Eukaryotic initiation factor-4G

Overview
NameEukaryotic initiation factor-4G
Smed IDSMED30025106
Length (bp)4301
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eukaryotic initiation factor-4G (SMED30025106) t-SNE clustered cells

Violin plots show distribution of expression levels for Eukaryotic initiation factor-4G (SMED30025106) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Eukaryotic initiation factor-4G (SMED30025106) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Eukaryotic initiation factor-4G (SMED30025106) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025106

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025106h1SMcG0002525 Contig776newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025106h1SMcG0009297 Contig776newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
cephalic gangliaSMED30025106h1SMcG0002525 dd_Smed_v4_3720_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025106h1SMcG0002525 dd_Smed_v4_3720_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025106h1SMcG0002525 dd_Smed_v4_3720_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30025106h1SMcG0002525 dd_Smed_v6_3720_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Human
Match: EIF4G3 (eukaryotic translation initiation factor 4 gamma 3 [Source:HGNC Symbol;Acc:HGNC:3298])

HSP 1 Score: 147.902 bits (372), Expect = 5.360e-35
Identity = 126/418 (30.14%), Postives = 211/418 (50.48%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPE--SSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTE-------RKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLE-----ELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDS-KMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKF-NLMTKKKNVSNSQNI 2449
            YDR +L+  +      QKP  +P  ++   D I NQP++    L P             A+  +Q P  +     N   ++++       RK I + + ++    ++++ + P Q RD Q   D  E     EL R ++S LNK+TPQ F + +K++  L ++ +E +  +I+ +F KA+ E ++SV YA  C     L +   + P     F+  LL +CQ  FE   +D+ ++   E K+K L    + + +     +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K   LMTK+K     Q +
Sbjct:  344 YDREFLLDFQFMPACIQKPEGLPPISDVVLDKI-NQPKLPMRTLDPRILPRGPDFTPAFADFGRQTPGGRGVPLLNVGSRRSQPGQRREPRKIITVSVKEDVHLKKAENAWKPSQKRDSQA--DDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFE---KDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRV 750          

HSP 2 Score: 65.855 bits (159), Expect = 6.069e-10
Identity = 68/290 (23.45%), Postives = 130/290 (44.83%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFE---NIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWET--FLKVNNLEFTVDLPGLSLCGGDPLN---FIAEELEDML-----SNNLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSV----QEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDT--LTRIYDLLITEKIVSHQAL 3727
            V+  +E+    R  +G  L +L+  + +S Q   +G    +   DD+  DIP IW + A+ +   +  K   IS  E      K +LP     +  S  LH    ++ HK VG ++ ++ L W+  +P   +   FL    L+F   +   S C  + L+     AEEL   L      +  ++E+IF+++E ++D+         + + +++ KA   I +SS        +K +  I+ +  +   E E++ L ++     +L++    L   +D L  E+++S  A 
Sbjct:  983 VESTLERSQITRDHMGQLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPML--KEGGISMRELTIEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWREADLSWKDFLPEGEDVHNFLLEQKLDF---IESDSPCSSEALSKKELSAEELYKRLEKLIIEDKANDEQIFDWVEANLDEIQMSSPTFLRALMTAVCKAA-IIADSSTFRVDTAVIKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAF 1266          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Human
Match: EIF4G3 (eukaryotic translation initiation factor 4 gamma 3 [Source:HGNC Symbol;Acc:HGNC:3298])

HSP 1 Score: 147.902 bits (372), Expect = 6.030e-35
Identity = 126/418 (30.14%), Postives = 210/418 (50.24%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPE--SSSSQTNNERANNKKQLPNRQY-------SKYKNYNHKQTERKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLE-----ELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDS-KMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKF-NLMTKKKNVSNSQNI 2449
            YDR +L+  +      QKP  +P  ++   D I NQP++    L P             A+  +Q P  +        S+      ++  RK I + + ++    ++++ + P Q RD Q   D  E     EL R ++S LNK+TPQ F + +K++  L ++ +E +  +I+ +F KA+ E ++SV YA  C     L +   + P     F+  LL +CQ  FE   +D+ ++   E K+K L    + + +     +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K   LMTK+K     Q +
Sbjct:  630 YDREFLLDFQFMPACIQKPEGLPPISDVVLDKI-NQPKLPMRTLDPRILPRGPDFTPAFADFGRQTPGGRGVPLLNVGSRRSQPGQRREPRKIITVSVKEDVHLKKAENAWKPSQKRDSQA--DDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFE---KDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRV 1036          

HSP 2 Score: 63.929 bits (154), Expect = 2.759e-9
Identity = 68/290 (23.45%), Postives = 130/290 (44.83%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFE---NIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWET--FLKVNNLEFTVDLPGLSLCGGDPLN---FIAEELEDML-----SNNLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSV----QEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDT--LTRIYDLLITEKIVSHQAL 3727
            V+  +E+    R  +G  L +L+  + +S Q   +G    +   DD+  DIP IW + A+ +   +  K   IS  E      K +LP     +  S  LH    ++ HK VG ++ ++ L W+  +P   +   FL    L+F   +   S C  + L+     AEEL   L      +  ++E+IF+++E ++D+         + + +++ KA   I +SS        +K +  I+ +  +   E E++ L ++     +L++    L   +D L  E+++S  A 
Sbjct: 1269 VESTLERSQITRDHMGQLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPML--KEGGISMRELTIEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWREADLSWKDFLPEGEDVHNFLLEQKLDF---IESDSPCSSEALSKKELSAEELYKRLEKLIIEDKANDEQIFDWVEANLDEIQMSSPTFLRALMTAVCKAA-IIADSSTFRVDTAVIKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAF 1552          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Human
Match: EIF4G3 (eukaryotic translation initiation factor 4 gamma 3 [Source:HGNC Symbol;Acc:HGNC:3298])

HSP 1 Score: 147.902 bits (372), Expect = 6.221e-35
Identity = 126/418 (30.14%), Postives = 210/418 (50.24%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPE--SSSSQTNNERANNKKQLPNRQY-------SKYKNYNHKQTERKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLE-----ELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDS-KMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKF-NLMTKKKNVSNSQNI 2449
            YDR +L+  +      QKP  +P  ++   D I NQP++    L P             A+  +Q P  +        S+      ++  RK I + + ++    ++++ + P Q RD Q   D  E     EL R ++S LNK+TPQ F + +K++  L ++ +E +  +I+ +F KA+ E ++SV YA  C     L +   + P     F+  LL +CQ  FE   +D+ ++   E K+K L    + + +     +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K   LMTK+K     Q +
Sbjct:  624 YDREFLLDFQFMPACIQKPEGLPPISDVVLDKI-NQPKLPMRTLDPRILPRGPDFTPAFADFGRQTPGGRGVPLLNVGSRRSQPGQRREPRKIITVSVKEDVHLKKAENAWKPSQKRDSQA--DDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFE---KDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRV 1030          

HSP 2 Score: 63.929 bits (154), Expect = 2.711e-9
Identity = 68/290 (23.45%), Postives = 130/290 (44.83%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFE---NIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWET--FLKVNNLEFTVDLPGLSLCGGDPLN---FIAEELEDML-----SNNLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSV----QEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDT--LTRIYDLLITEKIVSHQAL 3727
            V+  +E+    R  +G  L +L+  + +S Q   +G    +   DD+  DIP IW + A+ +   +  K   IS  E      K +LP     +  S  LH    ++ HK VG ++ ++ L W+  +P   +   FL    L+F   +   S C  + L+     AEEL   L      +  ++E+IF+++E ++D+         + + +++ KA   I +SS        +K +  I+ +  +   E E++ L ++     +L++    L   +D L  E+++S  A 
Sbjct: 1263 VESTLERSQITRDHMGQLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPML--KEGGISMRELTIEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWREADLSWKDFLPEGEDVHNFLLEQKLDF---IESDSPCSSEALSKKELSAEELYKRLEKLIIEDKANDEQIFDWVEANLDEIQMSSPTFLRALMTAVCKAA-IIADSSTFRVDTAVIKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAF 1546          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Human
Match: EIF4G3 (eukaryotic translation initiation factor 4 gamma 3 [Source:HGNC Symbol;Acc:HGNC:3298])

HSP 1 Score: 147.517 bits (371), Expect = 7.797e-35
Identity = 126/418 (30.14%), Postives = 210/418 (50.24%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPE--SSSSQTNNERANNKKQLPNRQY-------SKYKNYNHKQTERKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLE-----ELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDS-KMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKF-NLMTKKKNVSNSQNI 2449
            YDR +L+  +      QKP  +P  ++   D I NQP++    L P             A+  +Q P  +        S+      ++  RK I + + ++    ++++ + P Q RD Q   D  E     EL R ++S LNK+TPQ F + +K++  L ++ +E +  +I+ +F KA+ E ++SV YA  C     L +   + P     F+  LL +CQ  FE   +D+ ++   E K+K L    + + +     +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K   LMTK+K     Q +
Sbjct:  813 YDREFLLDFQFMPACIQKPEGLPPISDVVLDKI-NQPKLPMRTLDPRILPRGPDFTPAFADFGRQTPGGRGVPLLNVGSRRSQPGQRREPRKIITVSVKEDVHLKKAENAWKPSQKRDSQA--DDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFE---KDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRV 1219          

HSP 2 Score: 63.5438 bits (153), Expect = 3.505e-9
Identity = 68/290 (23.45%), Postives = 130/290 (44.83%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFE---NIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWET--FLKVNNLEFTVDLPGLSLCGGDPLN---FIAEELEDML-----SNNLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSV----QEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDT--LTRIYDLLITEKIVSHQAL 3727
            V+  +E+    R  +G  L +L+  + +S Q   +G    +   DD+  DIP IW + A+ +   +  K   IS  E      K +LP     +  S  LH    ++ HK VG ++ ++ L W+  +P   +   FL    L+F   +   S C  + L+     AEEL   L      +  ++E+IF+++E ++D+         + + +++ KA   I +SS        +K +  I+ +  +   E E++ L ++     +L++    L   +D L  E+++S  A 
Sbjct: 1452 VESTLERSQITRDHMGQLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPML--KEGGISMRELTIEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWREADLSWKDFLPEGEDVHNFLLEQKLDF---IESDSPCSSEALSKKELSAEELYKRLEKLIIEDKANDEQIFDWVEANLDEIQMSSPTFLRALMTAVCKAA-IIADSSTFRVDTAVIKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAF 1735          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Human
Match: EIF4G3 (eukaryotic translation initiation factor 4 gamma 3 [Source:HGNC Symbol;Acc:HGNC:3298])

HSP 1 Score: 139.043 bits (349), Expect = 2.829e-32
Identity = 108/340 (31.76%), Postives = 181/340 (53.24%), Query Frame = 2
Query: 1475 SKYKNYNHKQTERKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLE-----ELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDS-KMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKF-NLMTKKKNVSNSQNI 2449
            S+      ++  RK I + + ++    ++++ + P Q RD Q   D  E     EL R ++S LNK+TPQ F + +K++  L ++ +E +  +I+ +F KA+ E ++SV YA  C     L +   + P     F+  LL +CQ  FE   +D+ ++   E K+K L    + + +     +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K   LMTK+K     Q +
Sbjct:  737 SRRSQPGQRREPRKIITVSVKEDVHLKKAENAWKPSQKRDSQA--DDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFE---KDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRV 1066          

HSP 2 Score: 63.929 bits (154), Expect = 2.723e-9
Identity = 67/290 (23.10%), Postives = 131/290 (45.17%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFE---NIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWET--FLKVNNLEFTVDLPGLSLCGGDPLN---FIAEELED-----MLSNNLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSV----QEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDT--LTRIYDLLITEKIVSHQAL 3727
            V+  +E+    R  +G  L +L+  + +S Q   +G    +   DD+  DIP IW + A+ +   +  K   IS  E      K +LP     +  S  LH    ++ HK VG ++ ++ L W+  +P   +   FL    L+F   +   S C  + L+     AEEL       ++ +  ++E+IF+++E ++D+         + + +++ KA   I +SS        +K +  I+ +  +   E E++ L ++     +L++    L   +D L  E+++S  A 
Sbjct: 1299 VESTLERSQITRDHMGQLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPML--KEGGISMRELTIEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWREADLSWKDFLPEGEDVHNFLLEQKLDF---IESDSPCSSEALSKKELSAEELYKRLEKLIIEDKANDEQIFDWVEANLDEIQMSSPTFLRALMTAVCKAA-IIADSSTFRVDTAVIKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAF 1582          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Celegans
Match: ifg-1 (Initiation Factor 4G (eIF4G) family [Source:UniProtKB/TrEMBL;Acc:B5BM23])

HSP 1 Score: 59.6918 bits (143), Expect = 1.634e-8
Identity = 61/249 (24.50%), Postives = 123/249 (49.40%), Query Frame = 2
Query: 1622 ELKRNIKSNLNKITPQN-FPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNN-PAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELL---------RDSYDSDAMLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSVDLEK-----RIRFKLKDIIDMRERNWTLR 2311
            E+ + ++S +NK+TP +  P   + I      N  +++ ++  +F KAV+E  +   YA+ C   A   ++ T    AF+ ++L + Q  F    QD+ +++  +    +  E D   K L    L E+ +K + + FG + F+G L+ + LL+ K++  C  EL          ++  D +++    +L+ET G  +D K K+S   +   + +  Q ++  K     +IRF + +++++R+  W  R
Sbjct:  402 EVCKKVRSLMNKVTPTSQRPLTEEFISYNVSSNDAQLAQVVEIVFDKAVEEPKFCALYAEMCKAQANHELSQTGGKSAFRNKVLTRTQMTF----QDK-KDIDADKLAIIEKEEDPVKKELM---LAEEKQKFRRRKFGVMTFMGYLYRNQLLSTKIVQTCTFELFNSIKDQDIKKEDVDEESIHCGLQLIETVGVMLD-KSKDSTTVF---LDQWFQKLEAAKPYCSNKIRFMIMNLMELRKDKWIPR 638          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Celegans
Match: ifg-1 (Initiation Factor 4G (eIF4G) family [Source:UniProtKB/TrEMBL;Acc:B5BM23])

HSP 1 Score: 59.6918 bits (143), Expect = 1.634e-8
Identity = 61/249 (24.50%), Postives = 123/249 (49.40%), Query Frame = 2
Query: 1622 ELKRNIKSNLNKITPQN-FPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNN-PAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELL---------RDSYDSDAMLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSVDLEK-----RIRFKLKDIIDMRERNWTLR 2311
            E+ + ++S +NK+TP +  P   + I      N  +++ ++  +F KAV+E  +   YA+ C   A   ++ T    AF+ ++L + Q  F    QD+ +++  +    +  E D   K L    L E+ +K + + FG + F+G L+ + LL+ K++  C  EL          ++  D +++    +L+ET G  +D K K+S   +   + +  Q ++  K     +IRF + +++++R+  W  R
Sbjct:  402 EVCKKVRSLMNKVTPTSQRPLTEEFISYNVSSNDAQLAQVVEIVFDKAVEEPKFCALYAEMCKAQANHELSQTGGKSAFRNKVLTRTQMTF----QDK-KDIDADKLAIIEKEEDPVKKELM---LAEEKQKFRRRKFGVMTFMGYLYRNQLLSTKIVQTCTFELFNSIKDQDIKKEDVDEESIHCGLQLIETVGVMLD-KSKDSTTVF---LDQWFQKLEAAKPYCSNKIRFMIMNLMELRKDKWIPR 638          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Celegans
Match: ifg-1 (Initiation Factor 4G (eIF4G) family [Source:UniProtKB/TrEMBL;Acc:B5BM23])

HSP 1 Score: 59.6918 bits (143), Expect = 1.634e-8
Identity = 61/249 (24.50%), Postives = 123/249 (49.40%), Query Frame = 2
Query: 1622 ELKRNIKSNLNKITPQN-FPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNN-PAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELL---------RDSYDSDAMLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSVDLEK-----RIRFKLKDIIDMRERNWTLR 2311
            E+ + ++S +NK+TP +  P   + I      N  +++ ++  +F KAV+E  +   YA+ C   A   ++ T    AF+ ++L + Q  F    QD+ +++  +    +  E D   K L    L E+ +K + + FG + F+G L+ + LL+ K++  C  EL          ++  D +++    +L+ET G  +D K K+S   +   + +  Q ++  K     +IRF + +++++R+  W  R
Sbjct:  402 EVCKKVRSLMNKVTPTSQRPLTEEFISYNVSSNDAQLAQVVEIVFDKAVEEPKFCALYAEMCKAQANHELSQTGGKSAFRNKVLTRTQMTF----QDK-KDIDADKLAIIEKEEDPVKKELM---LAEEKQKFRRRKFGVMTFMGYLYRNQLLSTKIVQTCTFELFNSIKDQDIKKEDVDEESIHCGLQLIETVGVMLD-KSKDSTTVF---LDQWFQKLEAAKPYCSNKIRFMIMNLMELRKDKWIPR 638          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Celegans
Match: ifg-1 (Initiation Factor 4G (eIF4G) family [Source:UniProtKB/TrEMBL;Acc:B5BM23])

HSP 1 Score: 59.6918 bits (143), Expect = 1.786e-8
Identity = 61/249 (24.50%), Postives = 123/249 (49.40%), Query Frame = 2
Query: 1622 ELKRNIKSNLNKITPQN-FPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNN-PAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELL---------RDSYDSDAMLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSVDLEK-----RIRFKLKDIIDMRERNWTLR 2311
            E+ + ++S +NK+TP +  P   + I      N  +++ ++  +F KAV+E  +   YA+ C   A   ++ T    AF+ ++L + Q  F    QD+ +++  +    +  E D   K L    L E+ +K + + FG + F+G L+ + LL+ K++  C  EL          ++  D +++    +L+ET G  +D K K+S   +   + +  Q ++  K     +IRF + +++++R+  W  R
Sbjct:  516 EVCKKVRSLMNKVTPTSQRPLTEEFISYNVSSNDAQLAQVVEIVFDKAVEEPKFCALYAEMCKAQANHELSQTGGKSAFRNKVLTRTQMTF----QDK-KDIDADKLAIIEKEEDPVKKELM---LAEEKQKFRRRKFGVMTFMGYLYRNQLLSTKIVQTCTFELFNSIKDQDIKKEDVDEESIHCGLQLIETVGVMLD-KSKDSTTVF---LDQWFQKLEAAKPYCSNKIRFMIMNLMELRKDKWIPR 752          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Celegans
Match: ifg-1 (Initiation Factor 4G (eIF4G) family [Source:UniProtKB/TrEMBL;Acc:B5BM23])

HSP 1 Score: 59.6918 bits (143), Expect = 1.926e-8
Identity = 61/250 (24.40%), Postives = 125/250 (50.00%), Query Frame = 2
Query: 1622 ELKRNIKSNLNKITPQN-FPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC-----YKLAITYTNNPAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELL---------RDSYDSDAMLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSVDLEK-----RIRFKLKDIIDMRERNWTLR 2311
            E+ + ++S +NK+TP +  P   + I      N  +++ ++  +F KAV+E  +   YA+ C     ++L+ T   + AF+ ++L + Q  F    QD+ +++  +    +  E D   K L    L E+ +K + + FG + F+G L+ + LL+ K++  C  EL          ++  D +++    +L+ET G  +D K K+S   +   + +  Q ++  K     +IRF + +++++R+  W  R
Sbjct:  515 EVCKKVRSLMNKVTPTSQRPLTEEFISYNVSSNDAQLAQVVEIVFDKAVEEPKFCALYAEMCKAQANHELSQTGGKS-AFRNKVLTRTQMTF----QDK-KDIDADKLAIIEKEEDPVKKELM---LAEEKQKFRRRKFGVMTFMGYLYRNQLLSTKIVQTCTFELFNSIKDQDIKKEDVDEESIHCGLQLIETVGVMLD-KSKDSTTVF---LDQWFQKLEAAKPYCSNKIRFMIMNLMELRKDKWIPR 751          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Fly
Match: NAT1 (gene:FBgn0010488 transcript:FBtr0334772)

HSP 1 Score: 122.865 bits (307), Expect = 1.258e-27
Identity = 93/294 (31.63%), Postives = 147/294 (50.00%), Query Frame = 2
Query: 1490 YNHKQTERKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSL--EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKL---AITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDA--------MLALCKLLETCGKQIDVKH-KESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHV 2317
            ++ +Q ER Q     +   +  R    ++PP LR +  L  S   + + R ++  LNK+TP+ F E   E+  L++ +   +  +I  IF KA+ E  YS  YAQ C +L   A ++   P+    F   L+  C+D F   L+               +E D++     E+D EE+   AK +  GN++FIGEL   ++L+  V+  CI+EL        A        M  L +LL+TCGK +D +  KE MN+Y   + R S+S +   RIRF LKD+I++R+ NW  R +
Sbjct:  474 HSQQQQERSQAGKASTPPPITGR----WIPPSLRPQHGLTQSEKNDAVFRRVRGILNKLTPEKFQELSDELLKLDLNSIAILKGVILLIFDKALDEPKYSSMYAQLCKRLSEEAPSFDKEPSNSSTFLRLLIAVCRDKFNNRLK--------------RDENDNRPPPENEADEEERRHLAKQRMLGNVKFIGELNKLDMLSKNVLHQCIMELFDKKKKRTAGTQEMCEDMECLAQLLKTCGKNLDSEQGKELMNQYFEKLERRSKSSEYPPRIRFMLKDVIELRQNNWVPRKL 749          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Fly
Match: eIF4G1 (gene:FBgn0023213 transcript:FBtr0112904)

HSP 1 Score: 103.219 bits (256), Expect = 1.607e-21
Identity = 90/274 (32.85%), Postives = 145/274 (52.92%), Query Frame = 2
Query: 1619 EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLAI------------TYTNNPAFKGQLLKKCQDMFETPLQDQLENVRNEWK-----EKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQID---VKHKE-----SMNKYISDISRLSQSVD-----LEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTL 2350
            +EL R ++  LNK+TP+ F   V+EI  L I+  ++V  +I  +F KA+ E  +SV+YA+ C +LA             T +N+  F+  LL K +  F    Q+  ++   E K     +K+   TD+  KA  E+ LEE+ +K + +  G +RFIGELF  ++L GK+I +CI  LL + +  D +  LCKLL T G + +   V  K+     S+ K I+ +  ++   D     +  R+RF L+D+ID+R+  W     Q  +   PKT+
Sbjct: 1000 DELVRRVRGILNKLTPERFDTLVEEIIKLKIDTPDKVDEVIVLVFEKAIDEPNFSVSYARLCQRLAAEVKVIDERMESETKSNSAHFRNALLDKTEQEF---TQNVSQSTAKEKKLQPIVDKIKKCTDANEKAELEAFLEEEERKIRRRSGGTVRFIGELFKISMLTGKIIYSCIDTLL-NPHSEDMLECLCKLLTTVGAKFEKTPVNSKDPSRCYSLEKSITRMQAIASKTDKDGARVSSRVRFMLQDVIDLRKNKW-----QTSRNEAPKTM 1264          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Fly
Match: eIF4G1 (gene:FBgn0023213 transcript:FBtr0289951)

HSP 1 Score: 102.834 bits (255), Expect = 1.846e-21
Identity = 90/274 (32.85%), Postives = 145/274 (52.92%), Query Frame = 2
Query: 1619 EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLAI------------TYTNNPAFKGQLLKKCQDMFETPLQDQLENVRNEWK-----EKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQID---VKHKE-----SMNKYISDISRLSQSVD-----LEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTL 2350
            +EL R ++  LNK+TP+ F   V+EI  L I+  ++V  +I  +F KA+ E  +SV+YA+ C +LA             T +N+  F+  LL K +  F    Q+  ++   E K     +K+   TD+  KA  E+ LEE+ +K + +  G +RFIGELF  ++L GK+I +CI  LL + +  D +  LCKLL T G + +   V  K+     S+ K I+ +  ++   D     +  R+RF L+D+ID+R+  W     Q  +   PKT+
Sbjct:  747 DELVRRVRGILNKLTPERFDTLVEEIIKLKIDTPDKVDEVIVLVFEKAIDEPNFSVSYARLCQRLAAEVKVIDERMESETKSNSAHFRNALLDKTEQEF---TQNVSQSTAKEKKLQPIVDKIKKCTDANEKAELEAFLEEEERKIRRRSGGTVRFIGELFKISMLTGKIIYSCIDTLL-NPHSEDMLECLCKLLTTVGAKFEKTPVNSKDPSRCYSLEKSITRMQAIASKTDKDGARVSSRVRFMLQDVIDLRKNKW-----QTSRNEAPKTM 1011          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Fly
Match: eIF4G1 (gene:FBgn0023213 transcript:FBtr0089243)

HSP 1 Score: 102.834 bits (255), Expect = 1.846e-21
Identity = 90/274 (32.85%), Postives = 145/274 (52.92%), Query Frame = 2
Query: 1619 EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLAI------------TYTNNPAFKGQLLKKCQDMFETPLQDQLENVRNEWK-----EKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQID---VKHKE-----SMNKYISDISRLSQSVD-----LEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTL 2350
            +EL R ++  LNK+TP+ F   V+EI  L I+  ++V  +I  +F KA+ E  +SV+YA+ C +LA             T +N+  F+  LL K +  F    Q+  ++   E K     +K+   TD+  KA  E+ LEE+ +K + +  G +RFIGELF  ++L GK+I +CI  LL + +  D +  LCKLL T G + +   V  K+     S+ K I+ +  ++   D     +  R+RF L+D+ID+R+  W     Q  +   PKT+
Sbjct:  747 DELVRRVRGILNKLTPERFDTLVEEIIKLKIDTPDKVDEVIVLVFEKAIDEPNFSVSYARLCQRLAAEVKVIDERMESETKSNSAHFRNALLDKTEQEF---TQNVSQSTAKEKKLQPIVDKIKKCTDANEKAELEAFLEEEERKIRRRSGGTVRFIGELFKISMLTGKIIYSCIDTLL-NPHSEDMLECLCKLLTTVGAKFEKTPVNSKDPSRCYSLEKSITRMQAIASKTDKDGARVSSRVRFMLQDVIDLRKNKW-----QTSRNEAPKTM 1011          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Fly
Match: NAT1 (gene:FBgn0010488 transcript:FBtr0087786)

HSP 1 Score: 93.2041 bits (230), Expect = 1.030e-18
Identity = 64/192 (33.33%), Postives = 97/192 (50.52%), Query Frame = 2
Query: 1790 YAQFCYKL---AITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDA--------MLALCKLLETCGKQIDVKH-KESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHV 2317
            YAQ C +L   A ++   P+    F   L+  C+D F   L+               +E D++     E+D EE+   AK +  GN++FIGEL   ++L+  V+  CI+EL        A        M  L +LL+TCGK +D +  KE MN+Y   + R S+S +   RIRF LKD+I++R+ NW  R +
Sbjct:    2 YAQLCKRLSEEAPSFDKEPSNSSTFLRLLIAVCRDKFNNRLK--------------RDENDNRPPPENEADEEERRHLAKQRMLGNVKFIGELNKLDMLSKNVLHQCIMELFDKKKKRTAGTQEMCEDMECLAQLLKTCGKNLDSEQGKELMNQYFEKLERRSKSSEYPPRIRFMLKDVIELRQNNWVPRKL 179          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Zebrafish
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma, 3a [Source:ZFIN;Acc:ZDB-GENE-120810-2])

HSP 1 Score: 152.91 bits (385), Expect = 9.721e-37
Identity = 138/480 (28.75%), Postives = 237/480 (49.38%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSED--------IISNQPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQINLEISDNQVFIRSKSGYLPPQLR-----DKQKLLDSLEELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKM-KALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFN--LMTKKKNVSNSQNIARRNIQKNVSIKNLSCNSH-------------KVDEKTVLGPVLG-NWATGSGSKSKSHEAE 2593
            YDR +L+  +      QKP  +P  ++   D        + S  PR+IS   P + + +      A+  +Q+   + +   N       +  +NL +SD+    ++++ + P   R     D + +    +EL R ++S LNK+TPQ F + +K++  L I  +E +  +I+ +F KA+ E ++SV YA  C  LA   +   + P     F+  LL +CQ  FE   +D++++V  E K+K ++   S   K   + +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K +  L++K       Q   R   ++  +    + NS              ++DEK  LGP    NW  GS   +K+ ++E
Sbjct:  355 YDRDFLLGFQFMPACVQKPEGLPPISDVVLDKMNQNKLPLRSVDPRLISRGTPQDFTPA-----FADFSRQMAGGRGAPLLNVRRLPPRKIIVNLSVSDDVQLKKAENAWKPGMKREGVAEDPETI--RTQELFRKVRSILNKLTPQMFHQLMKQVTDLTINTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPTADKPNTTVNFRKLLLNRCQKEFE---RDKVDDVVLERKQKEIDSATSPTEKERLQEELEEAKDKARRRSTGNIKFIGELFKLKMLTEPIMHDCVVKLLKN-HDDESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQ----GPKTIEQIHKEAKLEEQEEQRKVHQQLLSKDMKRRPDQREQRSMREETWNTVPTTKNSRTIDPTKIPKISKPQIDEKIQLGPRAQINWVKGSSGGAKASDSE 819          

HSP 2 Score: 87.8113 bits (216), Expect = 8.798e-17
Identity = 71/285 (24.91%), Postives = 136/285 (47.72%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNI-SFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVP--NHWETFLKVNNLEFTV-DLPGLSLCGGDPLNFIAEE----LEDMLSNNL-SNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQ---EYLKSKKEIIKRISNHKLENEIEILKSI--LNVASELNRDTLTRIYDLLITEKIVSHQAL 3727
            ++  +E+    R  +G    +L+   I+   Q+ +G    +   DD+  DIP IW + A+ L   + +   N+   F  + K +LP    A+  S  LH    ++ H+ VG ++ +S L W   +P   H   F+  + LEFTV D+  +S     P +   EE    LE +L  ++ S+E+IF+++E ++D+     S   + + ++I KA  K   +S +     ++ +  I+ +  +   E +++ L ++  L VA +   + L   +D L  E ++S  A 
Sbjct:  994 LESTLERSQKAREHMGLLYYQLIQKGILPHSQLYKGFSEMLEQADDMAIDIPFIWLYLAELLSPLLKEGGINMRELFSELSKPLLPVGRAAILLSEILHLLCKQMSHRKVGDLWRESGLNWADFLPEGEHLPAFISQHKLEFTVSDISPVSPASAKP-SLSPEELFKQLEQLLLEDMSSDEQIFDWIEANLDESQMSSSPFLRALMTAICKAAVKDESTSCRVDTAIIQKRLPILHKYFDSDTERQLQALYALQSLIVALDQPPNLLRMFFDCLYDEDVISEDAF 1277          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Zebrafish
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma, 3a [Source:ZFIN;Acc:ZDB-GENE-120810-2])

HSP 1 Score: 152.91 bits (385), Expect = 1.089e-36
Identity = 138/480 (28.75%), Postives = 237/480 (49.38%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSED--------IISNQPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQINLEISDNQVFIRSKSGYLPPQLR-----DKQKLLDSLEELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKM-KALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFN--LMTKKKNVSNSQNIARRNIQKNVSIKNLSCNSH-------------KVDEKTVLGPVLG-NWATGSGSKSKSHEAE 2593
            YDR +L+  +      QKP  +P  ++   D        + S  PR+IS   P + + +      A+  +Q+   + +   N       +  +NL +SD+    ++++ + P   R     D + +    +EL R ++S LNK+TPQ F + +K++  L I  +E +  +I+ +F KA+ E ++SV YA  C  LA   +   + P     F+  LL +CQ  FE   +D++++V  E K+K ++   S   K   + +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K +  L++K       Q   R   ++  +    + NS              ++DEK  LGP    NW  GS   +K+ ++E
Sbjct:  358 YDRDFLLGFQFMPACVQKPEGLPPISDVVLDKMNQNKLPLRSVDPRLISRGTPQDFTPA-----FADFSRQMAGGRGAPLLNVRRLPPRKIIVNLSVSDDVQLKKAENAWKPGMKREGVAEDPETI--RTQELFRKVRSILNKLTPQMFHQLMKQVTDLTINTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPTADKPNTTVNFRKLLLNRCQKEFE---RDKVDDVVLERKQKEIDSATSPTEKERLQEELEEAKDKARRRSTGNIKFIGELFKLKMLTEPIMHDCVVKLLKN-HDDESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQ----GPKTIEQIHKEAKLEEQEEQRKVHQQLLSKDMKRRPDQREQRSMREETWNTVPTTKNSRTIDPTKIPKISKPQIDEKIQLGPRAQINWVKGSSGGAKASDSE 822          

HSP 2 Score: 87.4261 bits (215), Expect = 1.070e-16
Identity = 71/285 (24.91%), Postives = 136/285 (47.72%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNI-SFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVP--NHWETFLKVNNLEFTV-DLPGLSLCGGDPLNFIAEE----LEDMLSNNL-SNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQ---EYLKSKKEIIKRISNHKLENEIEILKSI--LNVASELNRDTLTRIYDLLITEKIVSHQAL 3727
            ++  +E+    R  +G    +L+   I+   Q+ +G    +   DD+  DIP IW + A+ L   + +   N+   F  + K +LP    A+  S  LH    ++ H+ VG ++ +S L W   +P   H   F+  + LEFTV D+  +S     P +   EE    LE +L  ++ S+E+IF+++E ++D+     S   + + ++I KA  K   +S +     ++ +  I+ +  +   E +++ L ++  L VA +   + L   +D L  E ++S  A 
Sbjct:  997 LESTLERSQKAREHMGLLYYQLIQKGILPHSQLYKGFSEMLEQADDMAIDIPFIWLYLAELLSPLLKEGGINMRELFSELSKPLLPVGRAAILLSEILHLLCKQMSHRKVGDLWRESGLNWADFLPEGEHLPAFISQHKLEFTVSDISPVSPASAKP-SLSPEELFKQLEQLLLEDMSSDEQIFDWIEANLDESQMSSSPFLRALMTAICKAAVKDESTSCRVDTAIIQKRLPILHKYFDSDTERQLQALYALQSLIVALDQPPNLLRMFFDCLYDEDVISEDAF 1280          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Zebrafish
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma, 3a [Source:ZFIN;Acc:ZDB-GENE-120810-2])

HSP 1 Score: 150.984 bits (380), Expect = 5.400e-36
Identity = 138/480 (28.75%), Postives = 237/480 (49.38%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSED--------IISNQPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQINLEISDNQVFIRSKSGYLPPQLR-----DKQKLLDSLEELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKM-KALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFN--LMTKKKNVSNSQNIARRNIQKNVSIKNLSCNSH-------------KVDEKTVLGPVLG-NWATGSGSKSKSHEAE 2593
            YDR +L+  +      QKP  +P  ++   D        + S  PR+IS   P + + +      A+  +Q+   + +   N       +  +NL +SD+    ++++ + P   R     D + +    +EL R ++S LNK+TPQ F + +K++  L I  +E +  +I+ +F KA+ E ++SV YA  C  LA   +   + P     F+  LL +CQ  FE   +D++++V  E K+K ++   S   K   + +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K +  L++K       Q   R   ++  +    + NS              ++DEK  LGP    NW  GS   +K+ ++E
Sbjct:  750 YDRDFLLGFQFMPACVQKPEGLPPISDVVLDKMNQNKLPLRSVDPRLISRGTPQDFTPA-----FADFSRQMAGGRGAPLLNVRRLPPRKIIVNLSVSDDVQLKKAENAWKPGMKREGVAEDPETI--RTQELFRKVRSILNKLTPQMFHQLMKQVTDLTINTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPTADKPNTTVNFRKLLLNRCQKEFE---RDKVDDVVLERKQKEIDSATSPTEKERLQEELEEAKDKARRRSTGNIKFIGELFKLKMLTEPIMHDCVVKLLKN-HDDESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQ----GPKTIEQIHKEAKLEEQEEQRKVHQQLLSKDMKRRPDQREQRSMREETWNTVPTTKNSRTIDPTKIPKISKPQIDEKIQLGPRAQINWVKGSSGGAKASDSE 1214          

HSP 2 Score: 88.5817 bits (218), Expect = 5.144e-17
Identity = 71/289 (24.57%), Postives = 137/289 (47.40%), Query Frame = 2
Query: 2906 IEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNI-SFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVP--NHWETFLKVNNLEFTV-DLPGLSLCGGDPLNFIAEE----LEDMLSNNL-SNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQ---EYLKSKKEIIKRISNHKLENEIEILKSI--LNVASELNRDTLTRIYDLLITEKIVSHQAL 3727
            +   ++  +E+    R  +G    +L+   I+   Q+ +G    +   DD+  DIP IW + A+ L   + +   N+   F  + K +LP    A+  S  LH    ++ H+ VG ++ +S L W   +P   H   F+  + LEFTV D+  +S     P +   EE    LE +L  ++ S+E+IF+++E ++D+     S   + + ++I KA  K   +S +     ++ +  I+ +  +   E +++ L ++  L VA +   + L   +D L  E ++S  A 
Sbjct: 1385 VRMGLESTLERSQKAREHMGLLYYQLIQKGILPHSQLYKGFSEMLEQADDMAIDIPFIWLYLAELLSPLLKEGGINMRELFSELSKPLLPVGRAAILLSEILHLLCKQMSHRKVGDLWRESGLNWADFLPEGEHLPAFISQHKLEFTVSDISPVSPASAKP-SLSPEELFKQLEQLLLEDMSSDEQIFDWIEANLDESQMSSSPFLRALMTAICKAAVKDESTSCRVDTAIIQKRLPILHKYFDSDTERQLQALYALQSLIVALDQPPNLLRMFFDCLYDEDVISEDAF 1672          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Zebrafish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma, 3b [Source:ZFIN;Acc:ZDB-GENE-090312-49])

HSP 1 Score: 133.265 bits (334), Expect = 1.367e-30
Identity = 108/351 (30.77%), Postives = 180/351 (51.28%), Query Frame = 2
Query: 1619 EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVK-KAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFNLMTKKKNVSNSQNIARRNIQKNVSIKNLS----------CNSHKVDEKTVLGP-VLGNWATGS--GSKSKSHEAEGWTP 2605
            +EL R ++S LNK+TPQ F + +K++  L I+ +E +  +I+ +F KA+ E ++SV Y   C  LA   +  T+ P     F+  LL +CQ  FE   +D++++   E K + L    +  +     +  E+ K KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   +A  E      K +     K+      + R      V +   S           +   +DEK  LGP    NW  GS  G+ +K+ E++   P
Sbjct:  866 QELFRKVRSILNKLTPQMFSQLMKQVTDLTIDTEERLKGVIDLVFEKAINEPSFSVAYGNMCSCLATLKVPMTDKPNSTVNFRKLLLNRCQKEFE---KDKMDDDAFEKKHRELEAATASSERERLQEELEEAKDKARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQ----GPKTIEQIHKDAKLEEQEEQRKVHQQLLSKDNKRRPVVQREETWSTVPMTKNSRTIDPAKIPKFSKPAIDEKIQLGPRAQVNWMKGSSGGAGAKASESDASRP 1208          

HSP 2 Score: 78.1814 bits (191), Expect = 7.747e-14
Identity = 64/290 (22.07%), Postives = 133/290 (45.86%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNI-SFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWE--TFLKVNNLEFTVDLPGLSLCGGDPLNFIA------EELED-----MLSNNLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQ---EYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDT--LTRIYDLLITEKIVSHQAL 3727
            V+  +E+    R  +G  L +LL   ++   Q  +G    +   DD+  DIP IW + A+ +   + +   ++   F    K +LP     + FS  LH    ++ HK VG ++  S L W   +P   +  +F+  + LEFT+        G +P   ++      EEL       +L + + +E+IF+++E ++D+     +   + + +++ KA  K   SS +     ++++  ++ +  N   E +++ L ++  +  +L++    L   +D L  E ++S  A 
Sbjct: 1377 VESTLERSQITRDHMGQLLFQLLQAGVLPKLQFFKGFSETLELADDMAIDIPHIWLYLAELVTPVLREGGISMRELFSEFSKPLLPVGRAGILFSEILHLLCKQMSHKKVGSLWRDSGLSWADFIPETEDVHSFITEHKLEFTLS------DGSNPTEAVSKRTLSPEELNKQLEKLLLEDMVGDEQIFDWVEANLDESEMSSAPFVRALMTAVCKAAVKTEGSSCKVDLSIIQTRLPVLHKYLNSDTERQLQALYALQALIVKLDQPANLLRMFFDCLYDEDVISEDAF 1660          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Zebrafish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma, 3b [Source:ZFIN;Acc:ZDB-GENE-090312-49])

HSP 1 Score: 132.88 bits (333), Expect = 1.567e-30
Identity = 108/351 (30.77%), Postives = 180/351 (51.28%), Query Frame = 2
Query: 1619 EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVK-KAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFNLMTKKKNVSNSQNIARRNIQKNVSIKNLS----------CNSHKVDEKTVLGP-VLGNWATGS--GSKSKSHEAEGWTP 2605
            +EL R ++S LNK+TPQ F + +K++  L I+ +E +  +I+ +F KA+ E ++SV Y   C  LA   +  T+ P     F+  LL +CQ  FE   +D++++   E K + L    +  +     +  E+ K KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   +A  E      K +     K+      + R      V +   S           +   +DEK  LGP    NW  GS  G+ +K+ E++   P
Sbjct:  867 QELFRKVRSILNKLTPQMFSQLMKQVTDLTIDTEERLKGVIDLVFEKAINEPSFSVAYGNMCSCLATLKVPMTDKPNSTVNFRKLLLNRCQKEFE---KDKMDDDAFEKKHRELEAATASSERERLQEELEEAKDKARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQ----GPKTIEQIHKDAKLEEQEEQRKVHQQLLSKDNKRRPVVQREETWSTVPMTKNSRTIDPAKIPKFSKPAIDEKIQLGPRAQVNWMKGSSGGAGAKASESDASRP 1209          

HSP 2 Score: 78.1814 bits (191), Expect = 7.340e-14
Identity = 64/290 (22.07%), Postives = 133/290 (45.86%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNI-SFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWE--TFLKVNNLEFTVDLPGLSLCGGDPLNFIA------EELED-----MLSNNLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQ---EYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDT--LTRIYDLLITEKIVSHQAL 3727
            V+  +E+    R  +G  L +LL   ++   Q  +G    +   DD+  DIP IW + A+ +   + +   ++   F    K +LP     + FS  LH    ++ HK VG ++  S L W   +P   +  +F+  + LEFT+        G +P   ++      EEL       +L + + +E+IF+++E ++D+     +   + + +++ KA  K   SS +     ++++  ++ +  N   E +++ L ++  +  +L++    L   +D L  E ++S  A 
Sbjct: 1378 VESTLERSQITRDHMGQLLFQLLQAGVLPKLQFFKGFSETLELADDMAIDIPHIWLYLAELVTPVLREGGISMRELFSEFSKPLLPVGRAGILFSEILHLLCKQMSHKKVGSLWRDSGLSWADFIPETEDVHSFITEHKLEFTLS------DGSNPTEAVSKRTLSPEELNKQLEKLLLEDMVGDEQIFDWVEANLDESEMSSAPFVRALMTAVCKAAVKTEGSSCKVDLSIIQTRLPVLHKYLNSDTERQLQALYALQALIVKLDQPANLLRMFFDCLYDEDVISEDAF 1661          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:NCBI gene;Acc:100216088])

HSP 1 Score: 175.637 bits (444), Expect = 1.786e-43
Identity = 235/943 (24.92%), Postives = 432/943 (45.81%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVI-------SCQLPPESSSSQTNNER-ANNKKQLPNRQYSKYKNYNHKQTERKQI--NLEISDNQVFIRSKSGYLPPQLRDK-QKLLDSL--EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLN-ETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKF-NLMTKKKNVSNSQNI----------ARRN-------IQKNVSIKNLS-----CNSHKV-------DEKTV---LGPVLGNWATGSGSKSKSHEAEGWTPVSQKPKGGAMRYTSNSRSREQSPQVILANKYRNLESSAEASG-ADSRSSTPPMIRPITKAFRIIEQE---------VTDEEM---AEIIFNDLLSTGNFD-----IKKWLTLRKVQPIIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENI---FKSILPNNDVALCFSTALHEASSRL--GHKIVGQVFHKSLKWEKIVPNH--WETFLKVNNLEFTV---DLPGLSLCGGDPLNFIAEELEDMLSN-----NLSNEKIFEFLETHVDK-----PTWKKSECTKTITSSILKALRKIPESSVQ---EYLKSKKEIIKRISNHKLENEIEILKSILNVASELNR--DTLTRIYDLLITEKIVSHQAL------KDYCDNE----SLKSENNF 3772
            YDR +L+  +      QKP  +P  ++   D I NQP++          Q  P+ + +  +  R A   + +P       ++   ++ E ++I  N+ +SD+    +S++ + P   RD   +  DS+  + L R ++S LNK+TPQ F + +K++  L ++ +E +  +I+ +F KA+ E ++SV YA  C  LA   +   + P     F+  LL +CQ  FE   +D+ ++   E K+K L   T  + K+  + +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K   LMTK+K     Q +          A+ N         K   ++ L       ++H +        +K+V   L  VLG  + GS  + K+ +    + +   P+ G +   S+  S +   ++    +   L++  + +  A+   +T P  RP   A  ++ +          +++EEM   ++ I ++ L   ++      +++      +   + + V+  +E+    R  +G  L +L+    +S      G    +   DD+  DIP IW + A+ +   +  K   IS  E I    K++LP        S  LH    ++  G K   + F   +  E I+P     ++F+   NLEFT+     P  +L   +     AEEL   L         ++E+IF+++E  +D+     PT+ ++  T    ++IL        SS +    +LK +  ++ +  +   E E++ L ++  +  +L++  + L   +D L  E+++S  A       KD  + E    +LKS   F
Sbjct:  558 YDRDFLLGFQYMPACVQKPEGLPPISDVVLDKI-NQPKLPIRALDARMLQRGPDFTPAYADFGRPAPGGRGMPLLSVGPRRSQPGQRREPRKIIMNISVSDDVHLKKSENAWKPSVKRDSLPEDPDSIRTQALFRKVRSILNKLTPQMFNQLMKQVTDLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPMADKPGSTVNFRKLLLNRCQKEFE---KDKADDDVFEKKQKDLELATTPEEKSRLQDELEESKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLSNWVSRRAYQ----GPKTIEQIHKEAKIEEQEEQRKLQQLMTKEKRRPGVQRVDEGGWNTVQGAKNNRVLDPSKFLKITKVRRLPPPVALSSAHALLLWLGGSSDKSVTCDLTVVLGFSSRGSTGREKNDKPSAPSSIPSAPRPGTLLRGSSKDSADNQEEL----RRETLQTVKQLTNVAEPDKNTVPERRPKEPARTLVSKSEPSEPDKPTLSEEEMERKSKAIIDEFLHINDYKEAMQCVEELGANGPLSVFVRQGVESTLERSQITRDHMGQLLYQLVQSGKLSKLDFFTGFSETLELADDMAIDIPHIWLYLAELVTPML--KEGGISLRELITEFGKALLPVGRGGELLSEILHLLCKQMVRGKKPPRRFF---VHPEGILPEGEDVQSFVSEKNLEFTLSDSSSPSENLSKKE---MSAEELHKRLEQLIIQEKANDEQIFDWVEASLDESQMSSPTFLRALMTAVCKAAILGDC-----SSCRVDITFLKQRVPVLLKYLDSDTERELQALYALQALIVKLDQPPNVLRMFFDCLYDEEVISEDAFYKWESSKDPAEQEGKGVALKSVTAF 1474          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:NCBI gene;Acc:100216088])

HSP 1 Score: 160.614 bits (405), Expect = 7.032e-39
Identity = 160/554 (28.88%), Postives = 265/554 (47.83%), Query Frame = 2
Query: 1049 PLSVKSFERMEFEEFDLQNKAP-ESSIRLDIEEDVATCSSEDEVHIDLKLSSSNYHLPVNKKESDETILKRKLIYDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVI-------SCQLPPESSSSQTNNER-ANNKKQLPNRQYSKYKNYNHKQTERKQI--NLEISDNQVFIRSKSGYLPPQLRDK-QKLLDSL--EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLN-ETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKF-NLMTKKKNVSNSQNIARRNIQKNVSIKN---------LSCNSHKVDEKTVLGPVL--GNWATGSGSKSKSHEAEGWTP 2605
            P++      ME E+  L N  P E +  ++   + A   SE E       +      P +K        KR+  YDR +L+  +      QKP  +P  ++   D I NQP++          Q  P+ + +  +  R A   + +P       ++   ++ E ++I  N+ +SD+    +S++ + P   RD   +  DS+  + L R ++S LNK+TPQ F + +K++  L ++ +E +  +I+ +F KA+ E ++SV YA  C  LA   +   + P     F+  LL +CQ  FE   +D+ ++   E K+K L   T  + K+  + +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K   LMTK+K     Q +           KN         L      +DEK  L P    G+W  GS   +K+ E E   P
Sbjct:  569 PVTYSGTSTMEVEQLYLNNAKPQEQNGEVEPIRNGADAVSESEGTDIPSGTEEGLAYPYSKSADG----KRQ--YDRDFLLGFQYMPACVQKPEGLPPISDVVLDKI-NQPKLPIRALDARMLQRGPDFTPAYADFGRPAPGGRGMPLLSVGPRRSQPGQRREPRKIIMNISVSDDVHLKKSENAWKPSVKRDSLPEDPDSIRTQALFRKVRSILNKLTPQMFNQLMKQVTDLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPMADKPGSTVNFRKLLLNRCQKEFE---KDKADDDVFEKKQKDLELATTPEEKSRLQDELEESKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLSNWVSRRAYQ----GPKTIEQIHKEAKIEEQEEQRKLQQLMTKEKRRPGVQRVDEGGWNTVQGAKNNRVLDPSKFLKITKPTIDEKIQLVPKAQPGSWLKGSSGGAKASETESLRP 1107          

HSP 2 Score: 53.9138 bits (128), Expect = 2.441e-6
Identity = 77/325 (23.69%), Postives = 140/325 (43.08%), Query Frame = 2
Query: 2903 IIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENI---FKSILPNNDVALCFSTALHEASSRL--GHKIVGQVFHKSLKWEKIVPNH--WETFLKVNNLEFTV---DLPGLSLCGGDPLNFIAEELEDMLSN-----NLSNEKIFEFLETHVDK-----PTWKKSECTKTITSSILKALRKIPESSVQ---EYLKSKKEIIKRISNHKLENEIEILKSILNVASELNR--DTLTRIYDLLITEKIVSHQAL------KDYCDNE----SLKSENNF 3772
             + + V+  +E+    R  +G  L +L+    +S      G    +   DD+  DIP IW + A+ +   +  K   IS  E I    K++LP        S  LH    ++  G K   + F   +  E I+P     ++F+   NLEFT+     P  +L   +     AEEL   L         ++E+IF+++E  +D+     PT+ ++  T    ++IL        SS +    +LK +  ++ +  +   E E++ L ++  +  +L++  + L   +D L  E+++S  A       KD  + E    +LKS   F
Sbjct: 1259 FVRQGVESTLERSQITRDHMGQLLYQLVQSGKLSKLDFFTGFSETLELADDMAIDIPHIWLYLAELVTPML--KEGGISLRELITEFGKALLPVGRGGELLSEILHLLCKQMVRGKKPPRRFF---VHPEGILPEGEDVQSFVSEKNLEFTLSDSSSPSENLSKKE---MSAEELHKRLEQLIIQEKANDEQIFDWVEASLDESQMSSPTFLRALMTAVCKAAILGDC-----SSCRVDITFLKQRVPVLLKYLDSDTERELQALYALQALIVKLDQPPNVLRMFFDCLYDEEVISEDAFYKWESSKDPAEQEGKGVALKSVTAF 1570          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:NCBI gene;Acc:100216088])

HSP 1 Score: 159.073 bits (401), Expect = 2.305e-38
Identity = 144/480 (30.00%), Postives = 239/480 (49.79%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVI-------SCQLPPESSSSQTNNER-ANNKKQLPNRQYSKYKNYNHKQTERKQI--NLEISDNQVFIRSKSGYLPPQLRDK-QKLLDSL--EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLN-ETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKF-NLMTKKKNVSNSQNIARRNIQKNVSIKN---------LSCNSHKVDEKTVLGPVL--GNWATGSGSKSKSHEAEGWTP 2605
            YDR +L+  +      QKP  +P  ++   D I NQP++          Q  P+ + +  +  R A   + +P       ++   ++ E ++I  N+ +SD+    +S++ + P   RD   +  DS+  + L R ++S LNK+TPQ F + +K++  L ++ +E +  +I+ +F KA+ E ++SV YA  C  LA   +   + P     F+  LL +CQ  FE   +D+ ++   E K+K L   T  + K+  + +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K   LMTK+K     Q +           KN         L      +DEK  L P    G+W  GS   +K+ E E   P
Sbjct:  606 YDRDFLLGFQYMPACVQKPEGLPPISDVVLDKI-NQPKLPIRALDARMLQRGPDFTPAYADFGRPAPGGRGMPLLSVGPRRSQPGQRREPRKIIMNISVSDDVHLKKSENAWKPSVKRDSLPEDPDSIRTQALFRKVRSILNKLTPQMFNQLMKQVTDLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPMADKPGSTVNFRKLLLNRCQKEFE---KDKADDDVFEKKQKDLELATTPEEKSRLQDELEESKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLSNWVSRRAYQ----GPKTIEQIHKEAKIEEQEEQRKLQQLMTKEKRRPGVQRVDEGGWNTVQGAKNNRVLDPSKFLKITKPTIDEKIQLVPKAQPGSWLKGSSGGAKASETESLRP 1076          

HSP 2 Score: 53.9138 bits (128), Expect = 2.812e-6
Identity = 77/325 (23.69%), Postives = 140/325 (43.08%), Query Frame = 2
Query: 2903 IIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENI---FKSILPNNDVALCFSTALHEASSRL--GHKIVGQVFHKSLKWEKIVPNH--WETFLKVNNLEFTV---DLPGLSLCGGDPLNFIAEELEDMLSN-----NLSNEKIFEFLETHVDK-----PTWKKSECTKTITSSILKALRKIPESSVQ---EYLKSKKEIIKRISNHKLENEIEILKSILNVASELNR--DTLTRIYDLLITEKIVSHQAL------KDYCDNE----SLKSENNF 3772
             + + V+  +E+    R  +G  L +L+    +S      G    +   DD+  DIP IW + A+ +   +  K   IS  E I    K++LP        S  LH    ++  G K   + F   +  E I+P     ++F+   NLEFT+     P  +L   +     AEEL   L         ++E+IF+++E  +D+     PT+ ++  T    ++IL        SS +    +LK +  ++ +  +   E E++ L ++  +  +L++  + L   +D L  E+++S  A       KD  + E    +LKS   F
Sbjct: 1239 FVRQGVESTLERSQITRDHMGQLLYQLVQSGKLSKLDFFTGFSETLELADDMAIDIPHIWLYLAELVTPML--KEGGISLRELITEFGKALLPVGRGGELLSEILHLLCKQMVRGKKPPRRFF---VHPEGILPEGEDVQSFVSEKNLEFTLSDSSSPSENLSKKE---MSAEELHKRLEQLIIQEKANDEQIFDWVEASLDESQMSSPTFLRALMTAVCKAAILGDC-----SSCRVDITFLKQRVPVLLKYLDSDTERELQALYALQALIVKLDQPPNVLRMFFDCLYDEEVISEDAFYKWESSKDPAEQEGKGVALKSVTAF 1550          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:NCBI gene;Acc:100216088])

HSP 1 Score: 158.688 bits (400), Expect = 2.407e-38
Identity = 144/480 (30.00%), Postives = 239/480 (49.79%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVI-------SCQLPPESSSSQTNNER-ANNKKQLPNRQYSKYKNYNHKQTERKQI--NLEISDNQVFIRSKSGYLPPQLRDK-QKLLDSL--EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLN-ETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKF-NLMTKKKNVSNSQNIARRNIQKNVSIKN---------LSCNSHKVDEKTVLGPVL--GNWATGSGSKSKSHEAEGWTP 2605
            YDR +L+  +      QKP  +P  ++   D I NQP++          Q  P+ + +  +  R A   + +P       ++   ++ E ++I  N+ +SD+    +S++ + P   RD   +  DS+  + L R ++S LNK+TPQ F + +K++  L ++ +E +  +I+ +F KA+ E ++SV YA  C  LA   +   + P     F+  LL +CQ  FE   +D+ ++   E K+K L   T  + K+  + +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K   LMTK+K     Q +           KN         L      +DEK  L P    G+W  GS   +K+ E E   P
Sbjct:  559 YDRDFLLGFQYMPACVQKPEGLPPISDVVLDKI-NQPKLPIRALDARMLQRGPDFTPAYADFGRPAPGGRGMPLLSVGPRRSQPGQRREPRKIIMNISVSDDVHLKKSENAWKPSVKRDSLPEDPDSIRTQALFRKVRSILNKLTPQMFNQLMKQVTDLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPMADKPGSTVNFRKLLLNRCQKEFE---KDKADDDVFEKKQKDLELATTPEEKSRLQDELEESKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLSNWVSRRAYQ----GPKTIEQIHKEAKIEEQEEQRKLQQLMTKEKRRPGVQRVDEGGWNTVQGAKNNRVLDPSKFLKITKPTIDEKIQLVPKAQPGSWLKGSSGGAKASETESLRP 1029          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:NCBI gene;Acc:100216088])

HSP 1 Score: 157.918 bits (398), Expect = 5.491e-38
Identity = 170/604 (28.15%), Postives = 282/604 (46.69%), Query Frame = 2
Query:  986 DKEETEQSKKE---DDDILLESKT-----PLSVKSFERMEFEEFDLQNKAPE---------------------SSIRLDIEEDVATCSSEDEVHIDLKLSSSNYHLPVNKKESDETILKRKLIYDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVI-------SCQLPPESSSSQTNNER-ANNKKQLPNRQYSKYKNYNHKQTERKQI--NLEISDNQVFIRSKSGYLPPQLRDK-QKLLDSL--EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLN-ETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKF-NLMTK-KKNVSNSQNIARRNIQKNVSIKN---------LSCNSHKVDEKTVLGPVL--GNWATGSGSKSKSHEAEGWTP 2605
            D EE  QS+ E   +DD L +  T     P++      ME E+  L N  P+                     + I    EE +A   S+  +    +    +   P   + +D    KR+  YDR +L+  +      QKP  +P  ++   D I NQP++          Q  P+ + +  +  R A   + +P       ++   ++ E ++I  N+ +SD+    +S++ + P   RD   +  DS+  + L R ++S LNK+TPQ F + +K++  L ++ +E +  +I+ +F KA+ E ++SV YA  C  LA   +   + P     F+  LL +CQ  FE   +D+ ++   E K+K L   T  + K+  + +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K   LMTK K+  +  Q +           KN         L      +DEK  L P    G+W  GS   +K+ E E   P
Sbjct:  522 DIEEISQSETEPQYEDDPLEDKVTELDQDPVTYSGTSTMEVEQLYLNNAKPQEQNGEVEPIRNGADAVSESEGTDIPSGTEEGLAYPYSKAGIGAAEQPPDPSQEPPAPPQSADG---KRQ--YDRDFLLGFQYMPACVQKPEGLPPISDVVLDKI-NQPKLPIRALDARMLQRGPDFTPAYADFGRPAPGGRGMPLLSVGPRRSQPGQRREPRKIIMNISVSDDVHLKKSENAWKPSVKRDSLPEDPDSIRTQALFRKVRSILNKLTPQMFNQLMKQVTDLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPMADKPGSTVNFRKLLLNRCQKEFE---KDKADDDVFEKKQKDLELATTPEEKSRLQDELEESKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLSNWVSRRAYQ----GPKTIEQIHKEAKIEEQEEQRKLQQLMTKEKRRPAGVQRVDEGGWNTVQGAKNNRVLDPSKFLKITKPTIDEKIQLVPKAQPGSWLKGSSGGAKASETESLRP 1111          

HSP 2 Score: 55.4546 bits (132), Expect = 1.008e-6
Identity = 77/326 (23.62%), Postives = 142/326 (43.56%), Query Frame = 2
Query: 2903 IIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENI---FKSILPNNDVALCFSTALHEASSRLGHK---IVGQVFHKSLKWEKIVPNH--WETFLKVNNLEFTV---DLPGLSLCGGDPLNFIAEELEDMLSN-----NLSNEKIFEFLETHVDK-----PTWKKSECTKTITSSILKALRKIPESSVQ---EYLKSKKEIIKRISNHKLENEIEILKSILNVASELNR--DTLTRIYDLLITEKIVSHQAL------KDYCDNE----SLKSENNF 3772
             + + V+  +E+    R  +G  L +L+    +S      G    +   DD+  DIP IW + A+ +   +  K   IS  E I    K++LP        S  LH    ++ HK    + ++F   +  E I+P     ++F+   NLEFT+     P  +L   +     AEEL   L         ++E+IF+++E  +D+     PT+ ++  T    ++IL        SS +    +LK +  ++ +  +   E E++ L ++  +  +L++  + L   +D L  E+++S  A       KD  + E    +LKS   F
Sbjct: 1274 FVRQGVESTLERSQITRDHMGQLLYQLVQSGKLSKLDFFTGFSETLELADDMAIDIPHIWLYLAELVTPML--KEGGISLRELITEFGKALLPVGRGGELLSEILHLLCKQMSHKQETPLWKLFF--VHPEGILPEGEDVQSFVSEKNLEFTLSDSSSPSENLSKKE---MSAEELHKRLEQLIIQEKANDEQIFDWVEASLDESQMSSPTFLRALMTAVCKAAILGDC-----SSCRVDITFLKQRVPVLLKYLDSDTERELQALYALQALIVKLDQPPNVLRMFFDCLYDEEVISEDAFYKWESSKDPAEQEGKGVALKSVTAF 1587          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Mouse
Match: Eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:MGI Symbol;Acc:MGI:1923935])

HSP 1 Score: 186.808 bits (473), Expect = 2.018e-47
Identity = 230/923 (24.92%), Postives = 402/923 (43.55%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPE--SSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTE-------RKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLE-----ELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDS-KMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFN-LMTKKKNVSNSQNIARRNIQKNVSIKN---------LSCNSHKVDEKTVLGP-------VLGNWATGSGSKSKSHEAEGWTPV------------------SQKP------------KGGAMRYTSNSRSREQSPQVILANKYRNLESSAE-ASGADSRSSTPPMIR------PITKAFRIIEQEVTDEEMAEIIFNDLLSTGNFD-----IKKWLTLRKVQPIIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIF---KSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWET--FLKVNNLEFTVDLPGLSLCGGDPLN---FIAEELED-----MLSNNLSNEKIFEFLETHVDK-----PTWKKSECTKTITSSILKALRKIPESSVQEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNR--DTLTRIYDLLITEKIVSHQAL 3727
            YDR +L+ ++      QKP  +P  ++   D I NQPR+    L P             A+  +Q P  +     N   ++++       RK I + + ++    ++++ + P Q RD     D  E     EL R ++S LNK+TPQ F + +K++  L ++ +E +  +I+ +F KA+ E ++SV YA  C     L +   + P     F+  LL +CQ  FE   +D+ ++   E K+K L    + + +     +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K   LMTK+K     Q +           KN         L      +DEK  L P         G+      S+S    +   TP+                  S KP            +G +     N    EQ  +++   K       AE AS    RS T  + +      P      + E+EV  E  ++ I ++ L   +F      I++      +   ++  V+  +E+    R  +G  L +L+  + +S Q   +G    +   DD+  DIP IW + A+ +   +  K   IS  E I    K +LP     +  S  LH    ++ HK VG ++ ++ L W+  +P   +   FL    L+FT        C  + L+     AEEL       ++     +E+IF+++E ++D+     PT+ ++  T    ++I+         +    +K +  I+ +  +   E E++ L ++     +L++  + L   +D L  E+++S  A 
Sbjct:   61 YDREFLLDIQFMPACIQKPEGLPPISDVVLDKI-NQPRLSMRTLDPRILPRGPDFTPAFADFPRQTPGGRGVPLLNVGPRRSQPGQRREPRKIITVSVKEDVHLRKAENAWKPSQKRDSHA--DDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFE---KDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRVDEGGWNTVQGAKNSRVLDPSKFLKITKPTIDEKIQLVPKAQLGSWGKGSSGGAKASESAPSGSPSATPLEFDSRRALTSRGSMGREKSDKPIPAGTARPNTFLRGSSKDLLDNQSQEEQRREMLETVKQLTGGLDAERASTEADRSKTRELAKSEMCAVPAPDKPALSEEEV--ERKSKSIIDEFLHINDFKEATQCIEELSAQGPLHVFVKVGVEFTLERSQITRDHMGHLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPML--KGGGISMRELIVEFSKPLLPVGRAGVLLSEILHLLCRQMSHKKVGALWREADLSWKDFLPEGEDVHHFLLEQKLDFT---ESEGPCSSEALSKKELSAEELSQRLEKLIMEEKADDERIFDWVEANLDESQMSSPTFLRALMTAVCKAAIIADCSTFRVDTA--VIKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAF 963          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Mouse
Match: Eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:MGI Symbol;Acc:MGI:1923935])

HSP 1 Score: 147.517 bits (371), Expect = 4.879e-35
Identity = 126/418 (30.14%), Postives = 211/418 (50.48%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPE--SSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTE-------RKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLE-----ELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDS-KMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKF-NLMTKKKNVSNSQNI 2449
            YDR +L+ ++      QKP  +P  ++   D I NQPR+    L P             A+  +Q P  +     N   ++++       RK I + + ++    ++++ + P Q RD     D  E     EL R ++S LNK+TPQ F + +K++  L ++ +E +  +I+ +F KA+ E ++SV YA  C     L +   + P     F+  LL +CQ  FE   +D+ ++   E K+K L    + + +     +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K   LMTK+K     Q +
Sbjct:  619 YDREFLLDIQFMPACIQKPEGLPPISDVVLDKI-NQPRLSMRTLDPRILPRGPDFTPAFADFPRQTPGGRGVPLLNVGPRRSQPGQRREPRKIITVSVKEDVHLRKAENAWKPSQKRDSHA--DDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFE---KDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRV 1025          

HSP 2 Score: 65.855 bits (159), Expect = 4.544e-10
Identity = 67/291 (23.02%), Postives = 129/291 (44.33%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIF---KSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWET--FLKVNNLEFTVDLPGLSLCGGDPLN---FIAEELED-----MLSNNLSNEKIFEFLETHVDK-----PTWKKSECTKTITSSILKALRKIPESSVQEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDT--LTRIYDLLITEKIVSHQAL 3727
            V+  +E+    R  +G  L +L+  + +S Q   +G    +   DD+  DIP IW + A+ +   +  K   IS  E I    K +LP     +  S  LH    ++ HK VG ++ ++ L W+  +P   +   FL    L+FT        C  + L+     AEEL       ++     +E+IF+++E ++D+     PT+ ++  T    ++I+         +    +K +  I+ +  +   E E++ L ++     +L++    L   +D L  E+++S  A 
Sbjct: 1257 VEFTLERSQITRDHMGHLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPML--KGGGISMRELIVEFSKPLLPVGRAGVLLSEILHLLCRQMSHKKVGALWREADLSWKDFLPEGEDVHHFLLEQKLDFTE---SEGPCSSEALSKKELSAEELSQRLEKLIMEEKADDERIFDWVEANLDESQMSSPTFLRALMTAVCKAAIIADCSTFRVDTA--VIKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAF 1540          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Mouse
Match: Eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:MGI Symbol;Acc:MGI:1923935])

HSP 1 Score: 147.132 bits (370), Expect = 8.939e-35
Identity = 125/418 (29.90%), Postives = 211/418 (50.48%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPE--SSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTE-------RKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLEELK-----RNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDS-KMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKF-NLMTKKKNVSNSQNI 2449
            YDR +L+ ++      QKP  +P  ++   D I NQPR+    L P             A+  +Q P  +     N   ++++       RK I + + ++    ++++ + P Q RD     D  E +K     R ++S LNK+TPQ F + +K++  L ++ +E +  +I+ +F KA+ E ++SV YA  C     L +   + P     F+  LL +CQ  FE   +D+ ++   E K+K L    + + +     +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K   LMTK+K     Q +
Sbjct:  802 YDREFLLDIQFMPACIQKPEGLPPISDVVLDKI-NQPRLSMRTLDPRILPRGPDFTPAFADFPRQTPGGRGVPLLNVGPRRSQPGQRREPRKIITVSVKEDVHLRKAENAWKPSQKRDSHA--DDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFE---KDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRV 1208          

HSP 2 Score: 65.4698 bits (158), Expect = 6.449e-10
Identity = 67/296 (22.64%), Postives = 131/296 (44.26%), Query Frame = 2
Query: 2903 IIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIF---KSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWET--FLKVNNLEFTVDLPGLSLCGGDPLN---FIAEELED-----MLSNNLSNEKIFEFLETHVDK-----PTWKKSECTKTITSSILKALRKIPESSVQEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDT--LTRIYDLLITEKIVSHQAL 3727
             ++  V+  +E+    R  +G  L +L+  + +S Q   +G    +   DD+  DIP IW + A+ +   +  K   IS  E I    K +LP     +  S  LH    ++ HK VG ++ ++ L W+  +P   +   FL    L+FT        C  + L+     AEEL       ++     +E+IF+++E ++D+     PT+ ++  T    ++I+         +    +K +  I+ +  +   E E++ L ++     +L++    L   +D L  E+++S  A 
Sbjct: 1435 FVKVGVEFTLERSQITRDHMGHLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPML--KGGGISMRELIVEFSKPLLPVGRAGVLLSEILHLLCRQMSHKKVGALWREADLSWKDFLPEGEDVHHFLLEQKLDFTES---EGPCSSEALSKKELSAEELSQRLEKLIMEEKADDERIFDWVEANLDESQMSSPTFLRALMTAVCKAAIIADCSTFRVDTA--VIKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAF 1723          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Mouse
Match: Eif4g1 (eukaryotic translation initiation factor 4, gamma 1 [Source:MGI Symbol;Acc:MGI:2384784])

HSP 1 Score: 132.88 bits (333), Expect = 1.804e-30
Identity = 116/406 (28.57%), Postives = 199/406 (49.01%), Query Frame = 2
Query: 1250 LKRKLIYDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQP-------RVISCQLPPESSSSQTNNERA----------NNKKQLPNRQYSKYKNYNHKQTERKQINLEIS-----DNQVFIRSKSGYLPPQLR---DKQKLLDSL-----EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNE-TDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQID-VKHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTL 2350
            L+ K  YDR +L+  +    S QKP  +P  T+   D  +  P       R+      P+ + S  N  R               +LP    +       +Q  RK+    IS     ++    +++  + P   R   DK +  +       ++L R ++S LNK+TPQ F + +K++  L I+ +E +  +I+ IF KA+ E  +SV YA  C     L +  T  P     F+  LL +CQ  FE   +D+ ++   E K+K ++E   ++ +   + +LEE    A+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D++D+R+ NW  R   Q     PKT+
Sbjct:  603 LEEKKRYDREFLLGFQFIFASMQKPEGLPHITDVVLDKANKTPLRQLDPSRLPGINCGPDFTPSFANLGRPALSNRGPPRGGPGGELPRGPQAGLGPRRSQQGPRKETRKIISSVIMTEDIKLNKAEKAWKPSSKRTAADKDRGEEDADGSKTQDLFRRVRSILNKLTPQMFQQLMKQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVTVNFRKLLLNRCQKEFE---KDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFAKAKPRMDQYFNQMEKIIKEKKTSSRIRFMLQDVLDLRQSNWVPRRGDQ----GPKTI 1000          

HSP 2 Score: 53.5286 bits (127), Expect = 2.682e-6
Identity = 37/191 (19.37%), Postives = 87/191 (45.55%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNIS-FFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWE--TFLKVNNLEFTV----DLPGLSLCGGDPLNFIAEELEDMLSNNLSNEKIFEFLETHVDK 3466
            ++  +E+    R  +G  L++LL    +S+ Q  +G    +   +D+  DIP +W + A+ +   + +    +   F  I K + P           L      +G K VG ++ ++ L W + +    +  +F+    +E+T+    + PG           +  +LE +L +  SN+++F++++ ++++
Sbjct: 1277 IESTLERSTIAREHMGRLLHQLLCAGHLSTAQYYQGLYETLELAEDMEIDIPHVWLYLAELITPILQEDGVPMGELFREITKPLRPMGKATSLLLEILGLLCKSMGPKKVGMLWREAGLSWREFLAEGQDVGSFVAEKKVEYTLGEESEAPGQRTLA---FEELRRQLEKLLKDGGSNQRVFDWIDANLNE 1464          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Mouse
Match: Eif4g1 (eukaryotic translation initiation factor 4, gamma 1 [Source:MGI Symbol;Acc:MGI:2384784])

HSP 1 Score: 132.494 bits (332), Expect = 2.165e-30
Identity = 119/409 (29.10%), Postives = 196/409 (47.92%), Query Frame = 2
Query: 1250 LKRKLIYDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQP-------RVISCQLPPESSSSQTNNERA----------NNKKQLPNRQYSKYKNYNHKQTERKQINLEIS-----DNQVFIRSKSGYLPPQLR---DKQKLLDSL-----EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKD----KYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQID-VKHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTL 2350
            L+ K  YDR +L+  +    S QKP  +P  T+   D  +  P       R+      P+ + S  N  R               +LP R  +       +Q  RK+    IS     ++    +++  + P   R   DK +  +       ++L R ++S LNK+TPQ F + +K++  L I+ +E +  +I+ IF KA+ E  +SV YA  C     L +  T  P     F+  LL +CQ  FE    D      +E  EK   E D    A     L+E++++A+D    +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D++D+R+ NW  R   Q     PKT+
Sbjct:  313 LEEKKRYDREFLLGFQFIFASMQKPEGLPHITDVVLDKANKTPLRQLDPSRLPGINCGPDFTPSFANLGRPALSNRGPPRGGPGGELP-RGPAGLGPRRSQQGPRKETRKIISSVIMTEDIKLNKAEKAWKPSSKRTAADKDRGEEDADGSKTQDLFRRVRSILNKLTPQMFQQLMKQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVTVNFRKLLLNRCQKEFEKDKDD------DEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFAKAKPRMDQYFNQMEKIIKEKKTSSRIRFMLQDVLDLRQSNWVPRRGDQ----GPKTI 709          

HSP 2 Score: 54.299 bits (129), Expect = 1.614e-6
Identity = 58/283 (20.49%), Postives = 122/283 (43.11%), Query Frame = 2
Query: 2654 RSREQSPQVILANKYRNLESSAEASGADS--RSSTPPMIRPITKAFRIIEQEVTDEEMAE--IIFNDLLSTGNFDIKKWLTLRKVQPIIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNIS-FFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWE--TFLKVNNLEFTV----DLPGLSLCGGDPLNFIAEELEDMLSNNLSNEKIFEFLETHVDK 3466
            RSRE+  Q       R   S  E  G D   R +T P + P   A  + E E   + + E  +  ND+       +++  +   +   +   ++  +E+    R  +G  L++LL    +S+ Q  +G    +   +D+  DIP +W + A+ +   + +    +   F  I K + P           L      +G K VG ++ ++ L W + +    +  +F+    +E+T+    + PG      + L     +LE +L +  SN+++F++++ ++++
Sbjct:  898 RSRERPSQ---PEGLRKAASLTEDRGRDPVKREATLPPVSPPKAALSVDEVEKKSKAIIEEYLHLNDMKEAVQC-VQELASPSLLFIFVRLGIESTLERSTIAREHMGRLLHQLLCAGHLSTAQYYQGLYETLELAEDMEIDIPHVWLYLAELITPILQEDGVPMGELFREITKPLRPMGKATSLLLEILGLLCKSMGPKKVGMLWREAGLSWREFLAEGQDVGSFVAEKKVEYTLGEESEAPGQRTLAFEELR---RQLEKLLKDGGSNQRVFDWIDANLNE 1173          
BLAST of Eukaryotic initiation factor-4G vs. UniProt/SwissProt
Match: sp|O43432|IF4G3_HUMAN (Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 2.988e-34
Identity = 126/418 (30.14%), Postives = 210/418 (50.24%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPE--SSSSQTNNERANNKKQLPNRQY-------SKYKNYNHKQTERKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLE-----ELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDS-KMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKF-NLMTKKKNVSNSQNI 2449
            YDR +L+  +      QKP  +P  ++   D I NQP++    L P             A+  +Q P  +        S+      ++  RK I + + ++    ++++ + P Q RD Q   D  E     EL R ++S LNK+TPQ F + +K++  L ++ +E +  +I+ +F KA+ E ++SV YA  C     L +   + P     F+  LL +CQ  FE   +D+ ++   E K+K L    + + +     +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K   LMTK+K     Q +
Sbjct:  624 YDREFLLDFQFMPACIQKPEGLPPISDVVLDKI-NQPKLPMRTLDPRILPRGPDFTPAFADFGRQTPGGRGVPLLNVGSRRSQPGQRREPRKIITVSVKEDVHLKKAENAWKPSQKRDSQA--DDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFE---KDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRV 1030          

HSP 2 Score: 63.929 bits (154), Expect = 1.302e-8
Identity = 68/290 (23.45%), Postives = 130/290 (44.83%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFE---NIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWET--FLKVNNLEFTVDLPGLSLCGGDPLN---FIAEELEDML-----SNNLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSV----QEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDT--LTRIYDLLITEKIVSHQAL 3727
            V+  +E+    R  +G  L +L+  + +S Q   +G    +   DD+  DIP IW + A+ +   +  K   IS  E      K +LP     +  S  LH    ++ HK VG ++ ++ L W+  +P   +   FL    L+F   +   S C  + L+     AEEL   L      +  ++E+IF+++E ++D+         + + +++ KA   I +SS        +K +  I+ +  +   E E++ L ++     +L++    L   +D L  E+++S  A 
Sbjct: 1263 VESTLERSQITRDHMGQLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPML--KEGGISMRELTIEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWREADLSWKDFLPEGEDVHNFLLEQKLDF---IESDSPCSSEALSKKELSAEELYKRLEKLIIEDKANDEQIFDWVEANLDEIQMSSPTFLRALMTAVCKAA-IIADSSTFRVDTAVIKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAF 1546          
BLAST of Eukaryotic initiation factor-4G vs. UniProt/SwissProt
Match: sp|Q80XI3|IF4G3_MOUSE (Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 3.082e-34
Identity = 126/418 (30.14%), Postives = 211/418 (50.48%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPE--SSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTE-------RKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLE-----ELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDS-KMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKF-NLMTKKKNVSNSQNI 2449
            YDR +L+ ++      QKP  +P  ++   D I NQPR+    L P             A+  +Q P  +     N   ++++       RK I + + ++    ++++ + P Q RD     D  E     EL R ++S LNK+TPQ F + +K++  L ++ +E +  +I+ +F KA+ E ++SV YA  C     L +   + P     F+  LL +CQ  FE   +D+ ++   E K+K L    + + +     +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K   LMTK+K     Q +
Sbjct:  619 YDREFLLDIQFMPACIQKPEGLPPISDVVLDKI-NQPRLSMRTLDPRILPRGPDFTPAFADFPRQTPGGRGVPLLNVGPRRSQPGQRREPRKIITVSVKEDVHLRKAENAWKPSQKRDSHA--DDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFE---KDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRV 1025          

HSP 2 Score: 65.4698 bits (158), Expect = 4.725e-9
Identity = 67/291 (23.02%), Postives = 129/291 (44.33%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIF---KSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWET--FLKVNNLEFTVDLPGLSLCGGDPLN---FIAEELED-----MLSNNLSNEKIFEFLETHVDK-----PTWKKSECTKTITSSILKALRKIPESSVQEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDT--LTRIYDLLITEKIVSHQAL 3727
            V+  +E+    R  +G  L +L+  + +S Q   +G    +   DD+  DIP IW + A+ +   +  K   IS  E I    K +LP     +  S  LH    ++ HK VG ++ ++ L W+  +P   +   FL    L+FT        C  + L+     AEEL       ++     +E+IF+++E ++D+     PT+ ++  T    ++I+         +    +K +  I+ +  +   E E++ L ++     +L++    L   +D L  E+++S  A 
Sbjct: 1257 VEFTLERSQITRDHMGHLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPML--KEGGISMRELIVEFSKPLLPVGRAGVLLSEILHLLCRQMSHKKVGALWREADLSWKDFLPEGEDVHHFLLEQKLDFTE---SEGPCSSEALSKKELSAEELSQRLEKLIMEEKADDERIFDWVEANLDESQMSSPTFLRALMTAVCKAAIIADCSTFRVDTA--VIKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAF 1540          
BLAST of Eukaryotic initiation factor-4G vs. UniProt/SwissProt
Match: sp|Q6NZJ6|IF4G1_MOUSE (Eukaryotic translation initiation factor 4 gamma 1 OS=Mus musculus OX=10090 GN=Eif4g1 PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 2.428e-29
Identity = 86/253 (33.99%), Postives = 147/253 (58.10%), Query Frame = 2
Query: 1619 EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNE-TDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQID-VKHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTL 2350
            ++L R ++S LNK+TPQ F + +K++  L I+ +E +  +I+ IF KA+ E  +SV YA  C     L +  T  P     F+  LL +CQ  FE   +D+ ++   E K+K ++E   ++ +   + +LEE    A+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D++D+R+ NW  R   Q     PKT+
Sbjct:  762 QDLFRRVRSILNKLTPQMFQQLMKQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVTVNFRKLLLNRCQKEFE---KDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFAKAKPRMDQYFNQMEKIIKEKKTSSRIRFMLQDVLDLRQSNWVPRRGDQ----GPKTI 1006          
BLAST of Eukaryotic initiation factor-4G vs. UniProt/SwissProt
Match: sp|Q04637|IF4G1_HUMAN (Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4)

HSP 1 Score: 129.798 bits (325), Expect = 1.096e-28
Identity = 86/253 (33.99%), Postives = 146/253 (57.71%), Query Frame = 2
Query: 1619 EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNE-TDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTL 2350
            ++L R ++S LNK+TPQ F + +K++  L I+ +E +  +I+ IF KA+ E  +SV YA  C     L +  T  P     F+  LL +CQ  FE   +D+ ++   E K+K ++E   ++ +   + +LEE    A+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D++D+R  NW  R   Q     PKT+
Sbjct:  758 QDLFRRVRSILNKLTPQMFQQLMKQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVTVNFRKLLLNRCQKEFE---KDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIIKEKKTSSRIRFMLQDVLDLRGSNWVPRRGDQ----GPKTI 1002          

HSP 2 Score: 64.3142 bits (155), Expect = 1.004e-8
Identity = 43/194 (22.16%), Postives = 89/194 (45.88%), Query Frame = 2
Query: 2903 IIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNIS-FFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWE--TFLKVNNLEFTV----DLPGLSLCGGDPLNFIAEELEDMLSNNLSNEKIFEFLETHV 3460
             +   V+  +E+    R  +G  L++LL    +S+ Q  +G    +   +D+  DIP +W + A+ +   + +    +   F  I K + P    A      L      +G K VG ++ ++ L W++ +P   +   F+    +E+T+    + PG      + LN    +LE +L    SN+++F+++E ++
Sbjct: 1278 FVRHGVESTLERSAIAREHMGQLLHQLLCAGHLSTAQYYQGLYEILELAEDMEIDIPHVWLYLAELVTPILQEGGVPMGELFREITKPLRPLGKAASLLLEILGLLCKSMGPKKVGTLWREAGLSWKEFLPEGQDIGAFVAEQKVEYTLGEESEAPGQRALPSEELN---RQLEKLLKEGSSNQRVFDWIEANL 1468          
BLAST of Eukaryotic initiation factor-4G vs. UniProt/SwissProt
Match: sp|B9FXV5|IF4G_ORYSJ (Eukaryotic translation initiation factor 4G OS=Oryza sativa subsp. japonica OX=39947 GN=Os07g0555200 PE=2 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 1.719e-25
Identity = 89/256 (34.77%), Postives = 146/256 (57.03%), Query Frame = 2
Query: 1601 KLLDSLEELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLAITYTN------NPAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRD--SYDSDAMLALCKLLETCGKQID-VKHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRH-VQQEKQIN 2338
            K+ D  E  +R +K+ LNK+TPQNF +  ++++ +NI+N   ++ +I++IF KA+ E  +   YA FC+ LA    +         FK  LL KCQ+ FE   +++ E  + E +E  + +T        + + EE+  +A+ +  GNIR IGEL+   +L  +++  CI +LL +  + D + + ALCKL+ T G+ ID  K KE M+ Y   + +LS S  L  R+RF L+D ID+R+  W  R  V+  K+I+
Sbjct: 1174 KVSDEEEAKQRQLKAILNKLTPQNFEKLFEKVKEVNIDNVATLTGVISQIFDKALMEPTFCEMYANFCFHLAGALPDFSEDNEKITFKRLLLNKCQEEFERGEREEAEADKTE-EEGEIKQT--------KEEREEKRIRARRRMLGNIRLIGELYKKRMLTERIMHECIKKLLGNYQNPDEENIEALCKLMSTIGEMIDHAKAKEHMDAYFDIMLKLSTSQQLSSRVRFMLRDSIDLRKNKWQQRRKVEGPKKID 1420          
BLAST of Eukaryotic initiation factor-4G vs. TrEMBL
Match: D5JG54 (Eukaryotic initiation factor-4G OS=Dugesia japonica OX=6161 GN=eIF4G PE=2 SV=1)

HSP 1 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 419/566 (74.03%), Postives = 485/566 (85.69%), Query Frame = 2
Query: 2129 MLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFNLMTKKKNVSN-SQNIARRNIQ----KNVSIKNLSCNSHKVDEKTVLGPVLGNWATGSGSKSKSHEAEGWTPVSQKPKGGAMRYTSNSRSREQSPQVILANKYRNLESSAEASGADSRSSTPPMIRPITKAFRIIEQEVTDEEMAEIIFNDLLSTGNFDIKKWLTLRKVQPIIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKSLKWEKIVPNHWETFLKVNNLEFTVDLPGLSLCGGDPLNFIAEELEDMLSNNLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDTLTRIYDLLITEKIVSHQALKDYCDNESLKSENNFKLTNSLLSDILYL 3811
            MLALCKLLETCGKQID+KHKE MN +I+ I  LS+S+DLEKRIRFKL+DIIDMR R+WTLRHVQQEKQINPKTLEEQK EAAAEA+A  +K   M KK+N  N SQN  RRN+     KNVSIKNLSC+ H VDEKTVLGP  G+W  GSGSKSKSHEAE W PVS K KGG +RYTSNSRSREQSPQVIL NKYRNLESSAEASGADSRSSTPPMI  I+KA+R++E E++DEE A+IIFNDLLSTG+FDI  W  LR +  +IEKW+DDMMEKD SCRR IGD+ NRLLI+KII+++QI++GT+ FVSSIDDLICDIPK+W FFAQFLERFI DKNSNI FFE+IFKSILPN DVA CFS ALH+AS RLGHKIVGQVFH+SL W  IVP++WE F+K NNLEFTV L  LS CGGDPL+FI EEL DMLS+N SNE IF+FLE  VDKPTWKKSECT+TITSSILKA++K+PESSV+EY K+KKEIIKRISNHK ENE+EILK+ILN+AS+LN++TLT IYDLLITE+I+S + LK Y ++ESLKSE+NFKLT+ +LS ++Y+
Sbjct:    1 MLALCKLLETCGKQIDMKHKEQMNLFINKIYELSKSIDLEKRIRFKLRDIIDMRVRDWTLRHVQQEKQINPKTLEEQKEEAAAEASANALKLAAMNKKRNAQNPSQNNPRRNVNHAGNKNVSIKNLSCHRHTVDEKTVLGPAGGSWIYGSGSKSKSHEAEVWIPVSLKTKGGTIRYTSNSRSREQSPQVILGNKYRNLESSAEASGADSRSSTPPMIPLISKAYRVVEPEMSDEERADIIFNDLLSTGSFDINSWKKLRTIPVVIEKWIDDMMEKDASCRRTIGDNFNRLLINKIITTEQIIDGTKSFVSSIDDLICDIPKLWNFFAQFLERFILDKNSNIKFFESIFKSILPNQDVANCFSAALHDASDRLGHKIVGQVFHRSLNWNNIVPDNWEQFIKQNNLEFTVYLCPLSSCGGDPLHFIEEELADMLSSNSSNENIFDFLEXXVDKPTWKKSECTRTITSSILKAIKKMPESSVREYFKNKKEIIKRISNHKPENEMEILKAILNIASDLNKETLTLIYDLLITEEIISLEVLKTYLEDESLKSESNFKLTHPILS-VMYV 565          
BLAST of Eukaryotic initiation factor-4G vs. TrEMBL
Match: A0A1I8I699 (MI domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 4.038e-57
Identity = 209/752 (27.79%), Postives = 353/752 (46.94%), Query Frame = 2
Query: 1571 YLPPQLRDKQKLLDSLE--ELKRNIKSNLNKITPQNFPECVXXXXXX-XXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLAITYTNNP----------AFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAML-----ALCKLLETCGKQIDVKH--KESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFNLMTKKKNVSN------SQNIAR----------RNIQKNVSIKNLSCNSHKVDE-KTVLGPVLGNWATGSGSKSKSHEAEGWTP--VSQK--PKGGAMRYTSNSRSREQSPQVILANKYRNLESSAEASGADSRSSTPPMI--RPITKAFRIIEQEVTDEEMAEIIFNDLLSTGNF-DIKKWLTLRKVQPIIEKWVDD-----MMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIFKSILPN-NDVAL------CFSTALHEASSRLGHKIVGQVFHKS-LKWEKI--VPNH-WETFLKVNNLEFTVDLPGLSLCGGDP--LNFIAEELEDMLSN--------NLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQEYLKSKKEIIKRISNHKLENE 3616
            Y+P  L+ K    + L+  E++RNI+S LNKI PQNF  C  ++    +I + + ++  ++ IF KA +E++YS  +A+ C +LA    N P           F+  LLKKCQ+MFETPL++Q+E    +W+EK+  E     K   E + +EQ+KKAKD+Y+GNIRFIGELF+ ++L   +I  CIV  L+  + S +M       LC+LL+T GK+++ ++  K  +++Y   I +L  S ++E ++RF+L+DI++MR+RNW  R ++      P T EE + +A  +  +   +    T+             Q +A           R  QK  + K +  +S +  + +T LGP   ++   +    K     G TP   SQK   +  A R TS   S    PQ +       L +S +   + S    P      P +     I ++V + +   I+   L S  +  D K         P I  +V+      + E     R + G  L  LL  +++SS+ ++EG    +   DD + D P +  +  +    F+    S +S  + +   I  +  D +         S ALH AS RLGH  VG  F ++ + W  +  +P      F+  N LEFT+    LS     P  L+ + E +E  + N        +L +E++   +E  VDK   +  E  + +  S+ +   +  + +   +L  K  +++ I  H+ + +
Sbjct:    8 YVPGFLQKKPDDQEQLKKVEIERNIRSILNKIAPQNFESCFSQLTTTCDIGSIQGLNACVDIIFDKATREKSYSSVFAEICKRLAFLKVNFPEQSQENKQFIGFRSLLLKKCQEMFETPLKEQMEQKGAQWQEKIDAEEKEDKKKALEEERDEQMKKAKDQYYGNIRFIGELFMKDILTANIIHQCIVSQLKSDHSSKSMFTESLECLCELLKTVGKKLESENNAKARIDQYFERIKKLINSKEIESKVRFRLQDIVEMRQRNWERREMEIRLHERPMTKEELEQKARQDEESWAQQLQQQTRGGRQGGFSRPPAGQTLAANSKWTPVTTTRKAQKMDARKMVIGSSQEQGQSQTRLGPSRPSFVAKARPSGKDDGGRG-TPRLGSQKNSRESSASRGTSREASLHLDPQQLQQPAVAALTASGKMPRSQSSQELPARAVESPRSVEPPPIPRDVLERKSKNIMMEWLGSLCSLEDTKSNFIEISRHPEISAFVEVNAEHLLNENSKELREKGGQLLFELLHSELLSSKDLIEGFSPIMEMADDFLSDFPLLSSYLGEIFSSFVQKAASYLSCVQQLVLRIPADLRDSSRRPLRGEVVSRALHLASGRLGHDRVGAAFREAGMAWHSLLELPQADAADFVAANKLEFTLHETTLS---PSPIALDVVGERIEQKIGNADGDASAKDLLSEELIALIEKEVDKKQMESREFIRVLVRSVCRGCTQSKKLNKPLFLLVKPVLMRHIETHEQQQQ 755          
BLAST of Eukaryotic initiation factor-4G vs. TrEMBL
Match: A0A267H8S5 (MI domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018935g1 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 8.789e-57
Identity = 205/749 (27.37%), Postives = 350/749 (46.73%), Query Frame = 2
Query: 1568 GYLPPQLRDKQKLLDSLEELKRNIKSNLNKITPQNFPECVXXXXXX-XXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLAITYTNNP----------AFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLA-----LCKLLETCGKQIDVKH--KESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFNLMTKKKNVSN------SQNIAR----------RNIQKNVSIKNLSCNSHKVDE-KTVLGPVLGNWATGSGSKSKSHEAEGWTP--VSQK--PKGGAMRYTSNSRSREQSPQVILANKYRNLESSAEASGADSRSSTPPMI--RPITKAFRIIEQEVTDEEMAEIIFNDLLSTGNF-DIKKWLTLRKVQPIIEKWVDD-----MMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIFKSILPN-NDVAL------CFSTALHEASSRLGHKIVGQVFHKS-LKWEKI--VPNH-WETFLKVNNLEFTVDLPGLSLCGGDPLNFIAEELEDMLSN--------NLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQEYLKSKKEIIKRISNHKLENE 3616
            GYL  +  D+++L     E++RNI+S LNKI PQNF  C  ++    +I + + ++  ++ IF KA +E++YS  +A+ C +LA    N P           F+  LLKKCQ+MFETPL++Q+E    +W+EK+  E     K   E + +EQ+KKAKD+Y+GNIRFIGELF+ ++L   +I  CIV  L+  + S +M       L +LL+T GK+++ ++  K  +++Y   I +L  S ++E ++RF+L+DI++MR+RNW  R ++      P T +E + +A  +  +   +    T+             Q +A           R  QK  + K +  +S +  + +T LGP   ++   +    K     G TP   SQK   +  A R TS   S    PQ +       L +S +   + S    P      P +     I ++V + +   I+   L S  +  D K         P I  +V+      + E     R + G  L  LL  +++SS+ ++EG    +   DD + D   +  +  +    F+    S +S  + +   I  +  D +         S ALH AS RLGH  VG  F ++ + W  +  +P      F+  N LEFT+    L L     L+ + E +E  + N        +L +E++   +E  VDK   +  E  + +  S+ +   +  + +   +L  K  +++ I  H+ + +
Sbjct:   11 GYLQKKPDDQEQLKKV--EIERNIRSILNKIAPQNFESCFSQLTTTCDIGSIQGLNACVDIIFDKATREKSYSSVFAEICKRLAFLKVNFPEQSQENKQFIGFRSLLLKKCQEMFETPLKEQMEQKGAQWQEKIDAEEKEDKKKALEEERDEQMKKAKDQYYGNIRFIGELFMKDILTANIIHQCIVSQLKSDHSSKSMFTESLECLFELLKTVGKKLESENNAKARIDQYFERIKKLINSKEIESKVRFRLQDIVEMRQRNWERREMEIRLHERPMTKKELEQKARQDEESWAQQLQQQTRGGRQGGFSRPPAGQTLAANSKWTPVTTTRKAQKMDARKMVIGSSQEQGQSQTRLGPSRPSFVAKARPSGKDDGGRG-TPRLGSQKNSRESSASRGTSREASLHLDPQQLQQPAVAALTASGKMPRSQSSQELPARAVESPRSVEPPPIPRDVLERKSKNIMMEWLGSLCSLEDTKSNFIEISRHPEISAFVEVNAEHLLNESSKELREKGGQLLFELLHSELLSSKDLIEGFSPIMEMADDFLSDFSLLSSYLGEIFSSFVQKAASYLSCVQQLVLRIPADLRDSSRRPLRGEVVSRALHLASGRLGHDRVGAAFREAGMAWHSLLELPQADAADFVAANKLEFTLHETTL-LPSPIALDVVGERIEQKIGNADGDASAKDLLSEELIALIEKEVDKKQMESREFIRVLARSVCRGCTQSKKLNKPLFLLVKPVLMRHIETHEQQQQ 755          
BLAST of Eukaryotic initiation factor-4G vs. TrEMBL
Match: A0A1I8G5Z3 (MIF4G domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 5.724e-55
Identity = 197/736 (26.77%), Postives = 346/736 (47.01%), Query Frame = 2
Query: 1568 GYLPPQLRDKQKLLDSLEELKRNIKSNLNKITPQNFPECVXXXXXX-XXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLAITYTNNP----------AFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAML-----ALCKLLETCGKQIDVKH--KESMNKYISDISRLSQSVDLEKRIRFKLKDI-----IDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFNLMTKKKNVSNSQNIARRNIQKNVSIKNLSCNSHKVDEKTVLGPVLGNWATGSGSKSKSHEAEGWTPVSQKPKGGAMRYTSNSRSREQSPQVILANKYRNLESSAEASGADSRS-STPPMIRPITKAFRIIE-----QEVTDEEMAEIIFNDLLSTGNF-DIKKWLTLRKVQPIIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIFKSILPN-NDVAL------CFSTALHEASSRLGHKIVGQVFHKS-LKWEKI--VPNH-WETFLKVNNLEFTVDLPGLSLCGGDP--LNFIAEELEDMLSN--------NLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQEYLKSKKEIIKRISNHKLENEIE 3622
            GYL  +  D+++L     E++RNI+S LNKI PQNF  C  ++    +I + + ++  ++ IF KA +E++YS  +A+ C +LA    N P           F+  LLKKCQ+MFETPL++Q+E    +W+EK+  E     K   E + +EQ+KKAKD+Y+GNIRFIGELF+ ++L   +I  CIV  L+  + S +M       LC+LL+T GK+++ ++  K  +++Y   I +L  S ++E ++RF+L+DI         E +W        +Q+  +T   ++   +      T+  N  +K   V+ ++   + + +K V    +  +  +   +T LGP   ++   +    K     G TP     K       S   SRE SP +      +   ++  ASG   RS S+  +     ++ R +E     ++V + +   I+   L S  +  D K         P I  +V+     +       G  L  LL  +++SS+ ++EG    +   DD + D P +  +  +    F+    S +S  + +   I  +  D +         S ALH AS RLGH  VG  F ++ + W  +  +P      F+  N LEFT+    LS     P  L+ + E +E  + N        +L +E++   +E  VDK   +  E  + +  S+ +   +  + +   +L  K  +++ I  H+ + +++
Sbjct:   11 GYLQKKPDDQEQLKKV--EIERNIRSILNKIAPQNFESCFSQLTTTCDIGSIQGLNACVDIIFDKATREKSYSSVFAEICKRLAFLKVNFPEQSQENKQFIGFRSLLLKKCQEMFETPLKEQMEQKGAQWQEKIDAEEKEDKKKALEEERDEQMKKAKDQYYGNIRFIGELFMKDILTANIIHQCIVSQLKSDHSSKSMFTESLECLCELLKTVGKKLESENNAKARIDQYFERIKKLINSKEIESKVRFRLQDIELEQKARQDEESWA-------QQLQQQTRGGRQGGFSRPPAGQTLAAN--SKWTPVTTTRKAQKMDARKMV----IGSSQEQGQSQTRLGPSRPSFVAKARPSGKDDGGRG-TPRLGSQKNSRESSASRGTSREASPHLDPQQLQQPAVAALAASGKMPRSQSSQELPARAVESPRSVEPPPIPRDVLERKSKNIMMEWLGSLCSLEDTKSNFIEISRHPEISAFVEQRASGEG------GQLLFELLHSELLSSKDLIEGFSPIMEMADDFLSDFPLLSSYLGEIFSSFVQKAASYLSCVQQLVLRIPADLRDSSRRPLRGEVVSRALHLASGRLGHDRVGAAFREAGMAWHSLLELPQADAADFVAANKLEFTLHETTLS---PSPIALDVVGERIEQKIGNADGDASAKDLLSEELIALIEKEVDKKQMESREFIRVLVRSVCRGCTQSKKLNKPLFLLVKPVLMRHIETHEQQQQVD 721          
BLAST of Eukaryotic initiation factor-4G vs. TrEMBL
Match: A0A267HB46 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013413g3 PE=4 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 9.160e-53
Identity = 141/411 (34.31%), Postives = 228/411 (55.47%), Query Frame = 2
Query: 1196 SSSNYHLPVNKKESDETILKRKLIYDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPESSSS---------QTNNERANNKKQL-----PNRQYSKYKNYNHKQTERKQINLEISDNQVFI-RSKSGYLPPQLRDKQKLLDSLE--ELKRNIKSNLNKITPQNFPECVXXXXXX-XXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLAITYTNNP----------AFKGQLLKKCQDMFETPLQDQLENVRNEWKEKV-LNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAML-----ALCKLLETCGKQIDVKH--KESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQ 2320
            +S  Y       ESD+T L++KL YDR +L+ ++    S Q+P  +P       DI    PR  S Q PP +            Q N    +  K +      +           K   + Q+ +E+  ++V + +S S Y+P  L+ K    + L+  E++RNI+S LNKI PQNF  C  ++    +I + + ++  ++ IF KA +E++YS  +A+ C +LA    N P           F+  LLKKCQ+MFETPL++Q+E    +W+EK+   E + K KAL E + +EQ+KKAKD+Y+GNIRFIGELF+ ++L   +I  CIV  L+  + S +M       LC+LL+T GK+++ ++  K  +++Y   I +L  S ++E ++RF+L+DI++MR+RNW  R ++
Sbjct:  473 ASGKYEFKPEPGESDKTTLEKKLKYDRGFLLSLQFTDLSNQRPDELPG------DIPELLPRSDSQQQPPRAVRGFDFTPSFVVQPNYVAKDKGKSIYGSHRGSGGRGGGGGGPPKPAPKPQLVIEVRKDKVDLHKSDSAYVPGFLQKKPDDQEQLKKVEIERNIRSILNKIAPQNFESCFSQLTTTCDIGSIQGLNACVDIIFDKATREKSYSSVFAEICKRLAFLKVNFPEQSQENKQFIGFRSLLLKKCQEMFETPLKEQMEQKGAQWQEKIDAEEKEDKKKAL-EEERDEQMKKAKDQYYGNIRFIGELFMKDILTANIIHQCIVSQLKSDHSSKSMFTESLECLCELLKTVGKKLESENNAKARIDQYFERIKKLINSKEIESKVRFRLQDIVEMRQRNWERREME 876          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Cavefish
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma, 3a [Source:ZFIN;Acc:ZDB-GENE-120810-2])

HSP 1 Score: 142.895 bits (359), Expect = 1.023e-33
Identity = 114/384 (29.69%), Postives = 198/384 (51.56%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQP-----RVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQI--NLEISDNQVFIRSKSGYLPPQLRDK-------QKLLDSLEELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDS-KMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTL 2350
            YDR +L+  +      QKP  +P  ++   D I NQ      R++  +L             A+  +QLP  +     +   ++   ++I  N+ ++D+    ++++ + P   R+        QK  D L    + ++S LNK+TPQ F   +K++  L I  +E +  +I+ +F KA+ E ++SV YA  C+ LA   +   + P     F+  LL +CQ  FE   +D++++   E K+K L+   S   K   + +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y   + ++ +      RIRF L+D+ID+R  NW  R  +Q     PKT+
Sbjct:  706 YDREFLLGFQFMPACVQKPEGLPPISDVVLDKI-NQTKVPLIRMVDPRL--MIRGPDFTPAFADFTRQLPGMRGPPLLSLGARRPPPRKIIMNVSVNDDVQLKKAENAWKPGMKREAATEDQETQKTQDVL----KKVRSILNKLTPQMFTSLMKQVTDLTINTEERLKGVIDLVFEKAIDEPSFSVAYANMCHCLATLKVPMADKPGTTVNFRKLLLNRCQKEFE---RDKMDDAAFEKKQKELDSASSVTEKERLQEELEEAKDKARRRSTGNIKFIGELFKLRMLTEPIMHDCVVKLLKN-HDDESLECLCRLLTTIGKDLDFEKAKPRMDQYFHQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRAEQ----GPKTI 1074          

HSP 2 Score: 58.5362 bits (140), Expect = 6.377e-8
Identity = 61/280 (21.79%), Postives = 122/280 (43.57%), Query Frame = 2
Query: 2930 MEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNI-SFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVP--NHWETFLKVNNLEFTVDLPGLSLCGGDPLNFIAEELEDMLSNNL-----SNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQ---EYLKSKKEIIKRISNHKLENEIEILKSILNVASELNR--DTLTRIYDLLITEKIVSHQAL 3727
            +E+    R  +G  L +L    I+   Q+  G    +   DD+  DIP IW + A+ L   + +    +   F  + K +LP     +  S  LH    +  H+ VG ++ +S L W   +      ++F+    L+FT      S       +   EEL   L N L     ++E+IF+++E ++D+     S   + + +++ KA  K   +S +     ++ +  ++ +  N   E +++ L ++  +   L++  + L   +D L  E ++S  A 
Sbjct: 1308 LERSQISREHMGHLLYQLTQQSILPRTQLYTGFADTLEMADDMAIDIPHIWLYLAELLCPLLKEGGIPMRELFSELSKPLLPVGRAGVLLSEILH-LLCKQSHRKVGALWRESGLNWSDFLSEDEDLQSFISEQKLQFTQSDSSSSPSSPSKPSLPPEELHTQLENLLLVDMATDEQIFDWVEANLDESQISSSLFLRALMTAVCKAAVKDENTSCRVDTAIIQKRLPVLHKYFNADTERQLQALYALQALIVTLDQPPNLLRMFFDCLYDEDVISEDAF 1586          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Cavefish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:103031287])

HSP 1 Score: 141.354 bits (355), Expect = 3.085e-33
Identity = 156/562 (27.76%), Postives = 267/562 (47.51%), Query Frame = 2
Query: 1028 ILLESKTPLSVKSFERMEFEEFDLQNKAPESSIRLDIEEDVATCSSEDEVHIDLKLSSSNYHLPVNKKESDETILKRKLIYDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISN--------QPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQI--NLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLEELK-----RNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVK-KAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFN--LMTKKKNVSNSQNIARRN---IQKNVSIKNLS----CNSHKVDEKTVLGPVLG-NWATGS--GSKSKSHEAEGWTP 2605
            + +E ++  +    E  E E   L+N  PE +   D  E+V T +        LK +S+N    + K E    +   K  Y+R +L+  +      QKP  +P  ++   D I+          PRVIS                A+  + +P  + +   N   ++   ++I  N+ ++D     ++++ + P   RD    +D  E LK     R ++S LNK+TPQ F + +K++  L I+ +E +  +I+ +F KA+ E ++SV Y   C  LA   +   + P     F+  LL +CQ  FE   +D++++   E K++ L    S  +     +  E+ K KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K +  L++K K     Q     N   + KN    + S     +   +D+K  LGP    NW  GS  G+ +K+ E++   P
Sbjct:  590 VCVERRSSTAAPVEENGEQEAEPLRN-GPEHTPEADSSEEVPTPA--------LKEASTNA---IQKPE----LKNGKRQYNRDFLLGFQFMPACVQKPEGLPPISDVVLDKINQNKLPLRQVDPRVIS-------RGPDFTPAFADFGRMIPGSRGAPLLNVGLRRPPPRKIIMNVSVNDEVQLKKAENAWKPGMKRDA--AIDDPENLKTQELFRKVRSILNKLTPQMFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPSFSVAYGNMCSCLATLKVPMADKPTSTVNFRKLLLNRCQKEFE---KDKMDDDVFEKKQRELEAASSATERERLQEELEEAKDKARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVHQQLLSKDKRRPVLQREETWNTVPVPKNSRTIDPSKIPKISKPPMDDKIQLGPRAQLNWMKGSSGGAGAKASESDVLRP 1118          

HSP 2 Score: 77.0258 bits (188), Expect = 1.559e-13
Identity = 67/290 (23.10%), Postives = 132/290 (45.52%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNI-SFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWE--TFLKVNNLEFTVDLPGLSLCGGDPLNFIA----------EELEDMLSNNL-SNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQ---EYLKSKKEIIKRISNHKLENEIEILKSI--LNVASELNRDTLTRIYDLLITEKIVSHQAL 3727
            V+  +E+    R  +G   ++LL    +S  Q  +G    +   DD+  DIP IW + A+ +   + +   ++   F    K +LP     + FS  LH    ++ H+ VG ++  S L W   +P   +  +F+    L+FT     LS C   P   ++          ++LE +L  +L S+E+IF+++E ++D+         + + +++ KA  K+  SS +     ++ +  ++ +  N   E +++ L ++  L V  E   + L   +D L  E ++S  A 
Sbjct: 1287 VESTLERSQITRDHMGQLFHQLLQAGSLSKPQFFKGFSETLELADDMAIDIPHIWLYLAELVNPVLREGGISMRELFSEFSKPLLPVGRAGILFSEILHLLCKQMSHRKVGALWKDSGLSWADFLPETEDVNSFITEQKLDFT-----LSDCSS-PAAAVSNRMLSPEELNKQLEKLLLEDLASDEQIFDWVEANLDESEMSSPPFLRALMTAVCKAAVKLESSSYRVDTAIIQKRLPVLHKYLNSDTERQLQALYALQALIVKLEQPPNLLRMFFDCLYDEDVISEDAF 1570          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Cavefish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:103031287])

HSP 1 Score: 140.969 bits (354), Expect = 4.810e-33
Identity = 156/562 (27.76%), Postives = 267/562 (47.51%), Query Frame = 2
Query: 1028 ILLESKTPLSVKSFERMEFEEFDLQNKAPESSIRLDIEEDVATCSSEDEVHIDLKLSSSNYHLPVNKKESDETILKRKLIYDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISN--------QPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQI--NLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLEELK-----RNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVK-KAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFN--LMTKKKNVSNSQNIARRN---IQKNVSIKNLS----CNSHKVDEKTVLGPVLG-NWATGS--GSKSKSHEAEGWTP 2605
            + +E ++  +    E  E E   L+N  PE +   D  E+V T +        LK +S+N    + K E    +   K  Y+R +L+  +      QKP  +P  ++   D I+          PRVIS                A+  + +P  + +   N   ++   ++I  N+ ++D     ++++ + P   RD    +D  E LK     R ++S LNK+TPQ F + +K++  L I+ +E +  +I+ +F KA+ E ++SV Y   C  LA   +   + P     F+  LL +CQ  FE   +D++++   E K++ L    S  +     +  E+ K KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K +  L++K K     Q     N   + KN    + S     +   +D+K  LGP    NW  GS  G+ +K+ E++   P
Sbjct:  692 VCVERRSSTAAPVEENGEQEAEPLRN-GPEHTPEADSSEEVPTPA--------LKEASTNA---IQKPE----LKNGKRQYNRDFLLGFQFMPACVQKPEGLPPISDVVLDKINQNKLPLRQVDPRVIS-------RGPDFTPAFADFGRMIPGSRGAPLLNVGLRRPPPRKIIMNVSVNDEVQLKKAENAWKPGMKRDA--AIDDPENLKTQELFRKVRSILNKLTPQMFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPSFSVAYGNMCSCLATLKVPMADKPTSTVNFRKLLLNRCQKEFE---KDKMDDDVFEKKQRELEAASSATERERLQEELEEAKDKARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVHQQLLSKDKRRPVLQREETWNTVPVPKNSRTIDPSKIPKISKPPMDDKIQLGPRAQLNWMKGSSGGAGAKASESDVLRP 1220          

HSP 2 Score: 77.0258 bits (188), Expect = 1.466e-13
Identity = 67/290 (23.10%), Postives = 132/290 (45.52%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNI-SFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWE--TFLKVNNLEFTVDLPGLSLCGGDPLNFIA----------EELEDMLSNNL-SNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQ---EYLKSKKEIIKRISNHKLENEIEILKSI--LNVASELNRDTLTRIYDLLITEKIVSHQAL 3727
            V+  +E+    R  +G   ++LL    +S  Q  +G    +   DD+  DIP IW + A+ +   + +   ++   F    K +LP     + FS  LH    ++ H+ VG ++  S L W   +P   +  +F+    L+FT     LS C   P   ++          ++LE +L  +L S+E+IF+++E ++D+         + + +++ KA  K+  SS +     ++ +  ++ +  N   E +++ L ++  L V  E   + L   +D L  E ++S  A 
Sbjct: 1389 VESTLERSQITRDHMGQLFHQLLQAGSLSKPQFFKGFSETLELADDMAIDIPHIWLYLAELVNPVLREGGISMRELFSEFSKPLLPVGRAGILFSEILHLLCKQMSHRKVGALWKDSGLSWADFLPETEDVNSFITEQKLDFT-----LSDCSS-PAAAVSNRMLSPEELNKQLEKLLLEDLASDEQIFDWVEANLDESEMSSPPFLRALMTAVCKAAVKLESSSYRVDTAIIQKRLPVLHKYLNSDTERQLQALYALQALIVKLEQPPNLLRMFFDCLYDEDVISEDAF 1672          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Cavefish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:103031287])

HSP 1 Score: 140.969 bits (354), Expect = 5.060e-33
Identity = 156/562 (27.76%), Postives = 267/562 (47.51%), Query Frame = 2
Query: 1028 ILLESKTPLSVKSFERMEFEEFDLQNKAPESSIRLDIEEDVATCSSEDEVHIDLKLSSSNYHLPVNKKESDETILKRKLIYDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISN--------QPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQI--NLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLEELK-----RNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVK-KAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFN--LMTKKKNVSNSQNIARRN---IQKNVSIKNLS----CNSHKVDEKTVLGPVLG-NWATGS--GSKSKSHEAEGWTP 2605
            + +E ++  +    E  E E   L+N  PE +   D  E+V T +        LK +S+N    + K E    +   K  Y+R +L+  +      QKP  +P  ++   D I+          PRVIS                A+  + +P  + +   N   ++   ++I  N+ ++D     ++++ + P   RD    +D  E LK     R ++S LNK+TPQ F + +K++  L I+ +E +  +I+ +F KA+ E ++SV Y   C  LA   +   + P     F+  LL +CQ  FE   +D++++   E K++ L    S  +     +  E+ K KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K +  L++K K     Q     N   + KN    + S     +   +D+K  LGP    NW  GS  G+ +K+ E++   P
Sbjct:  717 VCVERRSSTAAPVEENGEQEAEPLRN-GPEHTPEADSSEEVPTPA--------LKEASTNA---IQKPE----LKNGKRQYNRDFLLGFQFMPACVQKPEGLPPISDVVLDKINQNKLPLRQVDPRVIS-------RGPDFTPAFADFGRMIPGSRGAPLLNVGLRRPPPRKIIMNVSVNDEVQLKKAENAWKPGMKRDA--AIDDPENLKTQELFRKVRSILNKLTPQMFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPSFSVAYGNMCSCLATLKVPMADKPTSTVNFRKLLLNRCQKEFE---KDKMDDDVFEKKQRELEAASSATERERLQEELEEAKDKARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVHQQLLSKDKRRPVLQREETWNTVPVPKNSRTIDPSKIPKISKPPMDDKIQLGPRAQLNWMKGSSGGAGAKASESDVLRP 1245          

HSP 2 Score: 77.0258 bits (188), Expect = 1.434e-13
Identity = 67/290 (23.10%), Postives = 132/290 (45.52%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNI-SFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWE--TFLKVNNLEFTVDLPGLSLCGGDPLNFIA----------EELEDMLSNNL-SNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQ---EYLKSKKEIIKRISNHKLENEIEILKSI--LNVASELNRDTLTRIYDLLITEKIVSHQAL 3727
            V+  +E+    R  +G   ++LL    +S  Q  +G    +   DD+  DIP IW + A+ +   + +   ++   F    K +LP     + FS  LH    ++ H+ VG ++  S L W   +P   +  +F+    L+FT     LS C   P   ++          ++LE +L  +L S+E+IF+++E ++D+         + + +++ KA  K+  SS +     ++ +  ++ +  N   E +++ L ++  L V  E   + L   +D L  E ++S  A 
Sbjct: 1414 VESTLERSQITRDHMGQLFHQLLQAGSLSKPQFFKGFSETLELADDMAIDIPHIWLYLAELVNPVLREGGISMRELFSEFSKPLLPVGRAGILFSEILHLLCKQMSHRKVGALWKDSGLSWADFLPETEDVNSFITEQKLDFT-----LSDC-SSPAAAVSNRMLSPEELNKQLEKLLLEDLASDEQIFDWVEANLDESEMSSPPFLRALMTAVCKAAVKLESSSYRVDTAIIQKRLPVLHKYLNSDTERQLQALYALQALIVKLEQPPNLLRMFFDCLYDEDVISEDAF 1697          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Cavefish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:103031287])

HSP 1 Score: 140.969 bits (354), Expect = 5.355e-33
Identity = 155/558 (27.78%), Postives = 266/558 (47.67%), Query Frame = 2
Query: 1028 ILLESKTPLSVKSFERMEFEEFDLQNKAPESSIRLDIEEDVATCSSEDEVHIDLKLSSSNYHLPVNKKESDETILKRKLIYDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISN--------QPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQI--NLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLEELK-----RNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVK-KAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFN--LMTKKKNVSNSQNIARRN---IQKNVSIKNLS----CNSHKVDEKTVLGPVLG-NWATGS--GSKSKSHEAE 2593
            + +E ++  +    E  E E   L+N  PE +   D  E+V T +        LK +S+N    + K E    +   K  Y+R +L+  +      QKP  +P  ++   D I+          PRVIS                A+  + +P  + +   N   ++   ++I  N+ ++D     ++++ + P   RD    +D  E LK     R ++S LNK+TPQ F + +K++  L I+ +E +  +I+ +F KA+ E ++SV Y   C  LA   +   + P     F+  LL +CQ  FE   +D++++   E K++ L    S  +     +  E+ K KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K +  L++K K     Q     N   + KN    + S     +   +D+K  LGP    NW  GS  G+ +K+ E++
Sbjct:  735 VCVERRSSTAAPVEENGEQEAEPLRN-GPEHTPEADSSEEVPTPA--------LKEASTNA---IQKPE----LKNGKRQYNRDFLLGFQFMPACVQKPEGLPPISDVVLDKINQNKLPLRQVDPRVIS-------RGPDFTPAFADFGRMIPGSRGAPLLNVGLRRPPPRKIIMNVSVNDEVQLKKAENAWKPGMKRDA--AIDDPENLKTQELFRKVRSILNKLTPQMFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPSFSVAYGNMCSCLATLKVPMADKPTSTVNFRKLLLNRCQKEFE---KDKMDDDVFEKKQRELEAASSATERERLQEELEEAKDKARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVHQQLLSKDKRRPVLQREETWNTVPVPKNSRTIDPSKIPKISKPPMDDKIQLGPRAQLNWMKGSSGGAGAKASESD 1259          

HSP 2 Score: 77.0258 bits (188), Expect = 1.551e-13
Identity = 67/290 (23.10%), Postives = 132/290 (45.52%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNI-SFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWE--TFLKVNNLEFTVDLPGLSLCGGDPLNFIA----------EELEDMLSNNL-SNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQ---EYLKSKKEIIKRISNHKLENEIEILKSI--LNVASELNRDTLTRIYDLLITEKIVSHQAL 3727
            V+  +E+    R  +G   ++LL    +S  Q  +G    +   DD+  DIP IW + A+ +   + +   ++   F    K +LP     + FS  LH    ++ H+ VG ++  S L W   +P   +  +F+    L+FT     LS C   P   ++          ++LE +L  +L S+E+IF+++E ++D+         + + +++ KA  K+  SS +     ++ +  ++ +  N   E +++ L ++  L V  E   + L   +D L  E ++S  A 
Sbjct: 1432 VESTLERSQITRDHMGQLFHQLLQAGSLSKPQFFKGFSETLELADDMAIDIPHIWLYLAELVNPVLREGGISMRELFSEFSKPLLPVGRAGILFSEILHLLCKQMSHRKVGALWKDSGLSWADFLPETEDVNSFITEQKLDFT-----LSDC-SSPAAAVSNRMLSPEELNKQLEKLLLEDLASDEQIFDWVEANLDESEMSSPPFLRALMTAVCKAAVKLESSSYRVDTAIIQKRLPVLHKYLNSDTERQLQALYALQALIVKLEQPPNLLRMFFDCLYDEDVISEDAF 1715          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Sea Lamprey
Match: eif4g2a (eukaryotic translation initiation factor 4, gamma 2a [Source:ZFIN;Acc:ZDB-GENE-030131-2173])

HSP 1 Score: 87.0409 bits (214), Expect = 2.084e-17
Identity = 77/244 (31.56%), Postives = 121/244 (49.59%), Query Frame = 2
Query: 1619 EELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLAITYTN--NPAFKGQLLKKCQDMFE----TPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYD------SDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLR 2311
            E + R ++  LNK+TP+ F +   E+  + I++K  +  +I  IF KA++E  YS  Y+Q C +LA    N   P  +G    K    F       LQD+ EN     + K L   D++   L   + +EQ   AK K  GNI+FIGEL   +LL   ++  CI  LL           ++ +  LC+++ T G ++D  K +  M++Y   +  L  + DL  RIRF L+D +++R   W  R
Sbjct:   69 EAIFRKVRGILNKLTPEKFDKLCLELLNVGIDSKLILKGIILLIFEKALEEPKYSSLYSQLCQRLAEDAPNFDGPPLEGPGRHKHNSSFRRLLIAKLQDEFEN-----RTKKLEGFDNRDSPLSPEE-DEQRTIAKLKMLGNIKFIGELGKLDLLHESILHRCIKTLLEKKKRVALKDMAEDLECLCQIMRTVGPRLDHDKARSLMDQYFLRMQSLMANKDLPARIRFLLQDTVELRLNKWVPR 306          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Yeast
Match: TIF4631 (Translation initiation factor eIF4G; subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); interacts with Pab1p and with eIF4A (Tif1p); also has a role in biogenesis of the large ribosomal subunit; TIF4631 has a paralog, TIF4632, that arose from the whole genome duplication [Source:SGD;Acc:S000003394])

HSP 1 Score: 83.1889 bits (204), Expect = 1.929e-16
Identity = 77/283 (27.21%), Postives = 129/283 (45.58%), Query Frame = 2
Query: 1595 KQKLLDSLEELKRNIKSNLNKITPQNFPE-----CVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA------ITYTNNPAFKGQ------LLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDS---DAMLALCKLLETCGKQID----------VKHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMR-ERNWTLRHVQQEKQINPKTL 2350
            K +LLD  +E++R +KS LNK+T + F              +   N E +  +I +IF+KA  E  +S  YAQ C K+       IT   N    G       L+ +C   F+    D+L            NE  + ++    S+       AK +  G +RFIG L+  NLL GK++  C   L++D  DS   + + ++ +LL T G+Q +          ++  + ++     +  + Q+  +  RI+FKL DI ++R ++NW       +K   PKT+
Sbjct:  597 KTELLDK-DEVERKMKSLLNKLTLEMFDAISSEILAIANISVWETNGETLKAVIEQIFLKACDEPHWSSMYAQLCGKVVKELNPDITDETNEGKTGPKLVLHYLVARCHAEFDKGWTDKL----------PTNEDGTPLEPEMMSEEYYAAASAKRRGLGLVRFIGFLYRLNLLTGKMMFECFRRLMKDLTDSPSEETLESVVELLNTVGEQFETDSFRTGQATLEGSQLLDSLFGILDNIIQTAKISSRIKFKLIDIKELRHDKNWN----SDKKDNGPKTI 864          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Yeast
Match: TIF4632 (Translation initiation factor eIF4G; subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); associates with the poly(A)-binding protein Pab1p, also interacts with eIF4A (Tif1p); TIF4632 has a paralog, TIF4631, that arose from the whole genome duplication [Source:SGD;Acc:S000003017])

HSP 1 Score: 75.0998 bits (183), Expect = 5.266e-14
Identity = 94/358 (26.26%), Postives = 153/358 (42.74%), Query Frame = 2
Query: 1595 KQKLLDSLEELKRNIKSNLNKITPQNFPECVX-----XXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA------ITYTNNPAFKGQ------LLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRD---SYDSDAMLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSVDLE----------------KRIRFKLKDIIDMRE-RNWTLRHVQQEKQINPKTLXX-XXXXXXXXXXXXTIKFNLMTKKKNVSNSQNIA--RRNIQ----------KNVSIKNLSCNSHKVDE 2518
            K +L D  EE++R +KS LNK+T + F            +    ++ E +  +I +IF KA  E  +S  YAQ C K+       I    N    G       L+ +C + FE    D+L             E  + ++    SD       AK +  G +RFIG L+  NLL GK++  C   L++D       + + ++ +LL T G+Q +       +K+++  + L  SV L+                 RI+FKL D+ ++RE ++W       +K   PKT+++  + E        + + N      N SNS   +  RRN+Q          K  S +N   N+ KV+E
Sbjct:  557 KTELFDK-EEVERKMKSLLNKLTLEMFDSISSEILDIANQSKWEDDGETLKIVIEQIFHKACDEPHWSSMYAQLCGKVVKDLDPNIKDKENEGKNGPKLVLHYLVARCHEEFEKGWADKL----------PAGEDGNPLEPEMMSDEYYIAAAAKRRGLGLVRFIGYLYCLNLLTGKMMFECFRRLMKDLNNDPSEETLESVIELLNTVGEQFE------HDKFVTPQATLEGSVLLDNLFMLLQHIIDGGTISNRIKFKLIDVKELREIKHWN----SAKKDAGPKTIQQIHQEEEQLRQKKNSQRSNSRFNNHNQSNSNRYSSNRRNMQNTQRDSFASTKTGSFRNNQRNARKVEE 893          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Nematostella
Match: EDO33172 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST03])

HSP 1 Score: 120.939 bits (302), Expect = 1.013e-27
Identity = 88/252 (34.92%), Postives = 137/252 (54.37%), Query Frame = 2
Query: 1622 ELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKL----AITYTNNPAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNET----DSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDVK-HKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTL 2350
            E+ R  +  LNK+TPQ F +  +++  L I+  E++  +I+ IF KA+ E  +SV YA  C  L      T      F+  LL KCQ  FE    D  EN  +E  ++++NE     D K+K   +++LEE+    K +  GNIRFIGELF   +L   ++  C+++L++ S D +++   CKLL T GK +D +  K  M++Y S + ++  S     R+RF L+D+ D+R  NW  R        NPKT+
Sbjct:    1 EVMRKFRGILNKLTPQKFKKLTEQVMELEIDTSEKLEGIIDIIFEKAISEPGFSVAYANLCRCLLPIKVSTGNKELVFRTILLNKCQKEFEKEKTD--ENRIHEKIDQLVNEGLSEEDYKIK---KAELEEEEMFGKRRTLGNIRFIGELFKLKILTENIMHTCVMKLIK-SMDEESLECFCKLLSTIGKDLDHEVAKPRMDQYFSQMDKIIASKKTSSRVRFMLQDLRDLRLSNWVPRRDDN----NPKTI 242          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Nematostella
Match: EDO32341 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVB3])

HSP 1 Score: 100.138 bits (248), Expect = 1.797e-23
Identity = 77/236 (32.63%), Postives = 127/236 (53.81%), Query Frame = 2
Query: 1631 RNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNP-AFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKM---KALYESDLEEQVKKAKDKYFGNIRFIGELF-LHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDVK-HKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLR 2311
            R  +  LNKITPQNF + V+++  L I+  E++  +I+ +F KA++E  Y V YA  C+ L    +++ N    FK  LL KCQ  F+   + +  N  ++    ++NE  S M   K  + S+ EE     + +  GNI FIGELF L  +L   ++  C+ +L+  + D +++  LC+LL T GK +D    K  M++Y    +++  S      +RF ++D+ D+R  NW  R
Sbjct:    4 RKFRGILNKITPQNFKKLVEQVMNLEIDTAEKLEGIIDIVFEKAIREPRYCVVYANLCHCLLPIKVSFENKELVFKTILLNKCQKKFDKTYEHKTHNNTDQ----LVNEGLSPMFSRKKKHPSEQEEYEMWERRRTLGNIIFIGELFILKKILTENIMHTCVWKLINRT-DDESLECLCELLSTVGKDLDHDIAKPRMDQYFRQFNKIIDSKKTSSCVRFMIQDLRDLRLSNWVPR 234          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Nematostella
Match: EDO31711 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX49])

HSP 1 Score: 98.2117 bits (243), Expect = 1.310e-20
Identity = 86/272 (31.62%), Postives = 127/272 (46.69%), Query Frame = 2
Query: 1580 PQLRDKQKLLDSLEELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA--------ITYTNNPAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELL----RDSY--DSDAMLALCKLLETCGKQID-VKHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTL 2350
            PQ        D  E + R ++  LNK+TP  F +   E+  + +E K  +  +I  +F KA+ E AYS  YAQ C +L+           T N  F+  LLK+C++ F               + K     D K     E   EE+    K K  GNIRFIGEL   ++L   ++  CI +LL    R S    S+ M  LC L++T G +ID  K K  +++Y   I ++    DL  RIRF L+ I ++R   W  R V ++  + PK +
Sbjct:   53 PQYNRTNLYRDENELVFRRVRGILNKLTPDKFDKLFYELLHVGVETKYILKGVILLVFEKALDEPAYSSMYAQLCLRLSEEAPNFDDPGKTGNSTFRRLLLKQCEEEFNN-------------RSKASQAFDKKDDLTQEE--EEERGSTKRKMLGNIRFIGELAKLDMLHETILHKCIKQLLDKKKRASVADTSEDMECLCHLMKTVGSRIDGPKAKPLVDQYFERIYQIRSRSDLPSRIRFMLEGIEELRTNKWIPRKVARD--VGPKPI 307          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Medaka
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:105354159])

HSP 1 Score: 136.346 bits (342), Expect = 1.187e-31
Identity = 131/475 (27.58%), Postives = 237/475 (49.89%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISN---QPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQI--NLEISDNQVFIRSKSGYLPPQLRD---KQKLLDSLEELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVK-KAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFN--LMTK--KKNVSNSQNIARRNIQKNV--SIKN---------LSCNSHKVDEKTVLGP-VLGNWATGSGSKSKSHEAE 2593
            Y+R +L+  +      QKP  +P  ++   D ++      R +  ++   S         A+  +Q+   + +   N   ++   ++I  N+ ++D+    ++++ + P   R+   +       +EL R ++S LNK+TPQ F + +K++  L I+ +E +  +I+ +F KA+ E  +SV Y   C  LA   +  T+ P     F+  LL +CQ  FE   +D++++V  E K+K L+   S  +     +  E+ K KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K +  L++K  K+     +  A+R+   N   + KN            +  ++DEK  LGP     W  GS   +K+ ++E
Sbjct:  737 YNREFLLNFQFMPACTQKPEGLPPISDVVLDKMNQNKMPSRAVDSRV--ISRGPDFTPAFADFGRQMSGARGAALMNMGTRRPPPRKIIMNVTVNDDVQLKKAENAWKPGMKRETLPEDPEAQRTQELFRRVRSILNKLTPQKFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPGFSVAYGNMCRCLATLKVQMTDKPNSTVNFRKLLLNRCQKEFE---KDKVDDVVFERKQKELDSAASTTERERLQEELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVHQQLLSKDSKRRPDPREQRAQRDDTWNTVPTTKNSRTIDPNKIPKISKPQMDEKIQLGPRAQVTWVKGSSGGAKASDSE 1201          

HSP 2 Score: 74.3294 bits (181), Expect = 9.955e-13
Identity = 73/321 (22.74%), Postives = 142/321 (44.24%), Query Frame = 2
Query: 2903 IIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNI-SFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNH--WETFLKVNNLEF-TVDLPGLSLCGGDPLNF------IAEELEDMLSNNL-SNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRK-------IPESSVQEYLKSKKEIIKRISNHKLENEIEILKSI--LNVASELNRDTLTRIYDLLITEKIVSHQAL------KDYCDNE----SLKSENNF 3772
             ++  VD  +E+    R  +G    +L+   I+   Q  +G    +   DD+  DIP IW + A+ L   + D   ++   F  + K +LP     +  S  LH    ++ H+ V  ++ +S + W  ++P     + F+    LEF   D  G   C   P         ++++LE +L  ++ S+E+IF+++E ++D+P        +++ +++ KA  K       +  + +Q  L     ++ +  N   E +++ L ++  L V+ E   + L   +D L  E ++S  A       KD  + E    +LKS   F
Sbjct: 1365 FVQVGVDSTLERSQITRDHMGQLFFQLVQQGILPKPQFYKGFTDTLEMADDMAIDIPHIWLYLAEMLCPVLKDGGFSMRELFSELSKPLLPVGRAGILISEILHILCKQMSHRTVSSLWRESGISWTDVLPQGEDVQAFISQQKLEFLQTDGSG---CEAAPSKRMLSPEELSQQLEKLLLEDMASDEQIFDWVEENLDEPQTSSPPFLRSLMTAVCKAAVKDENNCCRVDTAIIQRRLP----VLLKYLNSDTERQLQALYALQALIVSLEQPANLLRMFFDCLYDEDVISEDAFYKWESSKDPAEQEGKGVALKSVTAF 1678          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Medaka
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:105354159])

HSP 1 Score: 135.961 bits (341), Expect = 1.445e-31
Identity = 131/475 (27.58%), Postives = 237/475 (49.89%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISN---QPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQI--NLEISDNQVFIRSKSGYLPPQLRD---KQKLLDSLEELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVK-KAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFN--LMTK--KKNVSNSQNIARRNIQKNV--SIKN---------LSCNSHKVDEKTVLGP-VLGNWATGSGSKSKSHEAE 2593
            Y+R +L+  +      QKP  +P  ++   D ++      R +  ++   S         A+  +Q+   + +   N   ++   ++I  N+ ++D+    ++++ + P   R+   +       +EL R ++S LNK+TPQ F + +K++  L I+ +E +  +I+ +F KA+ E  +SV Y   C  LA   +  T+ P     F+  LL +CQ  FE   +D++++V  E K+K L+   S  +     +  E+ K KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K +  L++K  K+     +  A+R+   N   + KN            +  ++DEK  LGP     W  GS   +K+ ++E
Sbjct:  769 YNREFLLNFQFMPACTQKPEGLPPISDVVLDKMNQNKMPSRAVDSRV--ISRGPDFTPAFADFGRQMSGARGAALMNMGTRRPPPRKIIMNVTVNDDVQLKKAENAWKPGMKRETLPEDPEAQRTQELFRRVRSILNKLTPQKFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPGFSVAYGNMCRCLATLKVQMTDKPNSTVNFRKLLLNRCQKEFE---KDKVDDVVFERKQKELDSAASTTERERLQEELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVHQQLLSKDSKRRPDPREQRAQRDDTWNTVPTTKNSRTIDPNKIPKISKPQMDEKIQLGPRAQVTWVKGSSGGAKASDSE 1233          

HSP 2 Score: 73.9442 bits (180), Expect = 1.154e-12
Identity = 73/321 (22.74%), Postives = 142/321 (44.24%), Query Frame = 2
Query: 2903 IIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNI-SFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNH--WETFLKVNNLEF-TVDLPGLSLCGGDPLNF------IAEELEDMLSNNL-SNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRK-------IPESSVQEYLKSKKEIIKRISNHKLENEIEILKSI--LNVASELNRDTLTRIYDLLITEKIVSHQAL------KDYCDNE----SLKSENNF 3772
             ++  VD  +E+    R  +G    +L+   I+   Q  +G    +   DD+  DIP IW + A+ L   + D   ++   F  + K +LP     +  S  LH    ++ H+ V  ++ +S + W  ++P     + F+    LEF   D  G   C   P         ++++LE +L  ++ S+E+IF+++E ++D+P        +++ +++ KA  K       +  + +Q  L     ++ +  N   E +++ L ++  L V+ E   + L   +D L  E ++S  A       KD  + E    +LKS   F
Sbjct: 1397 FVQVGVDSTLERSQITRDHMGQLFFQLVQQGILPKPQFYKGFTDTLEMADDMAIDIPHIWLYLAEMLCPVLKDGGFSMRELFSELSKPLLPVGRAGILISEILHILCKQMSHRTVSSLWRESGISWTDVLPQGEDVQAFISQQKLEFLQTDGSG---CEAAPSKRMLSPEELSQQLEKLLLEDMASDEQIFDWVEENLDEPQTSSPPFLRSLMTAVCKAAVKDENNCCRVDTAIIQRRLP----VLLKYLNSDTERQLQALYALQALIVSLEQPANLLRMFFDCLYDEDVISEDAFYKWESSKDPAEQEGKGVALKSVTAF 1710          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Medaka
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:105354159])

HSP 1 Score: 135.961 bits (341), Expect = 1.473e-31
Identity = 131/475 (27.58%), Postives = 237/475 (49.89%), Query Frame = 2
Query: 1268 YDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISN---QPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQI--NLEISDNQVFIRSKSGYLPPQLRD---KQKLLDSLEELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLA---ITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVK-KAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFN--LMTK--KKNVSNSQNIARRNIQKNV--SIKN---------LSCNSHKVDEKTVLGP-VLGNWATGSGSKSKSHEAE 2593
            Y+R +L+  +      QKP  +P  ++   D ++      R +  ++   S         A+  +Q+   + +   N   ++   ++I  N+ ++D+    ++++ + P   R+   +       +EL R ++S LNK+TPQ F + +K++  L I+ +E +  +I+ +F KA+ E  +SV Y   C  LA   +  T+ P     F+  LL +CQ  FE   +D++++V  E K+K L+   S  +     +  E+ K KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D+ID+R  NW  R   Q     PKT+E+   EA  E      K +  L++K  K+     +  A+R+   N   + KN            +  ++DEK  LGP     W  GS   +K+ ++E
Sbjct:  776 YNREFLLNFQFMPACTQKPEGLPPISDVVLDKMNQNKMPSRAVDSRV--ISRGPDFTPAFADFGRQMSGARGAALMNMGTRRPPPRKIIMNVTVNDDVQLKKAENAWKPGMKRETLPEDPEAQRTQELFRRVRSILNKLTPQKFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPGFSVAYGNMCRCLATLKVQMTDKPNSTVNFRKLLLNRCQKEFE---KDKVDDVVFERKQKELDSAASTTERERLQEELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQ----GPKTIEQIHKEAKIEEQEEQRKVHQQLLSKDSKRRPDPREQRAQRDDTWNTVPTTKNSRTIDPNKIPKISKPQMDEKIQLGPRAQVTWVKGSSGGAKASDSE 1240          

HSP 2 Score: 73.9442 bits (180), Expect = 1.184e-12
Identity = 73/321 (22.74%), Postives = 142/321 (44.24%), Query Frame = 2
Query: 2903 IIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNI-SFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNH--WETFLKVNNLEF-TVDLPGLSLCGGDPLNF------IAEELEDMLSNNL-SNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRK-------IPESSVQEYLKSKKEIIKRISNHKLENEIEILKSI--LNVASELNRDTLTRIYDLLITEKIVSHQAL------KDYCDNE----SLKSENNF 3772
             ++  VD  +E+    R  +G    +L+   I+   Q  +G    +   DD+  DIP IW + A+ L   + D   ++   F  + K +LP     +  S  LH    ++ H+ V  ++ +S + W  ++P     + F+    LEF   D  G   C   P         ++++LE +L  ++ S+E+IF+++E ++D+P        +++ +++ KA  K       +  + +Q  L     ++ +  N   E +++ L ++  L V+ E   + L   +D L  E ++S  A       KD  + E    +LKS   F
Sbjct: 1404 FVQVGVDSTLERSQITRDHMGQLFFQLVQQGILPKPQFYKGFTDTLEMADDMAIDIPHIWLYLAEMLCPVLKDGGFSMRELFSELSKPLLPVGRAGILISEILHILCKQMSHRTVSSLWRESGISWTDVLPQGEDVQAFISQQKLEFLQTDGSG---CEAAPSKRMLSPEELSQQLEKLLLEDMASDEQIFDWVEENLDEPQTSSPPFLRSLMTAVCKAAVKDENNCCRVDTAIIQRRLP----VLLKYLNSDTERQLQALYALQALIVSLEQPANLLRMFFDCLYDEDVISEDAFYKWESSKDPAEQEGKGVALKSVTAF 1717          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Medaka
Match: eif4g1a (eukaryotic translation initiation factor 4 gamma 1 [Source:NCBI gene;Acc:101158558])

HSP 1 Score: 133.265 bits (334), Expect = 1.081e-30
Identity = 88/252 (34.92%), Postives = 144/252 (57.14%), Query Frame = 2
Query: 1622 ELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNET-DSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTL 2350
            EL + ++S LNK+TPQ F E +K++  L I+ +E +   I+ IF KA+ E  +SV YA  C     L +   + P     F+  LL +CQ  FE   +DQ ++   E K+K L+ + D + +     +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D++D+R  NW  R       + PKT+
Sbjct:  831 ELFKRLRSILNKLTPQKFQELMKQVSELAIDTEERLKGAIDLIFEKAISEPNFSVAYANMCRCLMGLKVPTPDKPGNFVNFRKLLLNRCQKEFE---KDQDDDEIFERKQKELDASKDDEERERLRVELEESKDKARRRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLSTIGKDLDFEKAKPRMDQYFTQMDKIIKEKKTSSRIRFMLQDVLDLRRNNWVPRR----GDLGPKTI 1074          

HSP 2 Score: 62.3882 bits (150), Expect = 4.450e-9
Identity = 43/194 (22.16%), Postives = 95/194 (48.97%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNIS-FFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWE--TFLKVNNLEFTVDLPGLS--------LCGGDPLNFIAEELEDMLSNNLSNEKIFEFLETHVD 3463
            V+  +E+    R  +G  L+ L+    + +QQ  +G +  + + +D+  DIP IW + A+ +   +++    +   F  I K ++P     +  +  L      +  + VG ++ ++ L W +I+P   +  TF+    +EFTVD    S        L G +    I+++L+ +L +  +N++I +++E +++
Sbjct: 1396 VESTLERSTIAREHMGLLLHNLVKAGTLPTQQYFKGLEEILEAAEDMAIDIPHIWLYLAELITPMLHEGGIPMGQLFREISKPLVPLGKAGVLLAQILQLLCKGMTPQKVGALWKEAGLSWNEILPKDEDVNTFVTDQKVEFTVDEEMKSKDVGRKNVLSGEE----ISKQLDRLLQDKANNQRIRDWIEANLE 1585          
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Medaka
Match: eif4g1a (eukaryotic translation initiation factor 4 gamma 1 [Source:NCBI gene;Acc:101158558])

HSP 1 Score: 133.265 bits (334), Expect = 1.084e-30
Identity = 88/252 (34.92%), Postives = 144/252 (57.14%), Query Frame = 2
Query: 1622 ELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFC---YKLAITYTNNPA----FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNET-DSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDV-KHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTL 2350
            EL + ++S LNK+TPQ F E +K++  L I+ +E +   I+ IF KA+ E  +SV YA  C     L +   + P     F+  LL +CQ  FE   +DQ ++   E K+K L+ + D + +     +LEE   KA+ +  GNI+FIGELF   +L   ++ +C+V+LL++ +D +++  LC+LL T GK +D  K K  M++Y + + ++ +      RIRF L+D++D+R  NW  R       + PKT+
Sbjct:  787 ELFKRLRSILNKLTPQKFQELMKQVSELAIDTEERLKGAIDLIFEKAISEPNFSVAYANMCRCLMGLKVPTPDKPGNFVNFRKLLLNRCQKEFE---KDQDDDEIFERKQKELDASKDDEERERLRVELEESKDKARRRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLKN-HDEESLECLCRLLSTIGKDLDFEKAKPRMDQYFTQMDKIIKEKKTSSRIRFMLQDVLDLRRNNWVPRR----GDLGPKTI 1030          

HSP 2 Score: 62.3882 bits (150), Expect = 4.283e-9
Identity = 43/194 (22.16%), Postives = 95/194 (48.97%), Query Frame = 2
Query: 2918 VDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNIS-FFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKS-LKWEKIVPNHWE--TFLKVNNLEFTVDLPGLS--------LCGGDPLNFIAEELEDMLSNNLSNEKIFEFLETHVD 3463
            V+  +E+    R  +G  L+ L+    + +QQ  +G +  + + +D+  DIP IW + A+ +   +++    +   F  I K ++P     +  +  L      +  + VG ++ ++ L W +I+P   +  TF+    +EFTVD    S        L G +    I+++L+ +L +  +N++I +++E +++
Sbjct: 1352 VESTLERSTIAREHMGLLLHNLVKAGTLPTQQYFKGLEEILEAAEDMAIDIPHIWLYLAELITPMLHEGGIPMGQLFREISKPLVPLGKAGVLLAQILQLLCKGMTPQKVGALWKEAGLSWNEILPKDEDVNTFVTDQKVEFTVDEEMKSKDVGRKNVLSGEE----ISKQLDRLLQDKANNQRIRDWIEANLE 1541          
BLAST of Eukaryotic initiation factor-4G vs. Planmine SMEST
Match: SMESG000045275.1 (SMESG000045275.1)

HSP 1 Score: 1924.06 bits (4983), Expect = 0.000e+0
Identity = 976/976 (100.00%), Postives = 976/976 (100.00%), Query Frame = 2
Query:  896 MCTTLMNTEEDSSYEKENVEYTTKESNIICDKEETEQSKKEDDDILLESKTPLSVKSFERMEFEEFDLQNKAPESSIRLDIEEDVATCSSEDEVHIDLKLSSSNYHLPVNKKESDETILKRKLIYDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLEELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLAITYTNNPAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFNLMTKKKNVSNSQNIARRNIQKNVSIKNLSCNSHKVDEKTVLGPVLGNWATGSGSKSKSHEAEGWTPVSQKPKGGAMRYTSNSRSREQSPQVILANKYRNLESSAEASGADSRSSTPPMIRPITKAFRIIEQEVTDEEMAEIIFNDLLSTGNFDIKKWLTLRKVQPIIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKSLKWEKIVPNHWETFLKVNNLEFTVDLPGLSLCGGDPLNFIAEELEDMLSNNLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDTLTRIYDLLITEKIVSHQALKDYCDNESLKSENNFKLTNSLLSDILYLNEKS 3823
            MCTTLMNTEEDSSYEKENVEYTTKESNIICDKEETEQSKKEDDDILLESKTPLSVKSFERMEFEEFDLQNKAPESSIRLDIEEDVATCSSEDEVHIDLKLSSSNYHLPVNKKESDETILKRKLIYDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLEELKRNIKSNLNKITPQNFPECVKEIEILNIENKEEVSCLINEIFIKAVKEEAYSVTYAQFCYKLAITYTNNPAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLEEQKAEAAAEANAATIKFNLMTKKKNVSNSQNIARRNIQKNVSIKNLSCNSHKVDEKTVLGPVLGNWATGSGSKSKSHEAEGWTPVSQKPKGGAMRYTSNSRSREQSPQVILANKYRNLESSAEASGADSRSSTPPMIRPITKAFRIIEQEVTDEEMAEIIFNDLLSTGNFDIKKWLTLRKVQPIIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKSLKWEKIVPNHWETFLKVNNLEFTVDLPGLSLCGGDPLNFIAEELEDMLSNNLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDTLTRIYDLLITEKIVSHQALKDYCDNESLKSENNFKLTNSLLSDILYLNEKS
Sbjct:    1 MCTTLMNTEEDSSYEKENVEYTTKESNIICDKEETEQSKKEDDDILLESKTPLSVKSFERMEFEEFDLQNKAPESSIRLDIEEDVATCSSEDEVHIDLKLSSSNYHLPVNKKESDETILKRKLIYDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLEELKRNIKSNLNKITPQNFPECVKEIEILNIENKEEVSCLINEIFIKAVKEEAYSVTYAQFCYKLAITYTNNPAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLEEQKAEAAAEANAATIKFNLMTKKKNVSNSQNIARRNIQKNVSIKNLSCNSHKVDEKTVLGPVLGNWATGSGSKSKSHEAEGWTPVSQKPKGGAMRYTSNSRSREQSPQVILANKYRNLESSAEASGADSRSSTPPMIRPITKAFRIIEQEVTDEEMAEIIFNDLLSTGNFDIKKWLTLRKVQPIIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKSLKWEKIVPNHWETFLKVNNLEFTVDLPGLSLCGGDPLNFIAEELEDMLSNNLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDTLTRIYDLLITEKIVSHQALKDYCDNESLKSENNFKLTNSLLSDILYLNEKS 976          
BLAST of Eukaryotic initiation factor-4G vs. Planmine SMEST
Match: SMESG000045275.1 (SMESG000045275.1)

HSP 1 Score: 1912.5 bits (4953), Expect = 0.000e+0
Identity = 971/971 (100.00%), Postives = 971/971 (100.00%), Query Frame = 2
Query:  911 MNTEEDSSYEKENVEYTTKESNIICDKEETEQSKKEDDDILLESKTPLSVKSFERMEFEEFDLQNKAPESSIRLDIEEDVATCSSEDEVHIDLKLSSSNYHLPVNKKESDETILKRKLIYDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLEELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLAITYTNNPAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFNLMTKKKNVSNSQNIARRNIQKNVSIKNLSCNSHKVDEKTVLGPVLGNWATGSGSKSKSHEAEGWTPVSQKPKGGAMRYTSNSRSREQSPQVILANKYRNLESSAEASGADSRSSTPPMIRPITKAFRIIEQEVTDEEMAEIIFNDLLSTGNFDIKKWLTLRKVQPIIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKSLKWEKIVPNHWETFLKVNNLEFTVDLPGLSLCGGDPLNFIAEELEDMLSNNLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDTLTRIYDLLITEKIVSHQALKDYCDNESLKSENNFKLTNSLLSDILYLNEKS 3823
            MNTEEDSSYEKENVEYTTKESNIICDKEETEQSKKEDDDILLESKTPLSVKSFERMEFEEFDLQNKAPESSIRLDIEEDVATCSSEDEVHIDLKLSSSNYHLPVNKKESDETILKRKLIYDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLEELKRNIKSNLNKITPQNFPECVKEIEILNIENKEEVSCLINEIFIKAVKEEAYSVTYAQFCYKLAITYTNNPAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLEEQKAEAAAEANAATIKFNLMTKKKNVSNSQNIARRNIQKNVSIKNLSCNSHKVDEKTVLGPVLGNWATGSGSKSKSHEAEGWTPVSQKPKGGAMRYTSNSRSREQSPQVILANKYRNLESSAEASGADSRSSTPPMIRPITKAFRIIEQEVTDEEMAEIIFNDLLSTGNFDIKKWLTLRKVQPIIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKSLKWEKIVPNHWETFLKVNNLEFTVDLPGLSLCGGDPLNFIAEELEDMLSNNLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDTLTRIYDLLITEKIVSHQALKDYCDNESLKSENNFKLTNSLLSDILYLNEKS
Sbjct:    1 MNTEEDSSYEKENVEYTTKESNIICDKEETEQSKKEDDDILLESKTPLSVKSFERMEFEEFDLQNKAPESSIRLDIEEDVATCSSEDEVHIDLKLSSSNYHLPVNKKESDETILKRKLIYDRHYLIKMKDNLKSRQKPINMPATTEFSEDIISNQPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKNYNHKQTERKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLEELKRNIKSNLNKITPQNFPECVKEIEILNIENKEEVSCLINEIFIKAVKEEAYSVTYAQFCYKLAITYTNNPAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLEEQKAEAAAEANAATIKFNLMTKKKNVSNSQNIARRNIQKNVSIKNLSCNSHKVDEKTVLGPVLGNWATGSGSKSKSHEAEGWTPVSQKPKGGAMRYTSNSRSREQSPQVILANKYRNLESSAEASGADSRSSTPPMIRPITKAFRIIEQEVTDEEMAEIIFNDLLSTGNFDIKKWLTLRKVQPIIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKSLKWEKIVPNHWETFLKVNNLEFTVDLPGLSLCGGDPLNFIAEELEDMLSNNLSNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQEYLKSKKEIIKRISNHKLENEIEILKSILNVASELNRDTLTRIYDLLITEKIVSHQALKDYCDNESLKSENNFKLTNSLLSDILYLNEKS 971          
BLAST of Eukaryotic initiation factor-4G vs. Planmine SMEST
Match: SMESG000030556.1 (SMESG000030556.1)

HSP 1 Score: 384.03 bits (985), Expect = 2.395e-113
Identity = 284/794 (35.77%), Postives = 426/794 (53.65%), Query Frame = 2
Query: 1556 RSKSGYLPPQLRDKQK--LLDSLEELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXX-------VSCLINEIFIKAVKEEAYSVTYAQFCYKLAITYTNNPA---FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSVD-LEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXX-----TIKFNLMTKKKNVSNSQNIARRNIQKNVSIKNLSCNSHKVDEKTVLGPVLGNWATGSGSKSKSHEAEGWTPVSQKPKGGAMRYTSNSRSREQ--SPQVIL--------ANKYRNLESSAEASGADSRSSTPPMIRPITKAFRIIEQEVTDEEMAEIIFNDLLSTGNFDIKKWLTLRKVQPIIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKSLKWEKIVPNHWETFLKV--NNLEFTVDLPGLSLCGGDPLNFIAEELEDMLSNNL------SNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKI-PESSVQEYLKSKKEIIKRISNHKLENEIEILKSILNVASEL-NRDTLTRIYDLLITEKIVSHQALKDYCDNESLKS---EN---NFKLTNSLLSDIL 3805
            R  +GYLPP LR K++  L  +LE  +RN+K  LNKI PQNF  C+ EI+ +     ++       + CLI EIF KAVKEEAYSVTYA  C+ +A    +N +   FK  LL +C+ MFETPLQDQL  V+N W++KV  E D K++ LY SD+EEQ+KKA+DKYFGNIRFIGEL++H+LL  K+I  C+  L+    D DAML+LCKLLETCGK+ D KH + M+ YI  ++ + ++ D LE RIRFK+ DII+M ER W LR VQ +K + PKTLEE K + + + + +     TIK N  T  K++ N   +  +   +N SI +++  S    E   L P  G W +      K  +   W  V  K +  + +Y+S ++S +   SP  I          +KY  L +  +    +  +S  P +R ++      E +    +  E++ N LL T   ++  W    KV  +I +W+D +MEK    R  +GD L  L+    +    ++EG   F+  I+DLI DIPKIW F A+ LERFI D+ S + F++ +F+S LPN  +  C    L  A+ R+G  ++          + ++ N  + FL +   + +FT     L L   +  +    +  +   N L       NE IFE LE+       +  E   ++   +   +  +  ES V ++L  K+ + +RI + K   E + L +++N A+ L  RD LT +   L T KI+S  A + + +N  LK    EN   N++LT + +  IL
Sbjct:  283 RIVNGYLPPHLRLKEECSLNKNLENCRRNLKCILNKIAPQNFSLCINEIKAIIKSIDQQNVKIDDCIDCLIEEIFDKAVKEEAYSVTYANLCFNIAKLDDDNESKWNFKASLLNRCKQMFETPLQDQLRMVKNHWEKKVEEEEDEKLRNLYRSDIEEQIKKARDKYFGNIRFIGELYVHDLLKPKIIHCCVNTLIPKPKDEDAMLSLCKLLETCGKKFDEKHSDKMSDYIKSMTEMLETPDLLETRIRFKILDIIEMSERKWLLREVQSQKMVRPKTLEEVKKDVSDDKSISASKFPTIKSNNRTSTKHIPNQSELKFKQQSRNQSI-DVNSLSLGTSESLELKPSYGFWNSN-----KEKDQSEWKNVDNKKRTKS-KYSSTNKSSQNRFSPNKITDEPTNKAHLSKYAILSTQDDVKENNITNSESP-VRSVSPCESKSEDDAVMMDGEELLDN-LLETHTLNMTAWGNQLKVSELINQWLDKIMEKKQRDRHLVGDQLANLVACNKLQKDALIEGLNQFIDLIEDLITDIPKIWTFLAEILERFIQDEKSYVEFYKFVFESRLPNEHINKCVLLILEYANERVGSSVM----------KFLIDNQLDDFLNLIKKDKDFTSMPETLILNTDNTNSSTTTQFTNSFKNELISSLPNDNENIFELLESKFTIEQMQTDEFVNSLAYCLFSFICDLKSESDVIDFLIEKQCLFRRIIDSKSAFETQFLLALVNFANRLETRDLLTTLVQNL-TGKIISTDACQHFINNSELKDLDLENDNENYQLTVNAIRSIL 1056          
BLAST of Eukaryotic initiation factor-4G vs. Planmine SMEST
Match: SMESG000030556.1 (SMESG000030556.1)

HSP 1 Score: 383.645 bits (984), Expect = 3.869e-113
Identity = 284/794 (35.77%), Postives = 426/794 (53.65%), Query Frame = 2
Query: 1556 RSKSGYLPPQLRDKQK--LLDSLEELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXX-------VSCLINEIFIKAVKEEAYSVTYAQFCYKLAITYTNNPA---FKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSVD-LEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXX-----TIKFNLMTKKKNVSNSQNIARRNIQKNVSIKNLSCNSHKVDEKTVLGPVLGNWATGSGSKSKSHEAEGWTPVSQKPKGGAMRYTSNSRSREQ--SPQVIL--------ANKYRNLESSAEASGADSRSSTPPMIRPITKAFRIIEQEVTDEEMAEIIFNDLLSTGNFDIKKWLTLRKVQPIIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKSLKWEKIVPNHWETFLKV--NNLEFTVDLPGLSLCGGDPLNFIAEELEDMLSNNL------SNEKIFEFLETHVDKPTWKKSECTKTITSSILKALRKI-PESSVQEYLKSKKEIIKRISNHKLENEIEILKSILNVASEL-NRDTLTRIYDLLITEKIVSHQALKDYCDNESLKS---EN---NFKLTNSLLSDIL 3805
            R  +GYLPP LR K++  L  +LE  +RN+K  LNKI PQNF  C+ EI+ +     ++       + CLI EIF KAVKEEAYSVTYA  C+ +A    +N +   FK  LL +C+ MFETPLQDQL  V+N W++KV  E D K++ LY SD+EEQ+KKA+DKYFGNIRFIGEL++H+LL  K+I  C+  L+    D DAML+LCKLLETCGK+ D KH + M+ YI  ++ + ++ D LE RIRFK+ DII+M ER W LR VQ +K + PKTLEE K + + + + +     TIK N  T  K++ N   +  +   +N SI +++  S    E   L P  G W +      K  +   W  V  K +  + +Y+S ++S +   SP  I          +KY  L +  +    +  +S  P +R ++      E +    +  E++ N LL T   ++  W    KV  +I +W+D +MEK    R  +GD L  L+    +    ++EG   F+  I+DLI DIPKIW F A+ LERFI D+ S + F++ +F+S LPN  +  C    L  A+ R+G  ++          + ++ N  + FL +   + +FT     L L   +  +    +  +   N L       NE IFE LE+       +  E   ++   +   +  +  ES V ++L  K+ + +RI + K   E + L +++N A+ L  RD LT +   L T KI+S  A + + +N  LK    EN   N++LT + +  IL
Sbjct:  292 RIVNGYLPPHLRLKEECSLNKNLENCRRNLKCILNKIAPQNFSLCINEIKAIIKSIDQQNVKIDDCIDCLIEEIFDKAVKEEAYSVTYANLCFNIAKLDDDNESKWNFKASLLNRCKQMFETPLQDQLRMVKNHWEKKVEEEEDEKLRNLYRSDIEEQIKKARDKYFGNIRFIGELYVHDLLKPKIIHCCVNTLIPKPKDEDAMLSLCKLLETCGKKFDEKHSDKMSDYIKSMTEMLETPDLLETRIRFKILDIIEMSERKWLLREVQSQKMVRPKTLEEVKKDVSDDKSISASKFPTIKSNNRTSTKHIPNQSELKFKQQSRNQSI-DVNSLSLGTSESLELKPSYGFWNSN-----KEKDQSEWKNVDNKKRTKS-KYSSTNKSSQNRFSPNKITDEPTNKAHLSKYAILSTQDDVKENNITNSESP-VRSVSPCESKSEDDAVMMDGEELLDN-LLETHTLNMTAWGNQLKVSELINQWLDKIMEKKQRDRHLVGDQLANLVACNKLQKDALIEGLNQFIDLIEDLITDIPKIWTFLAEILERFIQDEKSYVEFYKFVFESRLPNEHINKCVLLILEYANERVGSSVM----------KFLIDNQLDDFLNLIKKDKDFTSMPETLILNTDNTNSSTTTQFTNSFKNELISSLPNDNENIFELLESKFTIEQMQTDEFVNSLAYCLFSFICDLKSESDVIDFLIEKQCLFRRIIDSKSAFETQFLLALVNFANRLETRDLLTTLVQNL-TGKIISTDACQHFINNSELKDLDLENDNENYQLTVNAIRSIL 1065          
BLAST of Eukaryotic initiation factor-4G vs. Planmine SMEST
Match: SMESG000045255.1 (SMESG000045255.1)

HSP 1 Score: 363.614 bits (932), Expect = 2.065e-103
Identity = 230/584 (39.38%), Postives = 336/584 (57.53%), Query Frame = 2
Query: 1550 FIRSKSGYLPPQLRDKQKLLDSLEELKRNIKSNLNKITPQNFPECVXXXXXXXXXXXXXVSCLINEIFIKAVKEEAYSVTYAQFCYKLAITYTNNPAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVLNETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNCIVELLRDSYDSDAMLALCKLLETCGKQIDVKHKESMN------KYISDISRLSQSVDLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLXXXXXXXXXXXXXXTIKFNLMTKKKNVSNSQNIARRNIQKN--VSIKNLSCNSHKVDEKTVLGPVL-GNWATGSGSKSKSHEAEGWTPVSQKPKGGAMRYTSNSRSREQSPQVIL---ANKYRNLESSAEASGADSRSSTPPMIRPITKAFRIIEQEVTDEEMAEIIFNDLLSTGNFDIKKWLTLRKVQPIIEKWVDDMMEKDVSCRRQIGDSLNRLLIDKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNISFFENIFKSILPN-NDVALCFSTALHEASSRLGHKIVGQVFHK 3262
             IR+++GYLPPQLR   +  D L+ LKRNIKS LNK+TP+NF  C+ ++  L I+ +E + CLI+EIF KA++E +YS  YA+FC +++     N +FK  LLK CQ MF+ PL  QLE V+  W+ K  NE D +MK LYESD+EEQVKKAKDKYFGNIRF  ELFL N L+ K+I+ C   LL  S D++++ A C+L+E CGKQ++   KE  N      + ++    LS++VD+E+R+RFKLKD++DMRERNW LR +Q+  +  PKTL+E K +   E  +            N +N+ N+  R       +  K L  N   + E TVLGP L   W   +G +SKS+ + G++ +   P    + Y          P V++    NKY  L    E        S P          ++   E    E+ +++ N+L +     + KW  L     ++EKW   M E+ V CR ++GD  + L+   +++  Q+++G  V + ++DD+I D+PK WEF AQFLERFI  ++SNISFF+++FK +    + V  CF      +SSR+   IV  +F K
Sbjct: 1011 LIRTENGYLPPQLRKADE--DKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDLSKIKTNYNNNNNNNNTNNNNMRNRQPYSRPVMDTKKLLVNPQNLSENTVLGPSLRTQW--NAGCQSKSNNSNGFSTI---PSRKQVSYDDII----DKPTVVVIKTQNKYAKLCEDFEV----ELPSVP---------VKVNNDEALTTELFDLLMNNLAT-----VDKWKELFNPVEVVEKWFALMFERKVECRMRVGDYFHDLIEGGLLTFDQLIQGASVTMETVDDIIDDVPKFWEFLAQFLERFIRSEHSNISFFKDLFKDVEGQESGVEKCFKFTQQFSSSRIDSDIVEALFGK 1565          
The following BLAST results are available for this feature:
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF4G35.360e-3530.14eukaryotic translation initiation factor 4 gamma 3... [more]
EIF4G36.030e-3530.14eukaryotic translation initiation factor 4 gamma 3... [more]
EIF4G36.221e-3530.14eukaryotic translation initiation factor 4 gamma 3... [more]
EIF4G37.797e-3530.14eukaryotic translation initiation factor 4 gamma 3... [more]
EIF4G32.829e-3231.76eukaryotic translation initiation factor 4 gamma 3... [more]
back to top
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ifg-11.634e-824.50Initiation Factor 4G (eIF4G) family [Source:UniPr... [more]
ifg-11.634e-824.50Initiation Factor 4G (eIF4G) family [Source:UniPr... [more]
ifg-11.634e-824.50Initiation Factor 4G (eIF4G) family [Source:UniPr... [more]
ifg-11.786e-824.50Initiation Factor 4G (eIF4G) family [Source:UniPr... [more]
ifg-11.926e-824.40Initiation Factor 4G (eIF4G) family [Source:UniPr... [more]
back to top
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NAT11.258e-2731.63gene:FBgn0010488 transcript:FBtr0334772[more]
eIF4G11.607e-2132.85gene:FBgn0023213 transcript:FBtr0112904[more]
eIF4G11.846e-2132.85gene:FBgn0023213 transcript:FBtr0289951[more]
eIF4G11.846e-2132.85gene:FBgn0023213 transcript:FBtr0089243[more]
NAT11.030e-1833.33gene:FBgn0010488 transcript:FBtr0087786[more]
back to top
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4g3a9.721e-3728.75eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g3a1.089e-3628.75eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g3a5.400e-3628.75eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g3b1.367e-3030.77eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g3b1.567e-3030.77eukaryotic translation initiation factor 4 gamma, ... [more]
back to top
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4g31.786e-4324.92eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g37.032e-3928.88eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g32.305e-3830.00eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g32.407e-3830.00eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g35.491e-3828.15eukaryotic translation initiation factor 4 gamma, ... [more]
back to top
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eif4g32.018e-4724.92eukaryotic translation initiation factor 4 gamma, ... [more]
Eif4g34.879e-3530.14eukaryotic translation initiation factor 4 gamma, ... [more]
Eif4g38.939e-3529.90eukaryotic translation initiation factor 4 gamma, ... [more]
Eif4g11.804e-3028.57eukaryotic translation initiation factor 4, gamma ... [more]
Eif4g12.165e-3029.10eukaryotic translation initiation factor 4, gamma ... [more]
back to top
BLAST of Eukaryotic initiation factor-4G vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43432|IF4G3_HUMAN2.988e-3430.14Eukaryotic translation initiation factor 4 gamma 3... [more]
sp|Q80XI3|IF4G3_MOUSE3.082e-3430.14Eukaryotic translation initiation factor 4 gamma 3... [more]
sp|Q6NZJ6|IF4G1_MOUSE2.428e-2933.99Eukaryotic translation initiation factor 4 gamma 1... [more]
sp|Q04637|IF4G1_HUMAN1.096e-2833.99Eukaryotic translation initiation factor 4 gamma 1... [more]
sp|B9FXV5|IF4G_ORYSJ1.719e-2534.77Eukaryotic translation initiation factor 4G OS=Ory... [more]
back to top
BLAST of Eukaryotic initiation factor-4G vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG540.000e+074.03Eukaryotic initiation factor-4G OS=Dugesia japonic... [more]
A0A1I8I6994.038e-5727.79MI domain-containing protein OS=Macrostomum lignan... [more]
A0A267H8S58.789e-5727.37MI domain-containing protein OS=Macrostomum lignan... [more]
A0A1I8G5Z35.724e-5526.77MIF4G domain-containing protein OS=Macrostomum lig... [more]
A0A267HB469.160e-5334.31Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4g3a1.023e-3329.69eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g3b3.085e-3327.76eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g3b4.810e-3327.76eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g3b5.060e-3327.76eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g3b5.355e-3327.78eukaryotic translation initiation factor 4 gamma 3... [more]
back to top
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif4g2a2.084e-1731.56eukaryotic translation initiation factor 4, gamma ... [more]
back to top
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
TIF46311.929e-1627.21Translation initiation factor eIF4G; subunit of th... [more]
TIF46325.266e-1426.26Translation initiation factor eIF4G; subunit of th... [more]
back to top
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO331721.013e-2734.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323411.797e-2332.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317111.310e-2031.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Eukaryotic initiation factor-4G vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4g3a1.187e-3127.58eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g3a1.445e-3127.58eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g3a1.473e-3127.58eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g1a1.081e-3034.92eukaryotic translation initiation factor 4 gamma 1... [more]
eif4g1a1.084e-3034.92eukaryotic translation initiation factor 4 gamma 1... [more]
back to top
BLAST of Eukaryotic initiation factor-4G vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045275.10.000e+0100.00SMESG000045275.1[more]
SMESG000045275.10.000e+0100.00SMESG000045275.1[more]
SMESG000030556.12.395e-11335.77SMESG000030556.1[more]
SMESG000030556.13.869e-11335.77SMESG000030556.1[more]
SMESG000045255.12.065e-10339.38SMESG000045255.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025106 ID=SMED30025106|Name=Eukaryotic initiation factor-4G|organism=Schmidtea mediterranea sexual|type=transcript|length=4301bp
AAATATTACAAAATAATTTAAATAATCTTTTTTAAAACAATCAGTAGTTT
TTATTATTTTGTGATCATTAAATAACGTAATTTGAGGTGTAATTACAATT
TGTTAGATTTTCGTAAATAATTACATATCTGGTTACTCCATGTCACAAAA
ATTCGAGCTACGGAAGTACAATTATAACTTTCAGTGCTTTTTCAATTTAA
AACTAATTCCTATCGGGATTTGGACCCGGACGAAATATGTATTTTATTGT
AACGTATGTTATAAGGCTAATTCATTTATAATGATCATTCATATTTCGCT
GAGTTCCTTATTTAATTTTACAACTTTTTGTAATAATTCAAAAACAATTT
TTACGAAGATATTTATATTTCACTGGAATTGTTTCGTTTATATTTTTCAA
ATCTTTTTTTCGGCTTTTAATTATGGTCTTGTAAATTGTGAATGTGCTAA
TATTATTCTTGTTTTATTCAGTCATTTAGGCTTCAATACCAATATGCAAC
AAAATGTTGCTAACGCCATGAGATCTATGTCACCTTCAATCGCACAAAAC
CCTATTTTTCTTCAAAGTTACGTCCCTCAAAGTTTTGTACAGCCCATGCA
TACATATCAAACATATCCAAATTCATACCAACACCAGTTTAATTATCCGC
AGGAAATACAGCCTAGTGCTGTTAAACCGGCAGTAAATACACAAACTACA
AGAAAACTTAACCCCCTTATTGTGATAGATCCTAAAAGCAACACTGATGT
TGATTTAAGTAGATTTAGCGTTGATAGAACATTAACAGTTTCAGAGCCAT
TAGTGACGAAAAAGAAAATATCTAAACCAGATACTATAGAACAAAAAGAT
GTAGAGAAAGTTGATAAGACACTAAAATTCGAAAATCCTTCTGAAATGTG
TACAACATTAATGAATACAGAAGAAGATTCCAGTTATGAAAAAGAAAATG
TTGAATATACAACTAAGGAATCTAATATTATTTGTGATAAAGAAGAAACT
GAGCAATCTAAAAAGGAAGATGATGATATTTTATTAGAATCAAAAACACC
CTTGTCTGTTAAATCATTTGAAAGAATGGAATTTGAAGAATTTGATTTAC
AGAATAAAGCCCCGGAAAGCTCAATTAGATTAGACATTGAAGAAGACGTT
GCCACATGCAGTAGTGAAGATGAAGTTCATATCGATTTAAAACTCTCTTC
ATCAAACTACCATTTGCCTGTTAACAAAAAAGAATCCGATGAAACGATAC
TTAAACGAAAACTAATTTACGATAGGCATTATTTGATAAAAATGAAAGAT
AATTTAAAAAGTCGCCAAAAGCCAATAAATATGCCCGCAACTACAGAGTT
TTCAGAAGATATAATATCTAATCAACCGAGAGTCATTTCTTGCCAATTAC
CCCCAGAATCATCGTCCAGTCAGACTAATAACGAAAGAGCAAACAATAAA
AAGCAGCTTCCTAACAGACAATATTCGAAATATAAAAATTATAACCACAA
ACAGACTGAACGAAAACAGATTAATTTAGAAATTTCTGATAATCAAGTTT
TCATTCGTTCAAAATCCGGATATTTGCCTCCTCAATTAAGAGATAAACAG
AAATTGTTGGATTCACTTGAAGAATTAAAGCGAAATATCAAAAGTAATTT
GAATAAAATCACACCCCAGAACTTTCCGGAATGTGTAAAGGAAATCGAAA
TTTTGAATATAGAAAACAAGGAAGAAGTGTCATGCCTTATCAATGAAATC
TTCATCAAAGCAGTTAAAGAAGAAGCTTATAGTGTTACTTACGCTCAATT
TTGTTATAAATTAGCCATTACATACACCAACAATCCAGCATTTAAAGGAC
AGTTGCTCAAAAAATGTCAGGATATGTTCGAAACCCCATTACAAGATCAG
TTAGAAAATGTTCGAAATGAATGGAAAGAAAAAGTATTAAATGAAACTGA
TAGTAAAATGAAAGCATTATATGAATCTGATCTTGAAGAACAAGTTAAAA
AGGCAAAAGATAAATATTTTGGCAATATCAGGTTTATTGGTGAATTATTT
TTACACAACCTCTTAGCAGGAAAGGTGATTTTAAATTGCATTGTTGAGCT
GCTGAGAGACAGTTATGACTCAGATGCAATGCTGGCTTTGTGTAAACTCT
TAGAGACTTGTGGCAAGCAAATAGATGTGAAACATAAAGAGTCAATGAAC
AAATATATATCGGATATCAGTAGATTATCACAATCCGTTGATTTAGAGAA
ACGGATTAGATTCAAATTAAAGGATATAATTGATATGCGAGAAAGGAATT
GGACACTTCGTCACGTGCAACAGGAAAAACAAATCAATCCAAAGACACTA
GAAGAGCAAAAGGCAGAAGCGGCTGCTGAAGCAAATGCAGCAACAATTAA
ATTTAATTTAATGACAAAGAAAAAAAATGTTTCCAATTCTCAAAATATTG
CTCGAAGAAATATACAGAAAAATGTTTCCATTAAAAATTTGAGTTGCAAC
AGTCACAAAGTGGATGAAAAAACAGTTCTGGGGCCAGTTTTAGGTAATTG
GGCAACTGGGAGTGGATCAAAATCTAAATCCCACGAAGCCGAAGGATGGA
CTCCGGTTTCACAAAAACCAAAAGGTGGAGCTATGAGATACACGAGCAAT
TCTCGGTCGAGAGAACAATCTCCACAGGTGATTTTAGCTAACAAATACCG
AAATTTGGAGTCATCTGCTGAAGCAAGTGGTGCAGATAGTAGATCGAGTA
CACCTCCCATGATTAGACCAATTACAAAAGCTTTTCGAATTATTGAACAA
GAGGTTACGGATGAAGAGATGGCAGAAATTATATTCAATGATTTATTATC
AACCGGAAATTTCGACATTAAAAAATGGTTAACATTACGTAAAGTGCAGC
CAATCATCGAAAAGTGGGTTGATGATATGATGGAAAAAGATGTTTCATGT
CGTCGTCAAATCGGAGATAGTTTAAACAGGCTATTAATTGATAAGATAAT
TTCCAGCCAGCAAATCGTTGAAGGTACGCAAGTGTTTGTGTCATCTATTG
ACGATTTAATTTGTGATATTCCTAAAATCTGGGAATTTTTCGCCCAGTTC
CTCGAAAGATTTATCTATGACAAAAATTCAAATATTTCATTTTTTGAAAA
TATATTCAAATCAATTTTACCGAATAATGATGTAGCCTTATGCTTTTCCA
CAGCTTTGCATGAGGCTAGTTCAAGATTGGGACATAAAATCGTTGGGCAA
GTGTTCCATAAATCTTTGAAATGGGAAAAAATTGTTCCAAATCACTGGGA
AACATTTTTAAAAGTCAATAATTTAGAATTCACTGTAGATTTGCCCGGAT
TATCTTTGTGTGGTGGAGATCCATTGAATTTCATTGCTGAAGAGTTAGAA
GACATGTTATCAAACAACTTATCGAATGAAAAGATTTTTGAATTCCTAGA
AACACATGTCGATAAGCCTACTTGGAAAAAAAGTGAATGTACCAAAACAA
TTACCAGCTCCATATTAAAAGCACTGAGAAAAATACCAGAATCTTCAGTT
CAAGAATATTTGAAAAGCAAAAAAGAAATTATTAAAAGAATTTCAAATCA
CAAACTGGAAAACGAAATTGAAATTTTAAAATCCATTTTAAATGTTGCTT
CAGAATTGAATAGAGATACCTTGACCCGTATTTACGATTTGCTGATCACA
GAGAAAATAGTATCTCACCAAGCACTCAAAGACTACTGTGATAACGAATC
ATTAAAATCAGAAAATAATTTCAAATTGACTAATTCACTTTTGTCTGATA
TCTTGTACTTGAATGAAAAATCATAGCTTGTTAATTTAATCCTCCTCCTC
CTCCTTTCCCCTCCCTTCCTTTCTGTATGCGCGTTTGTCCATGTGTGTTT
CGCTGTGCTGTTTATTATCCCATATATCTTTCACATTTTTATTTTTATGG
GAAACTTGCATTGTGCTCTTTTTGATTTTGATGTTATATATGATATATAT
ATACATTTTTTTCTTAATAATTATTGAACTTGATTCGGTTTCGTTCATTT
TTATGGTTAATATTATTATTATTATTGGTTAGTAGTTATGTTGGAGGACT
TTCTCTATTTGGGTGTCTATGTGTGTGTGTGTGTTTGTGGTTATGTAATG
TCAGCAAATGTACGAGGGAAATACCCGTGTATATATTATACATATTTGTG
TGTAATCAAGTAATATTTTTATTGCATTTTCAGCGTTTATTTAGGAGTTA
GTATATTTATTGGATGATAATGTGAACCAATGAGCAACCTTGATTATTAT
T
back to top

protein sequence of SMED30025106-orf-1

>SMED30025106-orf-1 ID=SMED30025106-orf-1|Name=SMED30025106-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1229bp
MSQKFELRKYNYNFQCFFNLKLIPIGIWTRTKYVFYCNVCYKANSFIMII
HISLSSLFNFTTFCNNSKTIFTKIFIFHWNCFVYIFQIFFSAFNYGLVNC
ECANIILVLFSHLGFNTNMQQNVANAMRSMSPSIAQNPIFLQSYVPQSFV
QPMHTYQTYPNSYQHQFNYPQEIQPSAVKPAVNTQTTRKLNPLIVIDPKS
NTDVDLSRFSVDRTLTVSEPLVTKKKISKPDTIEQKDVEKVDKTLKFENP
SEMCTTLMNTEEDSSYEKENVEYTTKESNIICDKEETEQSKKEDDDILLE
SKTPLSVKSFERMEFEEFDLQNKAPESSIRLDIEEDVATCSSEDEVHIDL
KLSSSNYHLPVNKKESDETILKRKLIYDRHYLIKMKDNLKSRQKPINMPA
TTEFSEDIISNQPRVISCQLPPESSSSQTNNERANNKKQLPNRQYSKYKN
YNHKQTERKQINLEISDNQVFIRSKSGYLPPQLRDKQKLLDSLEELKRNI
KSNLNKITPQNFPECVKEIEILNIENKEEVSCLINEIFIKAVKEEAYSVT
YAQFCYKLAITYTNNPAFKGQLLKKCQDMFETPLQDQLENVRNEWKEKVL
NETDSKMKALYESDLEEQVKKAKDKYFGNIRFIGELFLHNLLAGKVILNC
IVELLRDSYDSDAMLALCKLLETCGKQIDVKHKESMNKYISDISRLSQSV
DLEKRIRFKLKDIIDMRERNWTLRHVQQEKQINPKTLEEQKAEAAAEANA
ATIKFNLMTKKKNVSNSQNIARRNIQKNVSIKNLSCNSHKVDEKTVLGPV
LGNWATGSGSKSKSHEAEGWTPVSQKPKGGAMRYTSNSRSREQSPQVILA
NKYRNLESSAEASGADSRSSTPPMIRPITKAFRIIEQEVTDEEMAEIIFN
DLLSTGNFDIKKWLTLRKVQPIIEKWVDDMMEKDVSCRRQIGDSLNRLLI
DKIISSQQIVEGTQVFVSSIDDLICDIPKIWEFFAQFLERFIYDKNSNIS
FFENIFKSILPNNDVALCFSTALHEASSRLGHKIVGQVFHKSLKWEKIVP
NHWETFLKVNNLEFTVDLPGLSLCGGDPLNFIAEELEDMLSNNLSNEKIF
EFLETHVDKPTWKKSECTKTITSSILKALRKIPESSVQEYLKSKKEIIKR
ISNHKLENEIEILKSILNVASELNRDTLTRIYDLLITEKIVSHQALKDYC
DNESLKSENNFKLTNSLLSDILYLNEKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003890MIF4G-like_typ-3
IPR016021MIF4-like_sf
IPR003891Initiation_fac_eIF4g_MI
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005515protein binding
GO:0005488binding
GO:0003743translation initiation factor activity
Vocabulary: biological process
TermDefinition
GO:0006413translational initiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 231..254
NoneNo IPR availableCOILSCoilCoilcoord: 901..921
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 555..594
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 578..594
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 168..195
NoneNo IPR availablePANTHERPTHR23253EUKARYOTIC TRANSLATION INITIATION FACTOR 4 GAMMAcoord: 18..748
IPR003890MIF4G-like, type 3SMARTSM00543if4_15coord: 245..468
e-value: 2.2E-24
score: 97.0
IPR003890MIF4G-like, type 3PFAMPF02854MIF4Gcoord: 248..467
e-value: 3.0E-28
score: 98.9
IPR016021MIF4G-like domain superfamilyGENE3DG3DSA:1.25.40.180coord: 238..470
e-value: 1.2E-57
score: 196.9
IPR016021MIF4G-like domain superfamilyGENE3DG3DSA:1.25.40.180coord: 658..817
e-value: 7.2E-29
score: 102.7
IPR016021MIF4G-like domain superfamilyGENE3DG3DSA:1.25.40.180coord: 826..952
e-value: 2.8E-6
score: 29.3
IPR003891Initiation factor eIF-4 gamma, MA3PFAMPF02847MA3coord: 670..742
e-value: 3.1E-6
score: 27.2
IPR003891Initiation factor eIF-4 gamma, MA3PROSITEPS51366MIcoord: 625..755
score: 10.714
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 670..798
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 238..469