++K +TL +KI++LD+L  G+  + + +   LNEST+R IK+ E ++R+SV +    S K V  VRD
Sbjct:   11 ASGNEPKRQKKVLTLHEKIELLDKLMGGKSYSAVGRHYGLNESTVRYIKKNEKEVRSSVASVFCGSAKMVNVVRD 85          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000071434.1 (SMESG000071434.1)

HSP 1 Score: 120.553 bits (301), Expect = 3.504e-40
Identity = 66/144 (45.83%), Postives = 88/144 (61.11%), Query Frame = 2
Query:  692 LIEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAK 1123
            +IEKMEKAL +WI D   +++ +  N I+ KALK Y YLK++   +V        +FLASKGW E  K  F LH IK+QGE  SA   AA  YP+ + KIIE+ GY  +Q+FNADE GL W+K P   ++ +  K AP    A+
Sbjct:  196 IIEKMEKALSIWINDSCQERIRLDSNIIRQKALKTYNYLKQNRESSV------NPDFLASKGWLERVKKWFTLHKIKIQGEIASAYHAAAISYPEKILKIIEDQGYTWKQVFNADEIGLRWQKCPI-GHLYQENKTAPDLSFAE 332          

HSP 2 Score: 65.0846 bits (157), Expect = 3.504e-40
Identity = 36/71 (50.70%), Postives = 53/71 (74.65%), Query Frame = 3
Query:  483 TLKRKF---ITLDDKIKILDRLSSGEKAALIAKSLSLNESTIRTIKQIENKIRNSVIAGSSISTKRVARVR 686
             +KRK+   + +  K +ILDRL  GEKA+ IAK+L+LNE+T+RTIK+ E +IR +V AG S+S+K  +R+R
Sbjct:  123 NVKRKWSSKLMMKMKKQILDRLLKGEKASHIAKTLNLNEATVRTIKKKEKEIRCAVAAGCSLSSKYSSRLR 193          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000027161.1 (SMESG000027161.1)

HSP 1 Score: 155.221 bits (391), Expect = 4.931e-38
Identity = 92/260 (35.38%), Postives = 134/260 (51.54%), Query Frame = 2
Query:  704 MEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNE-KVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKD--LNHPNVEIAFLPPNTTSIIQPLD 1474
            ++  L  W     ++++PIS   +K +A K    +                +F AS GW + FK R  +  + V GE  SAD +AA  YP  L K +EEG Y  +Q++N DET L +K +P+RT+ +K +     GFK  KDR+TLL C N SG +  +PL I +S  PR    V+    P  +  +  AW+ ++ F DWF   FVP+V  +L+   ++ K  LILDN P HPK   L   + E    P +T S+ Q  D
Sbjct:  272 LDSDLYQWFVQARSERVPISGPILKAQAEKFNRRIN-----------GEDSKFKASNGWLDRFKKRHAISQVLVLGEIRSADKDAANSYPFWLKKFLEEGCYTADQVYNCDETDLCYKILPNRTFTTKTDNHKREGFKKRKDRLTLLFCVNKSGSHKLRPLMIGKSKAPRCFYRVNMKSPPFQYINSNNAWMNTTAFYDWFHKTFVPDVRAHLRKLKLEEKA-LILDNCPAHPKRKILIKASPEGKLKPASTMSLPQSRD 519          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000032104.1 (SMESG000032104.1)

HSP 1 Score: 124.79 bits (312), Expect = 1.445e-31
Identity = 62/127 (48.82%), Postives = 82/127 (64.57%), Query Frame = 2
Query:  695 IEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVL-----------VTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADET 1042
            +E MEKALM+WIED   K+MP+  N I+ KA+KI+ +LKE+ P   L             +   +EF  SKGWFENF+ RF LHN+K+QGE  SAD  AA+++PK LAKIIEE GY  +Q +   +T
Sbjct:    1 MEMMEKALMIWIEDNTQKRMPLDGNVIRYKAVKIFNHLKETRPAPALPNQPLTSQESFEQQTPIREFSGSKGWFENFEKRFSLHNVKLQGEIASADEAAAKIFPKELAKIIEEHGYTADQAYYIRQT 127          

HSP 2 Score: 83.9593 bits (206), Expect = 1.502e-17
Identity = 35/55 (63.64%), Postives = 50/55 (90.91%), Query Frame = 2
Query: 1502 FYIRQTFQLILDKMDSNPNMTVTELWKNFTILNCIKIVETSLKELKQSTLNGSWK 1666
            +YIRQTF+ ILD+MDS+ ++TV+++WKNFTIL+C+KIV  +++EL+ STLNGSWK
Sbjct:  122 YYIRQTFKKILDEMDSDSSLTVSQVWKNFTILDCVKIVALAVEELRPSTLNGSWK 176          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000013943.1 (SMESG000013943.1)

HSP 1 Score: 117.857 bits (294), Expect = 1.594e-27
Identity = 67/182 (36.81%), Postives = 94/182 (51.65%), Query Frame = 2
Query:  704 MEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNE-KVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPV 1246
            ++ AL  W+    ++ +PIS   +K KA K    +                +F AS  W + FK R  +  + V GE  SAD E A  YP  L K +EEG Y  +Q++N DETGL +K +P+RT  +K +     GFK  KDR+TLL C N SG +   PL I +S  PR   +V+   LP+
Sbjct:   79 LDSALYQWLVQARSEGVPISGPILKAKAEKFNRRIN-----------GEDSKFKASNIWLDRFKKRHTISQVLVSGEIHSADKEDANSYPFLLKKFLEEGCYTADQVYNCDETGLCYKMLPNRTLATKTDNHKREGFKKRKDRLTLLFCINKSGSHKLSPLMIGKSKAPRCFHHVNMKSLPL 249          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000029226.1 (SMESG000029226.1)

HSP 1 Score: 119.398 bits (298), Expect = 7.540e-27
Identity = 84/284 (29.58%), Postives = 145/284 (51.06%), Query Frame = 2
Query:  695 IEKMEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASKQEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEGGYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSNASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWFLNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLNHPNVEIAFLPPNTTSIIQPLDQGIISTFKEFYIRQTFQLILDKMD 1546
            +E+ ++ +  W ++    K+PI    ++ KA      L               Q+F    G  + +K+R+ +    + GE+   +      +   L+ I ++  +K E I  A+ETGL +K +P++T+  K+EK   G K+ K+RIT+L   +A+G     PL I +SL PR +K ++ S L  Y+ +N K W+T  +FR+      + +++     KN   K+LL +DN  GH       NV++AF   N TS +QP+D+GII+ FK  Y     + IL+ ++
Sbjct: 2240 LEESDECVFEWFKEKRKVKVPIYGPILQAKAEDFATLLG--------------QDFKPCNGLLDLWKTRYNISFRILNGESAKVNESTVEEWLSKLSNITKD--FKFEDIDKAEETGLLYKCLPNKTFNIKDEKCFNGEKS-KERITILFGCDAAGSDKLTPLVIGKSLKPRCIKLINMSNLGFYYLSNRKTWMTEGVFRES-----IAKIDKRFLAKNR--KILLFIDNFSGHALKSQSNNVKVAFFHLNCTSKLQPMDKGIIANFKLKYRSAMVRRILENLE 2499          
The following BLAST results are available for this feature:
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TIGD12.449e-9850.90tigger transposable element derived 1 [Source:HGNC... [more]
TIGD22.812e-5031.42tigger transposable element derived 2 [Source:HGNC... [more]
TIGD22.812e-5031.42tigger transposable element derived 2 [Source:HGNC... [more]
JRKL2.506e-4932.33JRK like [Source:HGNC Symbol;Acc:HGNC:6200][more]
JRK1.750e-4233.70Jrk helix-turn-helix protein [Source:HGNC Symbol;A... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kif64.399e-4332.92kinesin family member 6 [Source:Xenbase;Acc:XB-GEN... [more]
ENSXETT00000046714.12.045e-3033.20pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
apmapl6.310e-2925.30adipocyte plasma membrane associated protein LIKE ... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Jrkl7.985e-4932.33Jrk-like [Source:MGI Symbol;Acc:MGI:1924782][more]
Tigd23.527e-4728.70tigger transposable element derived 2 [Source:MGI ... [more]
Jrk3.691e-4131.88jerky [Source:MGI Symbol;Acc:MGI:106214][more]
Tigd52.956e-3224.66tigger transposable element derived 5 [Source:MGI ... [more]
Tigd41.454e-2726.91tigger transposable element derived 4 [Source:MGI ... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96MW7|TIGD1_HUMAN1.176e-9750.90Tigger transposable element-derived protein 1 OS=H... [more]
sp|Q4W5G0|TIGD2_HUMAN1.350e-4931.42Tigger transposable element-derived protein 2 OS=H... [more]
sp|Q9Y4A0|JERKL_HUMAN1.204e-4832.33Jerky protein homolog-like OS=Homo sapiens OX=9606... [more]
sp|B2RRL2|JERKL_MOUSE5.585e-4832.33Jerky protein homolog-like OS=Mus musculus OX=1009... [more]
sp|Q0VBL1|TIGD2_MOUSE2.467e-4628.70Tigger transposable element-derived protein 2 OS=M... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2B3162.183e-13451.84Tigger transposable element-derived protein 1 OS=A... [more]
A0A2P2I4636.238e-12656.71Tigger transposable element-derived protein 1-like... [more]
A0A2A4JVK06.523e-12659.02HTH CENPB-type domain-containing protein OS=Heliot... [more]
A0A4C1YWZ62.942e-12559.33Tigger transposable element-derived protein 1 OS=E... [more]
A0A212FGJ62.718e-11656.90Putative Tigger transposable element-derived prote... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005656.14.409e-7841.10pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1... [more]
ENSPMAT00000001313.14.451e-6838.65pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gen... [more]
ENSPMAT00000010132.15.741e-6838.65pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 g... [more]
ENSPMAT00000003283.13.676e-6338.07pep scaffold:Pmarinus_7.0:GL479064:1419:3178:1 gen... [more]
ENSPMAT00000004972.13.121e-6240.80pep scaffold:Pmarinus_7.0:GL476545:74372:75575:-1 ... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO447388.810e-3833.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400006.456e-1828.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000031980.13.407e-8750.74pep primary_assembly:ASM223467v1:3:6881985:6888319... [more]
ENSORLT00000036785.13.513e-8349.82pep primary_assembly:ASM223467v1:22:11796267:11802... [more]
ENSORLT00000029563.13.902e-937.33pep primary_assembly:ASM223467v1:22:22280271:22280... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071434.13.504e-4045.83SMESG000071434.1[more]
SMESG000027161.14.931e-3835.38SMESG000027161.1[more]
SMESG000032104.11.445e-3148.82SMESG000032104.1[more]
SMESG000013943.11.594e-2736.81SMESG000013943.1[more]
SMESG000029226.17.540e-2729.58SMESG000029226.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025127 ID=SMED30025127|Name=Tigger transposable element-derived protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2788bp
ATTTGGAAAAAAATTCTGTTTCAGTACAACGCGAAATTTTGACTTATATA
ATGCGAAGGGGAAAATACATAATTATAAAATCTGGTAACACTAATTTGCG
TACCACATATTTATAATAATGTATTTTTAATGTCAACTGGGAATTACCCT
TTTTTGCCTTCACAACATGTGTGAATATACCAGGCATGCTCACAGCATAT
ATATTTGTACTCTTCTTGCACATTTATATTTATTATATTATCAGTTCAGT
GTGAACTTTTGTGGATATCAGGTATGTAATTAAGAAAAAACATTTATATT
CTAAAATTTTTCTTTTTAGAATTACAAATTTAATATTAAAGTATCAGCAT
AAGTTATATTTGTGATCGAAGATAGGTATGTAATATAAATTTTTGTTATT
GGTAATTTTCTTTATTATTTAAAATATACATATGTAAATTTTTGTACCCA
TGAATAGACAAATTTCAACTGCCGAAAAACCAACGCTAAAGCGAAAATTT
ATTACCTTGGATGACAAAATTAAGATTCTGGATAGATTAAGCAGTGGTGA
AAAAGCAGCATTAATAGCAAAATCTCTCAGTTTAAATGAATCCACAATAC
GCACCATTAAACAAATTGAAAATAAAATAAGAAATTCTGTTATTGCTGGG
TCATCAATAAGCACAAAAAGAGTTGCACGTGTGCGTGATCTTTAATAGAA
AAAATGGAAAAAGCGTTAATGCTGTGGATAGAAGACTGTGCTACAAAAAA
AATGCCAATCAGTATAAATGCCATTAAGACGAAAGCTCTTAAAATTTATG
CATATTTAAAAGAAAGTAATCCAGATGCAGTCCTTGTAACCAAAGCATCT
AAGCAGGAATTCTTAGCTAGCAAAGGCTGGTTCGAAAACTTTAAATCTCG
CTTTGGATTACACAATATTAAAGTTCAAGGTGAAACTGGATCGGCCGACG
TAGAAGCTGCAAGGGTTTACCCTAAAACTCTTGCTAAAATTATTGAAGAA
GGTGGTTATAAGGGAGAACAAATTTTTAATGCGGATGAAACAGGTCTAAA
TTGGAAAAAAATGCCGCATCGGACATATATTTCGAAAAATGAAAAAGTTG
CACCGGGTTTCAAGGCCGCAAAAGACAGAATTACTCTACTTCTCTGTAGT
AATGCATCAGGTGACTACATTACAAAACCTTTATTTATAAACCGCTCTTT
AAATCCACGAGCGTTGAAAAATGTCGATAAATCCAAGTTACCTGTTTATT
GGCGGGCAAATTGCAAGGCTTGGGTTACAAGCAGTATTTTTCGAGATTGG
TTTTTAAATTGCTTTGTACCTGAGGTTGAAAATTATTTGAAGATTAAGAA
CATCGATTTCAAAGTGCTTTTAATACTTGATAATGCCCCTGGACATCCAA
AAGACTTAAATCATCCCAATGTAGAAATAGCATTCCTACCACCTAATACC
ACGTCTATCATTCAACCGTTAGACCAAGGTATTATATCAACGTTCAAAGA
ATTTTATATTCGGCAAACATTCCAACTTATTCTTGATAAAATGGATTCAA
ATCCTAACATGACAGTTACAGAATTATGGAAAAATTTTACAATTTTAAAC
TGCATTAAAATTGTAGAAACATCTCTTAAAGAATTAAAGCAGTCCACGCT
AAATGGCTCATGGAAAAGATATAGCCGGAGATTGTTGCAAAAAATAATCC
TGTGCCGCCATTACGAGTGGAAGTGAGCCGTATATTAACGTTAGGTCAAC
GTTTCAGTGGAGAAGGCTTTGACGATATGAACGAAGATGACATTTATGAA
ATTATGAATGAAGGTACAGAGCTCACCGAAACAGACCTAATTCAATTAAC
AACTGAATCTCCATCCGTTTCAAATCTCGCACAAGATGACGTCACTTCGG
TAGAAGATATCAGTGAATCAATTCCCAGTTTCACTCTGAAGTGCATACGA
GAGGGTTTGAGTTTGGTTGAGAAAATGAAATCTTTCTTTACAACTAATGA
TCCTTCACTGGAGAGATCCAGCAAACTAATGAGGGAAATAGATATTAATC
TAGCACCTTATTACGAAATTGAAAAACACCTTAAAAAAAACACCCACCAA
AAACTGATAACAGATTTTGTAATTATAAAACCAGTAGAAGAACCACAAAG
TCCCACAACTAGTTTCTTATCCAATAGCGAAAACTATGTTGAAAAAATAT
CTTCTGATGAAGCTATTGCTCCCCCAAAACGCCCACGCGCAAAGATCTTT
GAAGACAGTGAAACAGATTAATTACCATATGAAGTTTGAAGAATAACAAT
AAAGTTTTTAATAAACCTTTAATTTGTTTTAGTTTGTTTTTAAATTTTTT
AATGTGCACATAATTATTTATATTTTGTTTTTTGAATTTTGAAATATGTA
CATATATGTATTATTATTCATAACTTGTGTTTTTAATTGTATAAGAAAGT
CTGAATTTTAGTATTGAGTTGAAATATATGTGCATCTGTTATTTAGTATG
TATTTATTTTGAAAGAAACTTATTGGAACGTAACCCCCAAATTTATATGA
AAACTATGTCTTAGATAACGCGGAATCCCATAACGCGCACTTATTCTGGA
ACGTAACTACCGCGTTATACAAGGGATACCTGTAATTTATCTCCCATCTC
AAAAATCCACAAATGAGTGTTGTAACGCTTTTTTTATATTAAACAAAAAA
GCGCTTTCCACAAAATTTCGTGTAATTGTTATTTTTTTCTTAATGATTTA
TTTTCCATTTAATTTTAAGATTGAAGAGTGCAAAGATG
back to top

protein sequence of SMED30025127-orf-1

>SMED30025127-orf-1 ID=SMED30025127-orf-1|Name=SMED30025127-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=341bp
MEKALMLWIEDCATKKMPISINAIKTKALKIYAYLKESNPDAVLVTKASK
QEFLASKGWFENFKSRFGLHNIKVQGETGSADVEAARVYPKTLAKIIEEG
GYKGEQIFNADETGLNWKKMPHRTYISKNEKVAPGFKAAKDRITLLLCSN
ASGDYITKPLFINRSLNPRALKNVDKSKLPVYWRANCKAWVTSSIFRDWF
LNCFVPEVENYLKIKNIDFKVLLILDNAPGHPKDLNHPNVEIAFLPPNTT
SIIQPLDQGIISTFKEFYIRQTFQLILDKMDSNPNMTVTELWKNFTILNC
IKIVETSLKELKQSTLNGSWKRYSRRLLQKIILCRHYEWK*
back to top

protein sequence of SMED30025127-orf-2

>SMED30025127-orf-2 ID=SMED30025127-orf-2|Name=SMED30025127-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=165bp
MNEDDIYEIMNEGTELTETDLIQLTTESPSVSNLAQDDVTSVEDISESIP
SFTLKCIREGLSLVEKMKSFFTTNDPSLERSSKLMREIDINLAPYYEIEK
HLKKNTHQKLITDFVIIKPVEEPQSPTTSFLSNSENYVEKISSDEAIAPP
KRPRAKIFEDSETD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006600HTH_CenpB_DNA-bd_dom
IPR004875DDE_SF_endonuclease_dom
IPR009057Homeobox-like_sf
IPR007889HTH_Psq
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006600HTH CenpB-type DNA-binding domainSMARTSM00674cenpbcoord: 1..73
e-value: 1.3E-4
score: 31.3
IPR006600HTH CenpB-type DNA-binding domainPFAMPF03221HTH_Tnp_Tc5coord: 1..72
e-value: 1.8E-14
score: 53.5
IPR006600HTH CenpB-type DNA-binding domainPROSITEPS51253HTH_CENPBcoord: 1..73
score: 12.878
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 1..67
e-value: 2.1E-11
score: 45.8
NoneNo IPR availablePANTHERPTHR19303TRANSPOSONcoord: 1..332
NoneNo IPR availablePANTHERPTHR19303:SF27coord: 1..332
IPR004875DDE superfamily endonuclease domainPFAMPF03184DDE_1coord: 140..320
e-value: 5.5E-41
score: 140.1
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 1..69