Ribosomal protein L2 domain protein

Overview
NameRibosomal protein L2 domain protein
Smed IDSMED30025110
Length (bp)1183
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribosomal protein L2 domain protein (SMED30025110) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribosomal protein L2 domain protein (SMED30025110) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribosomal protein L2 domain protein (SMED30025110) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribosomal protein L2 domain protein (SMED30025110) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025110

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025110h1SMcG0000127 SmedASXL_004723SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025110h1SMcG0000127 SmedASXL_004723SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30025110h1SMcG0000127 dd_Smed_v4_2712_3_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025110h1SMcG0000127 dd_Smed_v4_2712_3_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025110h1SMcG0000127 dd_Smed_v4_2712_3_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025110h1SMcG0000127 dd_Smed_v4_2712_3_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Human
Match: MRPL2 (mitochondrial ribosomal protein L2 [Source:HGNC Symbol;Acc:HGNC:14056])

HSP 1 Score: 127.487 bits (319), Expect = 3.059e-33
Identity = 79/231 (34.20%), Postives = 123/231 (53.25%), Query Frame = 1
Query:  220 TTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVSKYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVET 912
            T YT  P+   K+GGR  TGR+ +  IGGG K+   ++   R            E++I +  +  RS +IALVA G  KRWI AT +M+ GDT+ +   + ++    + GDA+ +G L VG  +  VE  PG+GA +   AGT  ++ + +   +++    KR +++   C A +G++SN +HNK    K G  RWLG R  SG   +K G  GR+I  L P   +  + +
Sbjct:   70 TKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDPCRSADIALVAGGSRKRWIIATENMQAGDTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLETCVATVGRVSNVDHNKRVIGKAGRNRWLGKRPNSGRWHRKGGWAGRKIRPLPPMKSYVKLPS 300          
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Human
Match: AL355385.2 (pep chromosome:GRCh38:6:43051066:43058185:-1 gene:ENSG00000288564.1 transcript:ENST00000673761.1 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay gene_symbol:AL355385.2)

HSP 1 Score: 107.071 bits (266), Expect = 2.435e-26
Identity = 63/185 (34.05%), Postives = 102/185 (55.14%), Query Frame = 1
Query:  220 TTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVSKYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNK 774
            T YT  P+   K+GGR  TGR+ +  IGGG K+   ++   R            E++I +  +  RS +IALVA G  KRWI AT +M+ GDT+ +   + ++    + GDA+ +G L VG  +  VE  PG+GA +   AGT  ++ + +   +++    KR +++   C A +G++SN +HNK
Sbjct:   22 TKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDPCRSADIALVAGGSRKRWIIATENMQAGDTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLETCVATVGRVSNVDHNK 206          
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Human
Match: MRPL2 (mitochondrial ribosomal protein L2 [Source:HGNC Symbol;Acc:HGNC:14056])

HSP 1 Score: 88.1965 bits (217), Expect = 1.607e-19
Identity = 54/153 (35.29%), Postives = 81/153 (52.94%), Query Frame = 1
Query:  190 AWKAAIPNIDTTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVSKYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGT 648
            +WK+      T YT  P+   K+GGR  TGR+ +  IGGG K+   ++   R            E++I +  +  RS +IALVA G  KRWI AT +M+ GDT+ +   + ++    + GDA+ +G L VG  +  VE  PG+GA +   AG 
Sbjct:   65 SWKS-----RTKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDPCRSADIALVAGGSRKRWIIATENMQAGDTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGA 212          
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Celegans
Match: mrpl-2 (Mitochondrial Ribosomal Protein, Large [Source:UniProtKB/TrEMBL;Acc:U4PFC3])

HSP 1 Score: 115.546 bits (288), Expect = 4.739e-29
Identity = 84/226 (37.17%), Postives = 121/226 (53.54%), Query Frame = 1
Query:  226 YTHLPLPTVKTGGRGP-TGRVELKHIGGGLKKPTFLVSKYRGGLSN-GAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAH-FAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGEL---RWLGYRQRSGLRQKKTGRYGRRIYNLRP 885
            YTH PL   + GGR P TGR   +HIGGG+K   F++  +R G ++ GA +   E+I+ I ++  R+ +IAL A    KRWI AT +MK GD +++ G + +       G+AY IG L+ G  +  +E+YP   +  F   AGT A I +   D +VV    K    L   C A +G++S   H  I  + FG     R  GY+  SGL  KK G +GR++  L P
Sbjct:   53 YTHKPLRINRLGGRDPETGRKVNQHIGGGVKFDYFMIDFHRRGPADQGATY--DERILEIRRDPNRTCHIALCAGINGKRWILATENMKAGDVISTSGHLSENPVIGVEGNAYPIGSLAAGTVINSIERYPTMDSETFVKAAGTSATIVRHQGDFTVVKLPHKHEFSLHRTCMATVGRLS---HADIDGKIFGSAQMHRRFGYKMSSGLFHKKDGYFGRKVRALPP 273          
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Fly
Match: mRpL2 (gene:FBgn0036135 transcript:FBtr0076211)

HSP 1 Score: 132.109 bits (331), Expect = 2.946e-35
Identity = 87/243 (35.80%), Postives = 128/243 (52.67%), Query Frame = 1
Query:  226 YTHLPLPTVKTGGRGP-TGRVELKHIGGGLKKPTFLVSKYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQILPDDSVVIKI-GKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVETEPKSGVISYSKP 948
            YT  PL      GR P +GR+  K IGGG+K+    V   R G + GA+    E ++ + ++  R+  +ALVA G   ++I AT +MK GD + +   + +I  +P  GDAY +G L VG  +  +EK PGQ  H    AGT   I +   D+ VV+++  KR       C A +G++SNPEHNK        +R +G R RSGL ++K G++GR+I  L P    +     PK   I  + P
Sbjct:   56 YTVEPLKITHLAGRDPVSGRLVAKGIGGGIKQQYRWVKWVRDGPTEGAQE---ELVLEVLRDGCRTAKVALVAVGDELKYILATENMKAGDILKTSRFIPRIPVRPNEGDAYPLGALPVGTRIHCLEKNPGQMCHLIHAAGTFGTILRKF-DEKVVVQLPSKREFAFQRTCMATVGRLSNPEHNKEHVGSAQRMREMGNRPRSGLWKRKEGKHGRKIRRLPPMTTISP-PAPPKEEAIKLTLP 293          
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Zebrafish
Match: mrpl2 (mitochondrial ribosomal protein L2 [Source:ZFIN;Acc:ZDB-GENE-050809-12])

HSP 1 Score: 122.094 bits (305), Expect = 1.623e-31
Identity = 79/230 (34.35%), Postives = 126/230 (54.78%), Query Frame = 1
Query:  226 YTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVSKYRGGLSNGAEH-VISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVET 912
            YT  P+   KTGGR  TGR++   IGGG K+   ++   R     G E  V+ E+++ +  +  RS +IALVA G  KRWI A+ +M+ GD + S   + ++    + GDA+ +G L VG  +  +E +PG+GA +   AGT  ++ + +   +++    K  +++   C A +G++SN +HNK    K G  RWLG R  SG  Q+K G  GR+I  L     + ++ T
Sbjct:   60 YTIRPIGMKKTGGRDHTGRIKTHGIGGGHKQRHRIIDFQRLRSEPGKEQPVMVEKVLEVRYDPCRSADIALVAGGNRKRWIIASQNMEAGDLIQSCRGIGRMAVLAQEGDAHPVGALPVGTLIHNLELFPGRGAQYIRAAGTCGVLLRKVSGTAIIQLPSKHQIQVLETCVATVGRVSNVDHNKRIIGKAGTNRWLGIRPSSGRWQRKGGWAGRKIRPLPAMKSYINLPT 289          
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Mouse
Match: Mrpl2 (mitochondrial ribosomal protein L2 [Source:MGI Symbol;Acc:MGI:1351622])

HSP 1 Score: 133.265 bits (334), Expect = 1.546e-35
Identity = 87/259 (33.59%), Postives = 139/259 (53.67%), Query Frame = 1
Query:  142 SFRPGILHPNGYSFDWAWKAAIPNIDTTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVS--KYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVET 912
            S+RP  +  +  +   +WK+      T YT  P+   K+GGR  TGR+ +  IGGG K+   ++   ++R       E    E+++ +  +  RS +IALVA G  KRWI AT +MK GDT+ +   + ++    + GDA+ +G L VG  +  VE  PG+GA +   AGT  ++ + +   +++    KR +++   CTA +G++SN  HN+    K G  RWLG R  SGL Q+K G  GR+I  L P   +  + +
Sbjct:   47 SYRPVHMSADRSAKFVSWKS-----RTKYTVKPVKMRKSGGRDHTGRIRVHGIGGGHKQNYRMIDFLRFRPEKEKAPEP-FEEKVVVVRYDPCRSADIALVAGGSRKRWIIATENMKAGDTILNSNHIGRMAVAAQEGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLESCTATVGRVSNVNHNQRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLPS 299          
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Mouse
Match: Mrpl2 (mitochondrial ribosomal protein L2 [Source:MGI Symbol;Acc:MGI:1351622])

HSP 1 Score: 133.265 bits (334), Expect = 1.757e-35
Identity = 87/259 (33.59%), Postives = 139/259 (53.67%), Query Frame = 1
Query:  142 SFRPGILHPNGYSFDWAWKAAIPNIDTTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVS--KYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVET 912
            S+RP  +  +  +   +WK+      T YT  P+   K+GGR  TGR+ +  IGGG K+   ++   ++R       E    E+++ +  +  RS +IALVA G  KRWI AT +MK GDT+ +   + ++    + GDA+ +G L VG  +  VE  PG+GA +   AGT  ++ + +   +++    KR +++   CTA +G++SN  HN+    K G  RWLG R  SGL Q+K G  GR+I  L P   +  + +
Sbjct:   49 SYRPVHMSADRSAKFVSWKS-----RTKYTVKPVKMRKSGGRDHTGRIRVHGIGGGHKQNYRMIDFLRFRPEKEKAPEP-FEEKVVVVRYDPCRSADIALVAGGSRKRWIIATENMKAGDTILNSNHIGRMAVAAQEGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLESCTATVGRVSNVNHNQRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLPS 301          
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Mouse
Match: Mrpl2 (mitochondrial ribosomal protein L2 [Source:MGI Symbol;Acc:MGI:1351622])

HSP 1 Score: 65.4698 bits (158), Expect = 1.199e-11
Identity = 51/154 (33.12%), Postives = 76/154 (49.35%), Query Frame = 1
Query:  142 SFRPGILHPNGYSFDWAWKAAIPNIDTTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVS--KYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTV-NSYGIMKQIKGQPKPGDAYNIGCLSVGMSVC 594
            S+RP  +  +  +   +WK+      T YT  P+   K+GGR  TGR+ +  IGGG K+   ++   ++R       E    E+++ +  +  RS +IALVA G  KRWI AT +MK GDT+ NS  I +   G          GC S   + C
Sbjct:   49 SYRPVHMSADRSAKFVSWKS-----RTKYTVKPVKMRKSGGRDHTGRIRVHGIGGGHKQNYRMIDFLRFRPEKEKAPE-PFEEKVVVVRYDPCRSADIALVAGGSRKRWIIATENMKAGDTILNSNHIGRMAGG----------GCTSTWGAAC 186          
BLAST of Ribosomal protein L2 domain protein vs. UniProt/SwissProt
Match: sp|Q498T4|RM02_RAT (39S ribosomal protein L2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mrpl2 PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 7.531e-35
Identity = 85/242 (35.12%), Postives = 131/242 (54.13%), Query Frame = 1
Query:  190 AWKAAIPNIDTTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVSKYRGGLSNGAE-HVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVET 912
            +WK+ I      YT  P+   K+GGR  TGR+ +  IGGG K+   ++   R     G E     E+++ +  +  RS +IALVA G  KRWI AT +MK GDT+ +   + ++    + GDA+ +G L VG  +  VE  PG+GA +   AGT  ++ + +   +++    KR +++   CTA +G++SN  HN+    K G  RWLG R  SGL Q+K G  GR+I  L P   +  + +
Sbjct:   63 SWKSRI-----KYTVKPVKMRKSGGRDHTGRIRVHGIGGGHKQNYRMIDFLRFRPEKGTEPEPFEEKVVVVRYDPCRSADIALVAGGSRKRWIIATENMKAGDTILNSNHIGRMAVAAQEGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLESCTATVGRVSNVNHNQRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLPS 299          
BLAST of Ribosomal protein L2 domain protein vs. UniProt/SwissProt
Match: sp|Q9D773|RM02_MOUSE (39S ribosomal protein L2, mitochondrial OS=Mus musculus OX=10090 GN=Mrpl2 PE=1 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.229e-34
Identity = 87/259 (33.59%), Postives = 139/259 (53.67%), Query Frame = 1
Query:  142 SFRPGILHPNGYSFDWAWKAAIPNIDTTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVS--KYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVET 912
            S+RP  +  +  +   +WK+      T YT  P+   K+GGR  TGR+ +  IGGG K+   ++   ++R       E    E+++ +  +  RS +IALVA G  KRWI AT +MK GDT+ +   + ++    + GDA+ +G L VG  +  VE  PG+GA +   AGT  ++ + +   +++    KR +++   CTA +G++SN  HN+    K G  RWLG R  SGL Q+K G  GR+I  L P   +  + +
Sbjct:   49 SYRPVHMSADRSAKFVSWKS-----RTKYTVKPVKMRKSGGRDHTGRIRVHGIGGGHKQNYRMIDFLRFRPEKEKAPEP-FEEKVVVVRYDPCRSADIALVAGGSRKRWIIATENMKAGDTILNSNHIGRMAVAAQEGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLESCTATVGRVSNVNHNQRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLPS 301          
BLAST of Ribosomal protein L2 domain protein vs. UniProt/SwissProt
Match: sp|Q2TA12|RM02_BOVIN (39S ribosomal protein L2, mitochondrial OS=Bos taurus OX=9913 GN=MRPL2 PE=1 SV=2)

HSP 1 Score: 129.798 bits (325), Expect = 2.058e-33
Identity = 81/232 (34.91%), Postives = 128/232 (55.17%), Query Frame = 1
Query:  220 TTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVSKYRGGLSNGAEH-VISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVET 912
            T YT +P+   K+GGR  TGR+++  IGGG K+   ++   R      ++     E++I +  +  RS +IALVA G  KRWI AT +MK GDT+ +   + ++    + GDA+ +G L VG  +  VE  PG+GA +   AGT  ++ + +   +++    KR +++   CTA +G++SN +HNK    K G  RWLG R  SG   +K G  GR+I  L P   +  + +
Sbjct:   70 TKYTTMPVKMRKSGGRNHTGRIQVHGIGGGHKQRYRMIDFLRFRPEQESKPGPFEEKVIVVRYDPCRSADIALVAGGNRKRWIIATENMKAGDTILNSDHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLETCTATVGRVSNVDHNKRVIGKAGRNRWLGKRPNSGRWHRKGGWAGRKIRPLPPMKSYVKLPS 301          
BLAST of Ribosomal protein L2 domain protein vs. UniProt/SwissProt
Match: sp|Q5T653|RM02_HUMAN (39S ribosomal protein L2, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL2 PE=1 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 1.469e-32
Identity = 79/231 (34.20%), Postives = 123/231 (53.25%), Query Frame = 1
Query:  220 TTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVSKYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVET 912
            T YT  P+   K+GGR  TGR+ +  IGGG K+   ++   R            E++I +  +  RS +IALVA G  KRWI AT +M+ GDT+ +   + ++    + GDA+ +G L VG  +  VE  PG+GA +   AGT  ++ + +   +++    KR +++   C A +G++SN +HNK    K G  RWLG R  SG   +K G  GR+I  L P   +  + +
Sbjct:   70 TKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDPCRSADIALVAGGSRKRWIIATENMQAGDTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLETCVATVGRVSNVDHNKRVIGKAGRNRWLGKRPNSGRWHRKGGWAGRKIRPLPPMKSYVKLPS 300          
BLAST of Ribosomal protein L2 domain protein vs. UniProt/SwissProt
Match: sp|B8D0C7|RL2_HALOH (50S ribosomal protein L2 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=rplB PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.025e-16
Identity = 71/204 (34.80%), Postives = 96/204 (47.06%), Query Frame = 1
Query:  235 LPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVSKYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVAR-GLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALI--------HQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYR 819
            L  P  KTGGR   GRV ++H GGG K+   ++   R       +  +  ++  I  +  RS  IAL+      KR+I A   ++VGDTV S G   +IK    PG+A  +  + VG  +  +E  PG+G   A  AGT A I        H  LP   V      RL+ L   C A +GQ+ N +H  I   K G  RWLG R
Sbjct:   33 LLAPLKKTGGRNSYGRVTVRHRGGGHKRRYRIIDFKRD------KDGVPARVASIEYDPNRSARIALLHYVDGEKRYILAPNKLQVGDTVKS-GEDAEIK----PGNALKLKNIPVGTIIHNIELKPGKGGQLARAAGTMAQILAKEGKYAHIKLPSGEV------RLISLE--CKATIGQVGNIDHENISIGKAGRKRWLGKR 217          
BLAST of Ribosomal protein L2 domain protein vs. TrEMBL
Match: A0A4S2MD51 (Ribosomal_L2_C domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000870 PE=4 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 6.096e-59
Identity = 142/371 (38.27%), Postives = 190/371 (51.21%), Query Frame = 1
Query:   46 TTIIQSSLSRANVNALGFLMRQPKLGGIASERSFRPGILHPNGYSFDWAWKAAIPNIDTTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVS-KYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALI-----HQILPD------------DSVVI---KIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVETEPKSGVISYSKPGMPAAMKRE----YTFDNPVNVKPL---PVDEN---ETHPRFKWYTWAT 1065
            T+ I  SL  A  + L F ++  +  G  +     PGI  P   S  WA K         YT   +  V+TGGRGP G ++ KH   GL +P F+V   Y   +  G   V+ E ++ I +NWWR+  +ALVA G  KRWI ATTSMK GD V S+  +  I   P+ GDAY +G L VG SVC VE +PG+GA     AGT A +     H   PD            + VV+      ++L++L   C  V+GQ+SN EHNK +YRKFGE  W G +QRSGL Q+KTGR+GR+I  + P  DF + E      ++  +KPG P   +      Y   NP   KP    P   N   +  PRF W +W +
Sbjct:    9 TSSIFKSLELA-ASKLEFSVQILRQFGTTTTAHRHPGITFPYHVSKQWAVKRLFD--PEQYTVDAVKLVRTGGRGPDGIIQYKHRTTGLNRPWFMVDYNYSRHIPTGK--VVDEIVLKITRNWWRTPFLALVASGEVKRWIVATTSMKPGDIVRSHVDIPLIPVSPREGDAYPVGALPVGTSVCLVELHPGEGAIRCRAAGTSASVIRRGKHVGDPDCPRPDTLSDVTEEHVVLLRDNGTRKLMRLLPECMVVVGQVSNNEHNKEKYRKFGEKYWHGIKQRSGLWQRKTGRFGRKIRPIGPPLDFVNPEVSAGQMILKVTKPGTPLHNRENERNLYALMNPGKQKPFQPTPKAYNGLPDNQPRFCWSSWTS 374          
BLAST of Ribosomal protein L2 domain protein vs. TrEMBL
Match: A0A074ZLB4 (Ribosomal_L2_C domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_08128 PE=4 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 6.228e-59
Identity = 138/358 (38.55%), Postives = 183/358 (51.12%), Query Frame = 1
Query:   85 NALGFLMRQPKLGGIASERSFRPGILHPNGYSFDWAWKAAIPNIDTTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVS-KYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALI-----HQILPD------------DSVVI---KIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVETEPKSGVISYSKPGMPAAMKRE----YTFDNPVNVKPL---PVDEN---ETHPRFKWYTWAT 1065
            N L F M+  +  G  +     PGI+ P   S  WA K         YT   +  V+TGGRGP G  + KH   GL +P F+V   Y   +  G   V+ E ++ I +NWWR+  +ALVA G  KRWI ATTSMK GD + S+  +  I   P+ GDAY +G L VG SVC VE YPG+GA     AGT A +     H   PD            + VV+      ++L++L   C  V+GQ+SN EH+K +YRKFGE  W G +QRSGL Q+KTGR+GR+I  + P  DF   E      ++  +KPG P   +      Y   NP   KP    P   N   +  PRF W +W +
Sbjct:   21 NKLEFPMQILRQFGTTTTAHRHPGIIFPYPVSKQWAVKRLFD--PEQYTVDAVKLVRTGGRGPDGITQYKHRTTGLNRPWFMVDYNYSRHIPTGK--VVDEIVLKITRNWWRTPFLALVASGEVKRWIVATTSMKPGDIIRSHVDIPLIPVSPREGDAYPVGALPVGTSVCLVELYPGEGAIRCRAAGTSASVVRRGKHVGDPDCPRPDTLSDVTEEHVVLLRDNGTRKLMRLLPECMVVVGQVSNNEHSKEKYRKFGEKYWHGIKQRSGLWQRKTGRFGRKIRPIGPPLDFVSPEVSASEMILKVTKPGTPLHNRENERDLYAQMNPGKQKPFQPTPKAYNGLPDNQPRFCWSSWTS 374          
BLAST of Ribosomal protein L2 domain protein vs. TrEMBL
Match: A0A095AT71 (39S ribosomal protein L2, mitochondrial OS=Schistosoma haematobium OX=6185 GN=MS3_05994 PE=4 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.112e-57
Identity = 137/377 (36.34%), Postives = 193/377 (51.19%), Query Frame = 1
Query:   40 LGTTIIQS-SLSRANVNALGFLMRQPKLGGIASERSFRPGILHPNGYSFDWAW-KAAIPNIDTTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVSKYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQ----------------ILPD---DSVVIKI---GKR-LLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVETEPKSGVISYSKPGMPA-AMKREYTFDNPVNVK------PLPVDENE---THPRFKWYTWAT 1065
            LG  + +S + S  N+  L  L         +   + RPGI +P   S  WA  K   P+    YT  PLP V+TGGRGP G+++LKH+  GL +P F+V   R       + +  E ++ + K WWR   IALVA G  KRWI AT SMK GD + S+  +  I   PK GDAY IG L VG  + Q E  PGQGA F   AG+ A I +                 L D   D  V+ +   GKR + +L   C  V+GQ+SN  H++ R+RKFGE +W G +QRSGL Q+KTGR+GR++  + P  D    ++ P    +  S PG     M+++      ++ K      P+P   NE     PR++W +W++
Sbjct:   19 LGNKLFKSFNFSTLNLTKLNPLQIYKHELSTSCSLNRRPGITYPRPVSRYWAISKMRDPH---QYTVDPLPLVRTGGRGPDGKIQLKHVTTGLNRPWFMVDHNRSR-QVLTKTIHEELVLQVKKTWWRHPFIALVASGEVKRWIIATASMKPGDIIRSHVDIPTIPVDPKEGDAYPIGALPVGTIISQFEIKPGQGALFCRTAGSSATIFRRGKYVGSKLNEELNFTSLTDEREDEYVVFVRTNGKRKIYRLLPTCMCVVGQVSNENHDQFRFRKFGEKKWRGIKQRSGLWQRKTGRFGRKVRPIGPPIDLVPCQSSPDYFRLKCSYPGRSEYTMRKKQDMYEALHAKNKPRPQPIPGRHNELPDKMPRYRWCSWSS 391          
BLAST of Ribosomal protein L2 domain protein vs. TrEMBL
Match: A0A1S8WZ36 (Ribosomal protein L2 domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_04366 PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 2.286e-57
Identity = 133/336 (39.58%), Postives = 175/336 (52.08%), Query Frame = 1
Query:  151 PGILHPNGYSFDWAWKAAIPNIDTTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVS-KYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALI-----HQILPD------------DSVVIKIG---KRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVETEPKSGVISYSKPGMPAAMKRE----YTFDNPVNVKPL---PVDEN---ETHPRFKWYTWAT 1065
            PGI+ P   S  WA K         YT   +  V+TGGRGP G  + KH   GL +P F+V   Y   +  G   V+ E ++ I +NWWR+  +ALVA G  KRWI ATTSMK GD + S+  +  I   P+ GDAY +G L VG SVC VE YPG+GA     AGT A +     H   PD            + VV+      ++L++L   C  V+GQ+SN EH+K +YRKFGE  W G +QRSGL Q+KTGR+GR+I  + P  DF   E      ++  +KPG P   +      Y   NP   KP    P   N   +  PRF W +W +
Sbjct:   57 PGIIFPYPVSKQWAVKRLFD--PEQYTVDAVKLVRTGGRGPDGITQYKHRTTGLNRPWFMVDYNYSRHIPTGK--VVDEIVLKITRNWWRTPFLALVASGEVKRWIVATTSMKPGDIIRSHVDIPLIPVSPREGDAYPVGALPVGTSVCLVELYPGEGAIRCRAAGTSASVVRRGKHVGDPDCPRPDTLSDVTEEHVVLLRDNGTRKLMRLLPECMVVVGQVSNNEHSKEKYRKFGEKYWHGIKQRSGLWQRKTGRFGRKIRPIGPPLDFVSPEVSASEMILKVTKPGTPLHNRENERDLYAQMNPGKQKPFQPTPKAYNGLPDNQPRFCWSSWTS 388          
BLAST of Ribosomal protein L2 domain protein vs. TrEMBL
Match: H2KUG3 (39S ribosomal protein L2 OS=Clonorchis sinensis OX=79923 GN=MRPL2 PE=4 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 2.665e-56
Identity = 135/358 (37.71%), Postives = 183/358 (51.12%), Query Frame = 1
Query:   85 NALGFLMRQPKLGGIASERSFRPGILHPNGYSFDWAWKAAIPNIDTTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVS-KYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALI-----HQILPD------------DSVVI---KIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVETEPKSGVISYSKPGMPAAMKRE----YTFDNPVNVKPL---PVDEN---ETHPRFKWYTWAT 1065
            N L F ++  +  G  +     PGI  P   S  WA K         YT   +  V+TGGRGP G  + KH   GL +P F+V   Y   +  G   V+ E ++ I +NWWR+  +ALVA G  KRWI ATTSMK GD + S+  +  I   P+ GDAY +G L VG SVC VE +PG+GA     AGT A +     H   PD            + VV+      ++L++L   C  V+GQ+SN EH+K +Y+KFGE  W G +QRSGL Q+KTGR+GR+I  + P  DF + E      ++  +KPG P   +      Y   NP   KP    P   N   +  PRF W +W +
Sbjct:   21 NKLEFSVQILRQFGTTTTAHRHPGITFPYPMSKQWAVKRLFD--PEQYTVDAVKLVRTGGRGPDGVTQYKHRTTGLNRPWFMVDYNYSRHIPTGK--VMDEIVLKITRNWWRTPFLALVASGEVKRWIVATTSMKPGDIIRSHVDIPLIPVSPREGDAYPVGALPVGTSVCLVELHPGEGAIRCRAAGTSASVVRRGKHVGDPDCPRPDTLSDVTEEHVVLLRDNGTRKLMRLLPECMVVVGQVSNNEHSKEKYKKFGEKYWHGIKQRSGLWQRKTGRFGRKIRPIGPPLDFVNPEASAGQMILKVTKPGTPLHNRENERDLYAQVNPGKQKPFQPTPKAYNGLPDNQPRFCWSSWTS 374          
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Cavefish
Match: mrpl2 (mitochondrial ribosomal protein L2 [Source:NCBI gene;Acc:103037714])

HSP 1 Score: 130.954 bits (328), Expect = 1.110e-34
Identity = 83/228 (36.40%), Postives = 125/228 (54.82%), Query Frame = 1
Query:  226 YTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVSKYRGGLSNGAE-HVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHV 906
            YT  P+   KTGGR  TGRV    IGGG K+   ++   R     G E   I E+++ +  +  RS +IALVA G  KRWI AT +M+ GD + +  ++ ++      GDA+ +G L VG  +  +E YPG+GA +   AGT  ++ + +   ++V    K  +++   C A +G++SN +HNK    K G  RWLG R  SGL ++K G  GR+I  L P   F ++
Sbjct:   71 YTIRPIGIKKTGGRDYTGRVIRHRIGGGHKQKYRMIDFQRLRYEAGKEGEQIVEKVVEVRYDPCRSADIALVAGGNRKRWIIATENMQAGDLIKTSSVIGRMAVLANEGDAHPLGALPVGTLINNLELYPGKGAQYIRAAGTCGVLLRKVNGTAIVQLPSKHQIQVLETCVATVGKVSNIDHNKRVIGKAGRNRWLGIRPSSGLWKRKGGWAGRKIRPLPPMKSFINL 298          
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Sea Lamprey
Match: mrpl2 (mitochondrial ribosomal protein L2 [Source:ZFIN;Acc:ZDB-GENE-050809-12])

HSP 1 Score: 125.176 bits (313), Expect = 3.249e-33
Identity = 81/232 (34.91%), Postives = 123/232 (53.02%), Query Frame = 1
Query:  223 TYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVSKYR------GGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFT 900
            TYT  P+   KTGGR  TGR+    IGGG ++   ++   R       G  +  + V+ E+++ +  +  RS +IALVA G  KRWI AT SM+ GD + + G + ++      GDAY +G L VG  +  +E  PG GA     AGT  L+ + +   +++    K  ++++  C A +G++S  EHNK    K G  R  G R +SGL Q+K G  GR+I  L P  ++ 
Sbjct:   70 TYTIRPIGRKKTGGRDHTGRIRTHGIGGGHRQCYRMIDFKRLPEGLMAGRLDENKKVMEEKVMEVRYDPLRSADIALVAGGTHKRWIIATQSMQPGDVIKTSGFIGRMAVLAHEGDAYPVGALPVGTLINNLEVKPGAGAQLIRAAGTCGLLIRKVEGTAIIQLPSKHQIQVAETCMATVGRVSRVEHNKEPIGKAGRNRRFGRRPQSGLWQRKGGWAGRKIRPLPPIKNYA 301          
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Yeast
Match: RML2 (Mitochondrial ribosomal protein of the large subunit (L2); has similarity to E. coli L2 ribosomal protein; mutant allele (fat21) causes inability to utilize oleate, and induce oleic acid oxidation; may interfere with activity of the Adr1p transcription factor [Source:SGD;Acc:S000000776])

HSP 1 Score: 54.6842 bits (130), Expect = 9.789e-9
Identity = 57/213 (26.76%), Postives = 96/213 (45.07%), Query Frame = 1
Query:  253 KTGGRGPTGRVELKHIGGGLKKPTFLV--SKYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKR--WIYATTSMKVGDTVNSY------GIMKQIKGQPKP----------GDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQILPDDS---VVIKIGK-RLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYR 819
            K GGR  +G++ ++H GGG +  T L+  +++ GG         ++ +  I  +  RS +IAL+    T    +I A   ++ GD V S+       ++ ++ G+  P          G+   I  + +G  +  V   P     F  +AGT A +   LP+     V ++ G+ R + L A   A +G +SN +H      K G  RWLG R
Sbjct:  129 KHGGRNNSGKITVRHQGGGHRNRTRLIDFNRWEGG---------AQTVQRIEYDPGRSSHIALLKHNTTGELSYIIACDGLRPGDVVESFRRGIPQTLLNEMGGKVDPAILSVKTTQRGNCLPISMIPIGTIIHNVGITPVGPGKFCRSAGTYARVLAKLPEKKKAIVRLQSGEHRYVSLEA--VATIGVVSNIDHQNRSLGKAGRSRWLGIR 330          
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Nematostella
Match: EDO48947 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI04])

HSP 1 Score: 82.0333 bits (201), Expect = 1.928e-18
Identity = 64/198 (32.32%), Postives = 104/198 (52.53%), Query Frame = 1
Query:  262 GRGPTGRVELKHIGGGLKKPTFLVSKYRGGLSNGAEHV--ISEQIIYIHKNWWRSENIALVARGLT--KRWIYATTSMKVGDTVNSYGIMKQIKGQP------KPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQA-LIHQILPDDSVVIKIGKRLLK-LSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYR 819
            GR  +G++ L+H GGG  +   ++   R  L    E V  I ++++ +  +  RS  IALVA   +  ++ + A   ++VGD      +M   +G+P      KPGDAY +  L +G  V  +E YPG+GA  A  AGT A LI +   +++ V+++  ++ K +S+ C A +G++SN E       K G  RWL  R
Sbjct:    1 GRNSSGQIVLRHRGGGHSQNYRIIDFIRAPLCITGEAVTPIKDKVLQVGYDPCRSARIALVAGNGSNQEKLVIAPDEIQVGD------VMTASRGKPESLALLKPGDAYPLCFLPIGTVVHNIELYPGKGAQLARAAGTSAQLIRKT--NETAVVRLPSKVEKEVSSKCLASVGRVSNIERKNRVIGKAGRNRWLNRR 190          
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Medaka
Match: mrpl2 (mitochondrial ribosomal protein L2 [Source:NCBI gene;Acc:101171275])

HSP 1 Score: 126.331 bits (316), Expect = 4.140e-33
Identity = 80/228 (35.09%), Postives = 124/228 (54.39%), Query Frame = 1
Query:  226 YTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVS--KYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTH 903
            Y+  P+   KTGGR  TGRV    IGGG K+   ++   + R    +G      E+++ +  +  RS +IALVA G  KRWI AT +M+ G+ + + G++ ++      GDAY +G L VG  V  +E  PG+GA +   AGT  ++ + +   ++V    K+ +++   C   +G++SN +HNK    K G  RWLG R  SGL Q+K G  GR+I  L P   + +
Sbjct:   64 YSIRPMGMKKTGGRDHTGRVRTHGIGGGHKQKYRMIDFQRLRYEAPDGGRP-FEEKVVEVRYDPCRSADIALVAGGNRKRWIIATETMQAGNIIKTSGVIGRMAVSANEGDAYPLGALPVGTLVNNLEVQPGRGAEYIRAAGTSGVLLRKVNGTAIVQLPSKQQVQVLETCMVTVGRVSNVDHNKRVIGKAGRNRWLGIRPSSGLWQRKGGWAGRKIKPLPPMKSYVN 290          
BLAST of Ribosomal protein L2 domain protein vs. Planmine SMEST
Match: SMESG000000489.1 (SMESG000000489.1)

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 345/347 (99.42%), Postives = 347/347 (100.00%), Query Frame = 1
Query:   28 MFKLLGTTIIQSSLSRANVNALGFLMRQPKLGGIASERSFRPGILHPNGYSFDWAWKAAIPNIDTTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVSKYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHFAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVETEPKSGVISYSKPGMPAAMKREYTFDNPVNVKPLPVDENETHPRFKWYTWATR 1068
            MFKLLGTTIIQSSLSRANVNALGFLMRQPKLGGIASERSFRPGILHPNGYSFDWAWKAAIPNIDTTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVSKYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAH+AVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGR+GRRIYNLRPAADFTHVETEPKSGVISYSKPGMPAAMKREYTFDNPVNVKPLPVDENETHPRFKWYTWATR
Sbjct:    1 MFKLLGTTIIQSSLSRANVNALGFLMRQPKLGGIASERSFRPGILHPNGYSFDWAWKAAIPNIDTTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTFLVSKYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATTSMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAHYAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKIRYRKFGELRWLGYRQRSGLRQKKTGRFGRRIYNLRPAADFTHVETEPKSGVISYSKPGMPAAMKREYTFDNPVNVKPLPVDENETHPRFKWYTWATR 347          
The following BLAST results are available for this feature:
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
MRPL23.059e-3334.20mitochondrial ribosomal protein L2 [Source:HGNC Sy... [more]
AL355385.22.435e-2634.05pep chromosome:GRCh38:6:43051066:43058185:-1 gene:... [more]
MRPL21.607e-1935.29mitochondrial ribosomal protein L2 [Source:HGNC Sy... [more]
back to top
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl-24.739e-2937.17Mitochondrial Ribosomal Protein, Large [Source:Un... [more]
back to top
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mRpL22.946e-3535.80gene:FBgn0036135 transcript:FBtr0076211[more]
back to top
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl21.623e-3134.35mitochondrial ribosomal protein L2 [Source:ZFIN;Ac... [more]
back to top
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Mrpl21.546e-3533.59mitochondrial ribosomal protein L2 [Source:MGI Sym... [more]
Mrpl21.757e-3533.59mitochondrial ribosomal protein L2 [Source:MGI Sym... [more]
Mrpl21.199e-1133.12mitochondrial ribosomal protein L2 [Source:MGI Sym... [more]
back to top
BLAST of Ribosomal protein L2 domain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q498T4|RM02_RAT7.531e-3535.1239S ribosomal protein L2, mitochondrial OS=Rattus ... [more]
sp|Q9D773|RM02_MOUSE1.229e-3433.5939S ribosomal protein L2, mitochondrial OS=Mus mus... [more]
sp|Q2TA12|RM02_BOVIN2.058e-3334.9139S ribosomal protein L2, mitochondrial OS=Bos tau... [more]
sp|Q5T653|RM02_HUMAN1.469e-3234.2039S ribosomal protein L2, mitochondrial OS=Homo sa... [more]
sp|B8D0C7|RL2_HALOH1.025e-1634.8050S ribosomal protein L2 OS=Halothermothrix orenii... [more]
back to top
BLAST of Ribosomal protein L2 domain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MD516.096e-5938.27Ribosomal_L2_C domain-containing protein OS=Opisth... [more]
A0A074ZLB46.228e-5938.55Ribosomal_L2_C domain-containing protein OS=Opisth... [more]
A0A095AT711.112e-5736.3439S ribosomal protein L2, mitochondrial OS=Schisto... [more]
A0A1S8WZ362.286e-5739.58Ribosomal protein L2 domain protein OS=Opisthorchi... [more]
H2KUG32.665e-5637.7139S ribosomal protein L2 OS=Clonorchis sinensis OX... [more]
back to top
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl21.110e-3436.40mitochondrial ribosomal protein L2 [Source:NCBI ge... [more]
back to top
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl23.249e-3334.91mitochondrial ribosomal protein L2 [Source:ZFIN;Ac... [more]
back to top
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RML29.789e-926.76Mitochondrial ribosomal protein of the large subun... [more]
back to top
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO489471.928e-1832.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ribosomal protein L2 domain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl24.140e-3335.09mitochondrial ribosomal protein L2 [Source:NCBI ge... [more]
back to top
BLAST of Ribosomal protein L2 domain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000000489.10.000e+099.42SMESG000000489.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025110 ID=SMED30025110|Name=Ribosomal protein L2 domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1183bp
ATCTATATAAATCTTATATGAACAGATATGTTTAAGCTCCTCGGCACAAC
GATAATTCAGAGCTCGCTCAGCAGAGCTAATGTAAATGCTCTGGGATTCC
TCATGAGACAGCCGAAATTGGGAGGGATTGCTAGTGAGCGGTCGTTCCGG
CCGGGGATTTTACACCCGAATGGATATTCATTCGACTGGGCCTGGAAGGC
AGCAATTCCCAATATTGACACGACATATACTCATCTGCCGTTGCCCACGG
TTAAAACCGGTGGCCGAGGTCCTACTGGTAGAGTTGAACTAAAACATATC
GGCGGAGGCTTGAAGAAGCCTACATTTCTTGTTAGTAAATATCGAGGGGG
TTTAAGCAACGGGGCAGAACACGTGATATCAGAACAAATAATATATATCC
ATAAAAACTGGTGGAGATCGGAAAATATCGCCTTAGTTGCAAGAGGATTG
ACAAAGAGATGGATTTACGCTACAACGTCAATGAAAGTTGGAGATACTGT
CAATTCCTATGGAATCATGAAACAGATAAAGGGTCAGCCGAAGCCCGGTG
ATGCATACAATATCGGTTGCCTTTCTGTTGGCATGTCAGTATGCCAAGTG
GAGAAATATCCGGGCCAAGGGGCTCATTTTGCTGTCAATGCCGGCACTCA
GGCTCTAATTCATCAAATATTGCCCGATGATTCAGTGGTTATCAAAATTG
GAAAAAGACTTCTAAAATTGTCTGCTGGGTGTACTGCAGTACTAGGACAA
ATGTCCAATCCAGAGCATAACAAAATTCGTTATCGGAAATTCGGAGAATT
AAGGTGGCTGGGATATCGACAGAGATCGGGATTGCGACAAAAGAAAACCG
GTCGATACGGACGGAGAATTTACAATCTGAGGCCGGCAGCTGATTTCACT
CATGTGGAAACTGAGCCGAAATCTGGAGTTATCAGTTACAGCAAGCCCGG
CATGCCTGCGGCGATGAAGAGGGAGTACACGTTTGATAACCCGGTTAATG
TTAAACCGCTTCCTGTCGATGAGAATGAGACCCATCCTCGGTTCAAATGG
TATACTTGGGCTACACGATAGTAAATGCATTTGTGTGTTCCAGTTGCGTT
CCTTTCTCTTCACCCGGGCATTATTTTCTGCCTGTTTAAATGAATATATA
GAAATGTTTGTATAAAATTAATTTTCAATTTAA
back to top

protein sequence of SMED30025110-orf-1

>SMED30025110-orf-1 ID=SMED30025110-orf-1|Name=SMED30025110-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=348bp
MFKLLGTTIIQSSLSRANVNALGFLMRQPKLGGIASERSFRPGILHPNGY
SFDWAWKAAIPNIDTTYTHLPLPTVKTGGRGPTGRVELKHIGGGLKKPTF
LVSKYRGGLSNGAEHVISEQIIYIHKNWWRSENIALVARGLTKRWIYATT
SMKVGDTVNSYGIMKQIKGQPKPGDAYNIGCLSVGMSVCQVEKYPGQGAH
FAVNAGTQALIHQILPDDSVVIKIGKRLLKLSAGCTAVLGQMSNPEHNKI
RYRKFGELRWLGYRQRSGLRQKKTGRYGRRIYNLRPAADFTHVETEPKSG
VISYSKPGMPAAMKREYTFDNPVNVKPLPVDENETHPRFKWYTWATR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR022669Ribosomal_L2_C
IPR002171Ribosomal_L2
IPR012340NA-bd_OB-fold
IPR014722Rib_L2_dom2
IPR022666Rbsml_prot_L2_RNA-bd_dom
IPR008991Translation_prot_SH3-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006412translation