Plastin 3

Overview
NamePlastin 3
Smed IDSMED30025105
Length (bp)2318
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Plastin 3 (SMED30025105) t-SNE clustered cells

Violin plots show distribution of expression levels for Plastin 3 (SMED30025105) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Plastin 3 (SMED30025105) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Plastin 3 (SMED30025105) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025105

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025105SMESG000081126.1 SMESG000081113.1 PL06011B1B01ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30025105SMESG000081126.1 SMESG000081113.1 dd_Smed_v4_749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30025105SMESG000081126.1 SMESG000081113.1 dd_Smed_v4_749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025105SMESG000081126.1 SMESG000081113.1 dd_Smed_v4_749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025105SMESG000081126.1 SMESG000081113.1 dd_Smed_v4_749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025105SMESG000081126.1 SMESG000081113.1 dd_Smed_v4_749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025105SMESG000081126.1 SMESG000081113.1 dd_Smed_v4_749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025105SMESG000081126.1 SMESG000081113.1 dd_Smed_v4_749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025105SMESG000081126.1 SMESG000081113.1 dd_Smed_v4_749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025105SMESG000081126.1 SMESG000081113.1 dd_Smed_v4_749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025105SMESG000081127.1 SMESG000081126.1 SMESG000081113.1 Contig29848newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025105SMESG000081127.1 SMESG000081126.1 SMESG000081113.1 Contig29848uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025105SMESG000081126.1 SMESG000081113.1 Contig45838uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025105SMESG000081126.1 SMESG000081113.1 Contig45838newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
central nervous systemSMED30025105SMESG000081126.1 SMESG000081113.1 DN311921ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30025105SMESG000081126.1 SMESG000081113.1 DN311921ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
gutSMED30025105SMESG000081113.1 DN303981ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30025105SMESG000081113.1 DN303981ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
intestinal phagocyteSMED30025105SMESG000081126.1 SMESG000081113.1 dd_Smed_v6_749_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30025105SMESG000081126.1 SMESG000081113.1 dd_Smed_v4_749_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Plastin 3 vs. Ensembl Human
Match: PLS3 (plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091])

HSP 1 Score: 436.802 bits (1122), Expect = 2.250e-143
Identity = 266/630 (42.22%), Postives = 382/630 (60.63%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIK----DVPENLD-KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV--DSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPKKKV-FQILGNCSYVIEYAKK-LNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDII-GWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPL------QDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  + L+EL + F  +    + FI    + E  K    PLPGY+ RE+I+    D   N D KI  + F+ +  +VK S DI +TF  R+ +  +  +  +    E S+   +H+  + E+  F NWI++ L  DP C   +P+    D+L+  + DG++LCK+IN +VPDT+DER +N      + F   ENL LA+NSA AIGC +VNIG ED+  G  HL+LGL+WQ+I+IGL   + L  +  L ALLR+ ETL++L +L+PEELLLRW N+HLE +G  K I NF  DI+DS+ Y HLL QIAP  ++ E  P I I       TD++KRAE ML  A  L  R F+ P DV           KLNLAFVANLFN YPAL    + DI+   +  ET EE+T+RNWMNS+GV P+V  +Y+DL++ LV+LQL + ++ P  V+W K+ +   PK     + L NC+Y +E  K    F++V +   ++ D    + L L +Q++R YT+ +L  +  G+K + DII  W N+    A K++ I SFKD +I++S  ++DLIDAI P  +++ L+ +  L       +AK+ +S ARRIGAR+YALP+ LV+V  KMVMTV+ACLM
Sbjct:    9 ISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKLMLDGDRNKDGKISFDEFVYIFQEVKSS-DIAKTF--RKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKL--TPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQK-INNFSADIKDSKAYFHLLNQIAPKGQK-EGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVP--VDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin 3 vs. Ensembl Human
Match: PLS3 (plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091])

HSP 1 Score: 436.802 bits (1122), Expect = 2.250e-143
Identity = 266/630 (42.22%), Postives = 382/630 (60.63%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIK----DVPENLD-KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV--DSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPKKKV-FQILGNCSYVIEYAKK-LNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDII-GWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPL------QDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  + L+EL + F  +    + FI    + E  K    PLPGY+ RE+I+    D   N D KI  + F+ +  +VK S DI +TF  R+ +  +  +  +    E S+   +H+  + E+  F NWI++ L  DP C   +P+    D+L+  + DG++LCK+IN +VPDT+DER +N      + F   ENL LA+NSA AIGC +VNIG ED+  G  HL+LGL+WQ+I+IGL   + L  +  L ALLR+ ETL++L +L+PEELLLRW N+HLE +G  K I NF  DI+DS+ Y HLL QIAP  ++ E  P I I       TD++KRAE ML  A  L  R F+ P DV           KLNLAFVANLFN YPAL    + DI+   +  ET EE+T+RNWMNS+GV P+V  +Y+DL++ LV+LQL + ++ P  V+W K+ +   PK     + L NC+Y +E  K    F++V +   ++ D    + L L +Q++R YT+ +L  +  G+K + DII  W N+    A K++ I SFKD +I++S  ++DLIDAI P  +++ L+ +  L       +AK+ +S ARRIGAR+YALP+ LV+V  KMVMTV+ACLM
Sbjct:    9 ISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKLMLDGDRNKDGKISFDEFVYIFQEVKSS-DIAKTF--RKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKL--TPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQK-INNFSADIKDSKAYFHLLNQIAPKGQK-EGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVP--VDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin 3 vs. Ensembl Human
Match: LCP1 (lymphocyte cytosolic protein 1 [Source:HGNC Symbol;Acc:HGNC:6528])

HSP 1 Score: 431.409 bits (1108), Expect = 2.404e-141
Identity = 266/630 (42.22%), Postives = 389/630 (61.75%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-----KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKST-HAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV--DSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPK-KKVFQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDII-GWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            +  E + EL + F  +    + +I  + + +  K    PLPGY  RE+ +++    D     +I  + F+ +   +K S D+ +TF  R+ + ++  +  +    E+S+   +H+  + E+  F NWI++ L  DP C   +P+    ++L+N + DG++LCK+IN +VPDT+DER +N      + F   ENL LA+NSA AIGC +VNIG ED+ +G  +L+LGL+WQVI+IGL   + L  +  L+ALLRE E+L+DL +L+PEELLLRW NYHLE AG  K I NF  DI+DS+ Y HLL Q+AP    +E +P + I    L+  D+++RAE ML  A  L  R F+   DV     RG    KLNLAF+ANLFN YPAL    + DI+   +  ET EE+T+RNWMNS+GV P V  +YSDL + LV+ QL + ++ P  V+W ++ +   PK     + L NC+Y +E  K +  F++V +   ++ +    + L L +Q++R YT+ +L ++  G+K + DII  W N+    A K+S ISSFKDP I+TS P+LDLIDAI P S+++ LL  E L D      AK+ IS AR+IGAR+YALP+ LV+VN KMVMTV+ACLM
Sbjct:    6 VSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKIFHGLK-STDVAKTF--RKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCNK-IGNFSTDIKDSKAYYHLLEQVAPKGD-EEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVV----RGN--PKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVP--VDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTLTLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. Ensembl Human
Match: LCP1 (lymphocyte cytosolic protein 1 [Source:HGNC Symbol;Acc:HGNC:6528])

HSP 1 Score: 431.409 bits (1108), Expect = 2.404e-141
Identity = 266/630 (42.22%), Postives = 389/630 (61.75%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-----KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKST-HAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV--DSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPK-KKVFQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDII-GWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            +  E + EL + F  +    + +I  + + +  K    PLPGY  RE+ +++    D     +I  + F+ +   +K S D+ +TF  R+ + ++  +  +    E+S+   +H+  + E+  F NWI++ L  DP C   +P+    ++L+N + DG++LCK+IN +VPDT+DER +N      + F   ENL LA+NSA AIGC +VNIG ED+ +G  +L+LGL+WQVI+IGL   + L  +  L+ALLRE E+L+DL +L+PEELLLRW NYHLE AG  K I NF  DI+DS+ Y HLL Q+AP    +E +P + I    L+  D+++RAE ML  A  L  R F+   DV     RG    KLNLAF+ANLFN YPAL    + DI+   +  ET EE+T+RNWMNS+GV P V  +YSDL + LV+ QL + ++ P  V+W ++ +   PK     + L NC+Y +E  K +  F++V +   ++ +    + L L +Q++R YT+ +L ++  G+K + DII  W N+    A K+S ISSFKDP I+TS P+LDLIDAI P S+++ LL  E L D      AK+ IS AR+IGAR+YALP+ LV+VN KMVMTV+ACLM
Sbjct:    6 VSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKIFHGLK-STDVAKTF--RKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCNK-IGNFSTDIKDSKAYYHLLEQVAPKGD-EEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVV----RGN--PKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVP--VDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTLTLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. Ensembl Human
Match: PLS1 (plastin 1 [Source:HGNC Symbol;Acc:HGNC:9090])

HSP 1 Score: 429.869 bits (1104), Expect = 8.766e-141
Identity = 267/629 (42.45%), Postives = 383/629 (60.89%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-----KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV----DSDIEIRE-ETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPK-KKVFQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  E L EL + F  +      ++    +Q+  K    PLPGY+ RE+++ +    D     KI  E F+ L  ++K SKDI +TF  R+++ +R  +  +      S+   +H+  + E+  F NWI++ L  DP C   +P+    D L+  L DG+LLCK+IN + PDT+DER +N      + F  +ENL LA+NSA AIGC +VNIG  D+ +G  HL+LGL+WQ+I++GL   + +  +  L+ALL E E L++L +L+PEELLLRWVNYHL  AG    I+NF +DI+DS  Y HLL QIAP    D   P I+I    +  T+++KRA LML  A  L  + F+ P DV           KLNLAFVANLFNTYP L      D D+ + E E+ EE+T+RNWMNS+GV PY+  +YSDL + LV+ QL ++++   V W  + +   P      + + NC+Y +E  K K  F++V ++  ++ +    + L L +Q++R YT+ +LS +  G+K +D+ II W N+  ++ANK + ISSFKD SI+TS P+LDLIDAI PN+V  +++  E L D      AK+ IS AR+IGARIYALP  LV+V  KMVMTV+ACLM
Sbjct:    8 ISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILSVADSNKDGKISFEEFVSLMQELK-SKDISKTF--RKIINKREGITAIGGTSTISSEGTQHSYSEEEKVAFVNWINKALENDPDCKHLIPMNPNDDSLFKSLADGILLCKMINLSEPDTIDERAINKKK--LTPFTISENLNLALNSASAIGCTVVNIGASDLKEGKPHLVLGLLWQIIKVGLFADIEISRNEALIALLNEGEELEELMKLSPEELLLRWVNYHLTNAG-WHTISNFSQDIKDSRAYFHLLNQIAPKGGEDG--PAIAIDLSGINETNDLKRAGLMLQEADKLGCKQFVTPADVV------SGNPKLNLAFVANLFNTYPCLHKPNNNDIDMNLLEGESKEERTFRNWMNSLGVNPYINHLYSDLADALVIFQLYEMIRVP-VNWSHVNKPPYPALGGNMKKIENCNYAVELGKNKAKFSLVGIAGQDLNEGNSTLTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLKSANKKTSISSFKDKSISTSLPVLDLIDAIAPNAVRQEMIRRENLSDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLM 621          
BLAST of Plastin 3 vs. Ensembl Celegans
Match: plst-1 (PLaSTin (Actin bundling protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PMA7])

HSP 1 Score: 301.982 bits (772), Expect = 1.678e-95
Identity = 166/360 (46.11%), Postives = 235/360 (65.28%), Query Frame = 2
Query: 1097 LRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALI---VDSDIE-IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKV------LPGKKDDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLL----TNE-PLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDH 2131
            +RWVNYHLE+AG  +R+ NF  DI DSEIY+HLL+QIAP +     L P+ +     N+ RA  ML  A  LD R F+   DVA          KLNLAFVANLFN +P L     D  +E + EET EEKTYRNWMNSMGV PYV  +Y+DL+NG+V+ QL D+++PG+V WK++VR F   + +   + NC+Y +E  K+L F++V +   +I D    + L L +Q++R+YT+ +L++       LP    DKDI+ W N+K + + K++ I SF+DP+I+  K +LDLIDAI PN +D  L+    +NE  + +AK+ I+  R+IGA+IYALP+ +V+V  KMV+TV+ACLM  D+
Sbjct:    1 MRWVNYHLERAGTQRRLHNFTSDIVDSEIYTHLLHQIAP-NGSGVTLSPLGV---HGNVPRAGAMLDEAEKLDCREFVTATDVA------AGNYKLNLAFVANLFNKHPNLPDPGADEVVEDVIEETREEKTYRNWMNSMGVDPYVNWLYADLQNGVVIFQLYDIIRPGMVTWKRVVRTFHKLRGMMDQIQNCNYAVELGKQLRFSLVGIQGKDIYDGNQTLTLALVWQLMRAYTLSVLAQCTQSGDSLPA---DKDIVAWVNEKLKNSGKSTSIRSFQDPAISDGKVVLDLIDAIKPNVIDHSLVKSGKSNEDKMSNAKYAITCGRKIGAKIYALPEDIVEVKPKMVLTVFACLMARDY 347          
BLAST of Plastin 3 vs. Ensembl Celegans
Match: plst-1 (PLaSTin (Actin bundling protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PMA7])

HSP 1 Score: 300.442 bits (768), Expect = 8.042e-95
Identity = 165/363 (45.45%), Postives = 235/363 (64.74%), Query Frame = 2
Query: 1097 LRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPAL-------IVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKV------LPGKKDDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLL----TNE-PLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDH 2131
            +RWVNYHLE+AG  +R+ NF  DI DSEIY+HLL+QIAP +     L P+ +     N+ RA  ML  A  LD R F+   DVA          KLNLAFVANLFN +P L       +  S  ++ EET EEKTYRNWMNSMGV PYV  +Y+DL+NG+V+ QL D+++PG+V WK++VR F   + +   + NC+Y +E  K+L F++V +   +I D    + L L +Q++R+YT+ +L++       LP    DKDI+ W N+K + + K++ I SF+DP+I+  K +LDLIDAI PN +D  L+    +NE  + +AK+ I+  R+IGA+IYALP+ +V+V  KMV+TV+ACLM  D+
Sbjct:    1 MRWVNYHLERAGTQRRLHNFTSDIVDSEIYTHLLHQIAP-NGSGVTLSPLGV---HGNVPRAGAMLDEAEKLDCREFVTATDVA------AGNYKLNLAFVANLFNKHPNLPDPGADEVGFSVEDVIEETREEKTYRNWMNSMGVDPYVNWLYADLQNGVVIFQLYDIIRPGMVTWKRVVRTFHKLRGMMDQIQNCNYAVELGKQLRFSLVGIQGKDIYDGNQTLTLALVWQLMRAYTLSVLAQCTQSGDSLPA---DKDIVAWVNEKLKNSGKSTSIRSFQDPAISDGKVVLDLIDAIKPNVIDHSLVKSGKSNEDKMSNAKYAITCGRKIGAKIYALPEDIVEVKPKMVLTVFACLMARDY 350          
BLAST of Plastin 3 vs. Ensembl Celegans
Match: Y73B3B.1 (pep chromosome:WBcel235:X:209108:211241:-1 gene:WBGene00022223.1 transcript:Y73B3B.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y73B3B.1)

HSP 1 Score: 120.553 bits (301), Expect = 3.011e-29
Identity = 60/144 (41.67%), Postives = 96/144 (66.67%), Query Frame = 2
Query: 1724 NIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKD---DKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLL----TNE-PLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDH 2131
            +I D    + L L +Q++R+YT+ +L++          DKDI+ W N+K + + K++ I SF+DP+I+  K +LDLID+I PN +D  L+    +NE  + +AK+ I+  R+IGA+IYALP+ +V+V  KMV+TV+ACLM  D+
Sbjct:  213 HIYDGNQILTLALVWQLMRAYTLSVLAQYTQSGDSLPTDKDIVAWVNEKLKNSGKSTSIRSFQDPAISDGKVVLDLIDSIKPNVIDHSLVKSGKSNEDKMSNAKYAITCGRKIGAKIYALPEDIVEVKPKMVLTVFACLMARDY 356          
BLAST of Plastin 3 vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 57.3806 bits (137), Expect = 4.293e-8
Identity = 54/168 (32.14%), Postives = 81/168 (48.21%), Query Frame = 2
Query:  851 KKNENLCLAVN---SAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRD-EMLPPISILKNTDN-MKRAELMLGNASILDARVFIEPE 1339
            +K EN+ LA+N   + E I   ++NI    I    K LILGLVW +I          LH++  +  ++E     D K+ TP++ LL W+   L  +G+   I+NF  D  D      L+  +AP    D E   P   L+NT+  MK A+ +L  A ++     I PE
Sbjct:   84 QKLENVSLALNFFQNEENI--KIINIDSTHIVDHNKKLILGLVWTLI----------LHYSISMGWIQEKREDGDNKEETPKQKLLNWIRNRLPVSGMP--ISNFTSDWNDGVALGALVNSMAPGALEDWENWSPNDALENTEKAMKSAQDLLKVAPLIAPAEMIHPE 237          
BLAST of Plastin 3 vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 57.3806 bits (137), Expect = 4.293e-8
Identity = 54/168 (32.14%), Postives = 81/168 (48.21%), Query Frame = 2
Query:  851 KKNENLCLAVN---SAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRD-EMLPPISILKNTDN-MKRAELMLGNASILDARVFIEPE 1339
            +K EN+ LA+N   + E I   ++NI    I    K LILGLVW +I          LH++  +  ++E     D K+ TP++ LL W+   L  +G+   I+NF  D  D      L+  +AP    D E   P   L+NT+  MK A+ +L  A ++     I PE
Sbjct:   84 QKLENVSLALNFFQNEENI--KIINIDSTHIVDHNKKLILGLVWTLI----------LHYSISMGWIQEKREDGDNKEETPKQKLLNWIRNRLPVSGMP--ISNFTSDWNDGVALGALVNSMAPGALEDWENWSPNDALENTEKAMKSAQDLLKVAPLIAPAEMIHPE 237          
BLAST of Plastin 3 vs. Ensembl Fly
Match: Fim (gene:FBgn0024238 transcript:FBtr0074443)

HSP 1 Score: 462.225 bits (1188), Expect = 2.122e-153
Identity = 263/617 (42.63%), Postives = 388/617 (62.88%), Query Frame = 2
Query:  344 LHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELI-----KDVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAK-HTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHD--ELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIR---EETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKD--DKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD-----AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDH 2131
            L +L P+L   KD FI+   +++AL  +GF L GY+ RE+I     K +     K+ +E F  L   +K SKD+  TF  + V+ ++ +++T+      S+    H+V   E+  FS+WI+  L  D      LPI  +   LY  ++DG+LLCK+IN + PDT+DER +N      +V+++ ENL LA+ S++AIGC +VNI   D+ KG  HL+LGL+WQ+IRIGL   + L     L  LL ++E L+DL +++PE +LLRWVN+HLE+AGI++R TNF+ DI DSEIYSHLL QIA  D        +  L+ +D   RAE+ML  A+ L+ R F+ P+DV           KLNLAFVANLFN +P L     IE     EET EEKTYRNWMNSMGV P+V  +YSDL +GLV+ QL D+++PGIV W ++ + F P +K  + L NC+Y ++  K+L F++V ++  ++ D    + L L +Q++R+YT+ +LS++        +K+I+ W N +   A K S++ +F DP+IA  K ++DLIDAI   S++++L+     Q+     AK+ IS AR+IGAR+YALP+ + +V  KMVMTV+AC+M LD+
Sbjct:   20 LEELIPNLDANKDGFIDLHELKDALNQVGFKLAGYQVREMIDEYKGKQLTAFQGKLNLEEFEALCLDLK-SKDVASTF--KTVVSKKENLETLGGMSSISSEGTTHSVRLEEQLAFSDWINSNLGHDKDLQHLLPIDSEGKRLYLSIKDGILLCKIINHSCPDTIDERAINKKN--LTVYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIGLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGISRRCTNFQSDIVDSEIYSHLLKQIAGNDAD----VNLDALRESDLQSRAEIMLQQAAKLNCRSFLTPQDVV------NGVYKLNLAFVANLFNNHPGLDKPEQIEGLESIEETREEKTYRNWMNSMGVAPHVNWLYSDLADGLVIFQLFDVIKPGIVNWSRVHKRFSPLRKFMEKLENCNYAVDLGKQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLANTGNPIIEKEIVQWVNNRLSEAGKQSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMARKIGARVYALPEDITEVKPKMVMTVFACMMALDY 621          
BLAST of Plastin 3 vs. Ensembl Fly
Match: Fim (gene:FBgn0024238 transcript:FBtr0074442)

HSP 1 Score: 459.914 bits (1182), Expect = 8.359e-153
Identity = 259/606 (42.74%), Postives = 382/606 (63.04%), Query Frame = 2
Query:  368 KDEFIERSNIQEALKVLGFPLPGYEFRELI-----KDVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAK-HTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHD--ELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIR---EETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKD--DKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD-----AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDH 2131
            KD FI+   +++AL  +GF L GY+ RE+I     K +     K+ +E F  L   +K SKD+  TF  + V+ ++ +++T+      S+    H+V   E+  FS+WI+  L  D      LPI  +   LY  ++DG+LLCK+IN + PDT+DER +N      +V+++ ENL LA+ S++AIGC +VNI   D+ KG  HL+LGL+WQ+IRIGL   + L     L  LL ++E L+DL +++PE +LLRWVN+HLE+AGI++R TNF+ DI DSEIYSHLL QIA  D        +  L+ +D   RAE+ML  A+ L+ R F+ P+DV           KLNLAFVANLFN +P L     IE     EET EEKTYRNWMNSMGV P+V  +YSDL +GLV+ QL D+++PGIV W ++ + F P +K  + L NC+Y ++  K+L F++V ++  ++ D    + L L +Q++R+YT+ +LS++        +K+I+ W N +   A K S++ +F DP+IA  K ++DLIDAI   S++++L+     Q+     AK+ IS AR+IGAR+YALP+ + +V  KMVMTV+AC+M LD+
Sbjct:    6 KDGFIDLHELKDALNQVGFKLAGYQVREMIDEYKGKQLTAFQGKLNLEEFEALCLDLK-SKDVASTF--KTVVSKKENLETLGGMSSISSEGTTHSVRLEEQLAFSDWINSNLGHDKDLQHLLPIDSEGKRLYLSIKDGILLCKIINHSCPDTIDERAINKKN--LTVYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIGLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGISRRCTNFQSDIVDSEIYSHLLKQIAGNDAD----VNLDALRESDLQSRAEIMLQQAAKLNCRSFLTPQDVV------NGVYKLNLAFVANLFNNHPGLDKPEQIEGLESIEETREEKTYRNWMNSMGVAPHVNWLYSDLADGLVIFQLFDVIKPGIVNWSRVHKRFSPLRKFMEKLENCNYAVDLGKQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLANTGNPIIEKEIVQWVNNRLSEAGKQSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMARKIGARVYALPEDITEVKPKMVMTVFACMMALDY 596          
BLAST of Plastin 3 vs. Ensembl Fly
Match: Fim (gene:FBgn0024238 transcript:FBtr0074441)

HSP 1 Score: 459.529 bits (1181), Expect = 1.905e-152
Identity = 259/606 (42.74%), Postives = 382/606 (63.04%), Query Frame = 2
Query:  368 KDEFIERSNIQEALKVLGFPLPGYEFRELI-----KDVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAK-HTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHD--ELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIR---EETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKD--DKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD-----AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDH 2131
            KD FI+   +++AL  +GF L GY+ RE+I     K +     K+ +E F  L   +K SKD+  TF  + V+ ++ +++T+      S+    H+V   E+  FS+WI+  L  D      LPI  +   LY  ++DG+LLCK+IN + PDT+DER +N      +V+++ ENL LA+ S++AIGC +VNI   D+ KG  HL+LGL+WQ+IRIGL   + L     L  LL ++E L+DL +++PE +LLRWVN+HLE+AGI++R TNF+ DI DSEIYSHLL QIA  D        +  L+ +D   RAE+ML  A+ L+ R F+ P+DV           KLNLAFVANLFN +P L     IE     EET EEKTYRNWMNSMGV P+V  +YSDL +GLV+ QL D+++PGIV W ++ + F P +K  + L NC+Y ++  K+L F++V ++  ++ D    + L L +Q++R+YT+ +LS++        +K+I+ W N +   A K S++ +F DP+IA  K ++DLIDAI   S++++L+     Q+     AK+ IS AR+IGAR+YALP+ + +V  KMVMTV+AC+M LD+
Sbjct:   30 KDGFIDLHELKDALNQVGFKLAGYQVREMIDEYKGKQLTAFQGKLNLEEFEALCLDLK-SKDVASTF--KTVVSKKENLETLGGMSSISSEGTTHSVRLEEQLAFSDWINSNLGHDKDLQHLLPIDSEGKRLYLSIKDGILLCKIINHSCPDTIDERAINKKN--LTVYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIGLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGISRRCTNFQSDIVDSEIYSHLLKQIAGNDAD----VNLDALRESDLQSRAEIMLQQAAKLNCRSFLTPQDVV------NGVYKLNLAFVANLFNNHPGLDKPEQIEGLESIEETREEKTYRNWMNSMGVAPHVNWLYSDLADGLVIFQLFDVIKPGIVNWSRVHKRFSPLRKFMEKLENCNYAVDLGKQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLANTGNPIIEKEIVQWVNNRLSEAGKQSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMARKIGARVYALPEDITEVKPKMVMTVFACMMALDY 620          
BLAST of Plastin 3 vs. Ensembl Zebrafish
Match: pls1 (plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-030131-6205])

HSP 1 Score: 446.432 bits (1147), Expect = 2.045e-147
Identity = 265/634 (41.80%), Postives = 389/634 (61.36%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIK-----DVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPI--KHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAP-ADKRDEMLPPISILKNT--DNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDS----DIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPKKKVFQILG-------NCSYVIEYAKK-LNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTN------EPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  E L +L + F  +      ++    +QE  +   F LPGY+ RE+++     D  ++ +KI  E F+ +  +++ SK++  TF  R+ +  R  +++       S+   +H+  D E+  F NW+++ L+ DP C   +P+    D L+  ++DG+LLCK+IN + PDT+DERV+N   +    F   ENL LA+NSA AIGC +VNI  +D+  GT HL+LGL+WQ+I+IGL   + +  +  L+ALL E E LD L  ++PE+LLLRWVNYHL+ AG  K+I NF EDI+DS  Y HLL QI+P  D  D+M   I +L  T  D+  RAELML  A+ LD R F+ P+DV           KLN+AFVANLFN YPAL   +    D  I  ET E++T+RNWMNS+GV+PYV  +YSDL +GL++LQL + +Q P  V+W ++       K  + +LG       NC+Y +   KK   F++V +  +NI + +P   L L +Q++R YT+K+LS +  G+K  D+ II W N   +  +K S ISSFKD SI+TS P++DLID IVP ++ ++++ +      + L +AK+ IS AR+IG ++YALP  LV+V  KMVMTV+ACLM
Sbjct:    8 ISREDLEDLREAFNKIDIDNSGYVSDFELQELFREASFHLPGYQIREIVEKFIAGDTNKD-EKISFEEFVAISQELR-SKEVRETF--RKCISRRDGIRSFGGTSGISSEGTQHSYSDEEKVAFVNWVNKALANDPDCKHLIPMDPGTDSLFKSVKDGILLCKMINLSQPDTIDERVINKKCT---PFTMTENLMLALNSASAIGCTVVNIDAQDMKAGTPHLVLGLLWQIIKIGLFADIEISRNEALIALLDESEELDHLMSMSPEDLLLRWVNYHLKAAG-WKQIRNFSEDIKDSRAYFHLLNQISPKGDLDDQMRIDIDMLGLTERDDEMRAELMLRQAARLDCRQFVTPKDVV------AGNHKLNMAFVANLFNMYPALNRPTDNGIDYAIEGETREDRTFRNWMNSLGVSPYVNHLYSDLHDGLIILQLYERIQIP--VDWPRV------NKPPYPVLGSNMKKLENCNYAVALGKKEAKFSLVGIGGENINEGSPMHTLALVWQLMRRYTLKVLSDLGDGEKVSDQIIINWVNSTLKQGDKNSSISSFKDKSISTSLPVIDLIDTIVPKAIKYEMVKSGDMTAEDKLNNAKYAISVARKIGVKVYALPDDLVEVKPKMVMTVFACLM 619          
BLAST of Plastin 3 vs. Ensembl Zebrafish
Match: pls1 (plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-030131-6205])

HSP 1 Score: 446.047 bits (1146), Expect = 1.070e-146
Identity = 265/634 (41.80%), Postives = 389/634 (61.36%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIK-----DVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPI--KHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAP-ADKRDEMLPPISILKNT--DNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDS----DIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPKKKVFQILG-------NCSYVIEYAKK-LNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTN------EPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  E L +L + F  +      ++    +QE  +   F LPGY+ RE+++     D  ++ +KI  E F+ +  +++ SK++  TF  R+ +  R  +++       S+   +H+  D E+  F NW+++ L+ DP C   +P+    D L+  ++DG+LLCK+IN + PDT+DERV+N   +    F   ENL LA+NSA AIGC +VNI  +D+  GT HL+LGL+WQ+I+IGL   + +  +  L+ALL E E LD L  ++PE+LLLRWVNYHL+ AG  K+I NF EDI+DS  Y HLL QI+P  D  D+M   I +L  T  D+  RAELML  A+ LD R F+ P+DV           KLN+AFVANLFN YPAL   +    D  I  ET E++T+RNWMNS+GV+PYV  +YSDL +GL++LQL + +Q P  V+W ++       K  + +LG       NC+Y +   KK   F++V +  +NI + +P   L L +Q++R YT+K+LS +  G+K  D+ II W N   +  +K S ISSFKD SI+TS P++DLID IVP ++ ++++ +      + L +AK+ IS AR+IG ++YALP  LV+V  KMVMTV+ACLM
Sbjct:   45 ISREDLEDLREAFNKIDIDNSGYVSDFELQELFREASFHLPGYQIREIVEKFIAGDTNKD-EKISFEEFVAISQELR-SKEVRETF--RKCISRRDGIRSFGGTSGISSEGTQHSYSDEEKVAFVNWVNKALANDPDCKHLIPMDPGTDSLFKSVKDGILLCKMINLSQPDTIDERVINKKCT---PFTMTENLMLALNSASAIGCTVVNIDAQDMKAGTPHLVLGLLWQIIKIGLFADIEISRNEALIALLDESEELDHLMSMSPEDLLLRWVNYHLKAAG-WKQIRNFSEDIKDSRAYFHLLNQISPKGDLDDQMRIDIDMLGLTERDDEMRAELMLRQAARLDCRQFVTPKDVV------AGNHKLNMAFVANLFNMYPALNRPTDNGIDYAIEGETREDRTFRNWMNSLGVSPYVNHLYSDLHDGLIILQLYERIQIP--VDWPRV------NKPPYPVLGSNMKKLENCNYAVALGKKEAKFSLVGIGGENINEGSPMHTLALVWQLMRRYTLKVLSDLGDGEKVSDQIIINWVNSTLKQGDKNSSISSFKDKSISTSLPVIDLIDTIVPKAIKYEMVKSGDMTAEDKLNNAKYAISVARKIGVKVYALPDDLVEVKPKMVMTVFACLM 656          
BLAST of Plastin 3 vs. Ensembl Zebrafish
Match: pls3 (plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-040718-10])

HSP 1 Score: 437.573 bits (1124), Expect = 5.716e-144
Identity = 266/630 (42.22%), Postives = 377/630 (59.84%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDK-----IPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDE-KSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRD---EMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEI-----REETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEW-KKIVRVFDPKKKV-FQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  E L EL + F  +    + FI    + +  K    PLPGY+ RE+I+ + E  DK     I  + F+ +  ++K S DI ++F  R+ +  +  +  +    E  S   +H+  + E   F NWI+  L  DP C   LP+    D L+  + DG++LCK+IN +VPDT+DER +N      + F   ENL LA+NSA AIGC +VNIG  D+ +G  HL+LGL+WQ+I+IGL   + L  +  L ALLR+ ETL+DL +L+PEELLLRW N+HLE AG +K I NF  DI+DS  Y HLL QIAP  ++D    +   +S     D++KRAE ML  A  L  R F+   DV           KLNLAFVANLFN YPAL    + +I       ET EE+T+RNWMNS+GV P+V  +Y DL++ LV+LQL + ++ P  V+W  K+ +   PK     + L NC+Y +E  K K NF++V +   ++ D  P + L L +Q++R YT+ +L  +  G+K +D  I+ W NK    A K++KIS+FKD  I++S  +LDLIDAI P+S+++ L+    L D      AK+ +S AR+IGAR+YALP+ LV+V  KMVMTV+ACLM
Sbjct:    5 ISKEELEELREAFGKVDLNGNGFICDHELHDLFKEANLPLPGYKVREIIQKLMEEGDKNKDNMISFDEFVSIFQELK-SGDIAKSF--RKAINRKEGILAIGGTSELSSAGTQHSFSEEERFAFVNWINTALEHDPDCKHKLPMNPNTDALFKAVGDGIVLCKMINLSVPDTIDERTINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGALDLREGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGWSK-INNFSHDIKDSRAYFHLLNQIAPKGQKDGESRIDIDMSGFTEKDDLKRAECMLLQADKLGCRQFVTSTDVM------SGNPKLNLAFVANLFNKYPALTKPENQDINWGLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYEKIKVP--VDWNNKVNKPPYPKLGANMKKLENCNYAVELGKTKANFSLVGIGGQDLNDGNPTLTLALVWQLMRRYTLNVLENLGDGQKVNDDVIVSWVNKTLSQAGKSTKISNFKDKEISSSLAVLDLIDAIQPSSINYDLVKRGSLSDGDKLDNAKYAVSMARKIGARVYALPEDLVEVKPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. Ensembl Zebrafish
Match: pls3 (plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-040718-10])

HSP 1 Score: 437.573 bits (1124), Expect = 5.716e-144
Identity = 266/630 (42.22%), Postives = 377/630 (59.84%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDK-----IPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDE-KSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRD---EMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEI-----REETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEW-KKIVRVFDPKKKV-FQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  E L EL + F  +    + FI    + +  K    PLPGY+ RE+I+ + E  DK     I  + F+ +  ++K S DI ++F  R+ +  +  +  +    E  S   +H+  + E   F NWI+  L  DP C   LP+    D L+  + DG++LCK+IN +VPDT+DER +N      + F   ENL LA+NSA AIGC +VNIG  D+ +G  HL+LGL+WQ+I+IGL   + L  +  L ALLR+ ETL+DL +L+PEELLLRW N+HLE AG +K I NF  DI+DS  Y HLL QIAP  ++D    +   +S     D++KRAE ML  A  L  R F+   DV           KLNLAFVANLFN YPAL    + +I       ET EE+T+RNWMNS+GV P+V  +Y DL++ LV+LQL + ++ P  V+W  K+ +   PK     + L NC+Y +E  K K NF++V +   ++ D  P + L L +Q++R YT+ +L  +  G+K +D  I+ W NK    A K++KIS+FKD  I++S  +LDLIDAI P+S+++ L+    L D      AK+ +S AR+IGAR+YALP+ LV+V  KMVMTV+ACLM
Sbjct:    5 ISKEELEELREAFGKVDLNGNGFICDHELHDLFKEANLPLPGYKVREIIQKLMEEGDKNKDNMISFDEFVSIFQELK-SGDIAKSF--RKAINRKEGILAIGGTSELSSAGTQHSFSEEERFAFVNWINTALEHDPDCKHKLPMNPNTDALFKAVGDGIVLCKMINLSVPDTIDERTINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGALDLREGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGWSK-INNFSHDIKDSRAYFHLLNQIAPKGQKDGESRIDIDMSGFTEKDDLKRAECMLLQADKLGCRQFVTSTDVM------SGNPKLNLAFVANLFNKYPALTKPENQDINWGLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYEKIKVP--VDWNNKVNKPPYPKLGANMKKLENCNYAVELGKTKANFSLVGIGGQDLNDGNPTLTLALVWQLMRRYTLNVLENLGDGQKVNDDVIVSWVNKTLSQAGKSTKISNFKDKEISSSLAVLDLIDAIQPSSINYDLVKRGSLSDGDKLDNAKYAVSMARKIGARVYALPEDLVEVKPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. Ensembl Zebrafish
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:NCBI gene;Acc:30583])

HSP 1 Score: 435.647 bits (1119), Expect = 2.752e-143
Identity = 264/628 (42.04%), Postives = 383/628 (60.99%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-----KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPI--KHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV--DSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPK-KKVFQILGNCSYVIEYAKK-LNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  E + EL + F  +    +  I    +    K    PLPGY  RE+I+++   +D     KI  + F  +   +K S ++ +TF  R+ + ++  + +V    E+S   +H+  + E+  F NW+++ L KDP C   LP+    D+L+  + DG++LCK+IN +VPDT+DER +N      + F   ENL LA+NSA AIGC +VNIG ED+ +G +HL+LGL+WQVI+IGL   + +  +  L+ALLR+ E+L+DL +L+PEELLLRW NYHLE+AG  K I NF  DI+DS+ Y ++L Q+AP    +E +P I I    ++  D++KRAE ML  A  L  R F+   DV     RG    KLNLA+VANLFN YPAL    + DI+   I  ET EE+T+RNWMNS+GV P V  +Y DL + LV+ QL + ++   V+W K+ +   PK     + L NC+Y +E  KK   F++V ++  ++ +    + L L +Q++R YT+ +L  +  G+K  D+ I+ W N+    A K + IS FKD SI++S P+LDLIDAI P S+ + LL  E L D      AK+ IS AR+IGAR+YALP+ LV+V  KMVMTV+ACLM
Sbjct:    6 ISAEEMEELREAFTKVDVDGNGHISTDELNALFKAANLPLPGYRVREIIQEISRTMDLNQDGKITFDEFAKVVHDLK-SSEVAKTF--RKAINKKEGICSVAGTSEQSG-TQHSYSEEEKVAFVNWVNKALEKDPDCQHVLPMDPSTDDLFTAVGDGIVLCKMINLSVPDTIDERTINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIEISRNEALIALLRDGESLEDLVKLSPEELLLRWANYHLEEAGCPK-INNFSSDIKDSKAYYNILNQVAPKGD-EEGIPAIPIDISGIREKDDLKRAECMLEQADRLGCRQFVTATDVV----RGN--PKLNLAYVANLFNKYPALKKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYVDLADALVIFQLYEKIKVP-VDWDKVNKPPYPKLGSNMKKLENCNYAVELGKKEAKFSLVGIAGQDLNEGNRTLTLALLWQLMRRYTLNILEDLGDGQKIIDETIVQWVNETLTQAGKGT-ISGFKDGSISSSMPVLDLIDAIQPGSIRYDLLKAEDLTDEEKLNNAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLM 617          
BLAST of Plastin 3 vs. Ensembl Xenopus
Match: snx5 (sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018])

HSP 1 Score: 439.113 bits (1128), Expect = 2.107e-144
Identity = 259/610 (42.46%), Postives = 376/610 (61.64%), Query Frame = 2
Query:  377 FIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-----KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV--DSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPKKKV---FQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLT------NEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            FI  + + +  K    PLPGY  RE+I+D  E  D     KI  + F  +   +K S D+ +TF  R+ + ++  +  +    E+S+   +H+  + E   F NW+++ L KD  C   +P+    D+L+  + DG++LCK+IN +V +T+DER +N      + F   ENL LA+NSA AIGC +VNIG ED+ +G  HL+LGL+WQVI+IGL   + L  +  L+ALL++ E+L+DL +L+PEELLLRW NYHLE AG  K I NF  DI+DS+ Y HLL Q+AP    +E +P I I    L+  +++KRAE ML     L  R F+   DV     RG    KLNLAF+ANLFN YPAL    + DI+   I  ET EE+T+RNWMNS+GV P V  +YSDL + LV+ QL + ++ P  V+W ++ +   P  K+    + + NC+Y ++  K K  F++V ++  ++K+    + L L +Q++R YT+ +L  +  G+K +D+ I+ W N+  + A K S ISSFKDP I+TS P+LDLIDAI P  +++ LL        E L +AK+ IS AR++GAR+YALP  LV+V  KMVMTV+ACLM
Sbjct:   29 FISLNELNDLFKAANLPLPGYRLREIIQDFMETGDSNKDGKISFDEFTTVFHNLKSS-DVAKTF--RKAINKKEGICAIGGTSEQSSAGTQHSYSEEENYAFVNWVNKALEKDQDCKHVIPMNPDTDDLFKAVGDGIVLCKMINLSVAETIDERAINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPHLVLGLLWQVIKIGLFADIELSRNEALIALLKDGESLEDLMKLSPEELLLRWANYHLENAGCNK-INNFSSDIKDSKAYYHLLNQVAPKGD-EEGIPAIDIDMTGLREKEDLKRAECMLLQTEKLGCRQFVTATDVV----RGN--PKLNLAFIANLFNKYPALHKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVP--VDWNRVNK--PPYSKLGENMKKIENCNYAVDLGKNKAKFSLVGIAGQDLKEGNHTLTLALLWQLMRRYTLNILEDIGGGQKVNDETILTWVNETLKEAEKCSSISSFKDPKISTSMPVLDLIDAIQPGCINYDLLKTEDLDETEKLNNAKYAISMARKVGARVYALPDDLVEVKPKMVMTVFACLM 621          
BLAST of Plastin 3 vs. Ensembl Xenopus
Match: snx5 (sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018])

HSP 1 Score: 438.728 bits (1127), Expect = 2.441e-144
Identity = 259/610 (42.46%), Postives = 376/610 (61.64%), Query Frame = 2
Query:  377 FIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-----KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV--DSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPKKKV---FQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLT------NEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            FI  + + +  K    PLPGY  RE+I+D  E  D     KI  + F  +   +K S D+ +TF  R+ + ++  +  +    E+S+   +H+  + E   F NW+++ L KD  C   +P+    D+L+  + DG++LCK+IN +V +T+DER +N      + F   ENL LA+NSA AIGC +VNIG ED+ +G  HL+LGL+WQVI+IGL   + L  +  L+ALL++ E+L+DL +L+PEELLLRW NYHLE AG  K I NF  DI+DS+ Y HLL Q+AP    +E +P I I    L+  +++KRAE ML     L  R F+   DV     RG    KLNLAF+ANLFN YPAL    + DI+   I  ET EE+T+RNWMNS+GV P V  +YSDL + LV+ QL + ++ P  V+W ++ +   P  K+    + + NC+Y ++  K K  F++V ++  ++K+    + L L +Q++R YT+ +L  +  G+K +D+ I+ W N+  + A K S ISSFKDP I+TS P+LDLIDAI P  +++ LL        E L +AK+ IS AR++GAR+YALP  LV+V  KMVMTV+ACLM
Sbjct:   24 FISLNELNDLFKAANLPLPGYRLREIIQDFMETGDSNKDGKISFDEFTTVFHNLKSS-DVAKTF--RKAINKKEGICAIGGTSEQSSAGTQHSYSEEENYAFVNWVNKALEKDQDCKHVIPMNPDTDDLFKAVGDGIVLCKMINLSVAETIDERAINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPHLVLGLLWQVIKIGLFADIELSRNEALIALLKDGESLEDLMKLSPEELLLRWANYHLENAGCNK-INNFSSDIKDSKAYYHLLNQVAPKGD-EEGIPAIDIDMTGLREKEDLKRAECMLLQTEKLGCRQFVTATDVV----RGN--PKLNLAFIANLFNKYPALHKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVP--VDWNRVNK--PPYSKLGENMKKIENCNYAVDLGKNKAKFSLVGIAGQDLKEGNHTLTLALLWQLMRRYTLNILEDIGGGQKVNDETILTWVNETLKEAEKCSSISSFKDPKISTSMPVLDLIDAIQPGCINYDLLKTEDLDETEKLNNAKYAISMARKVGARVYALPDDLVEVKPKMVMTVFACLM 616          
BLAST of Plastin 3 vs. Ensembl Xenopus
Match: snx5 (sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018])

HSP 1 Score: 439.113 bits (1128), Expect = 2.443e-144
Identity = 259/610 (42.46%), Postives = 376/610 (61.64%), Query Frame = 2
Query:  377 FIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-----KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV--DSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPKKKV---FQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLT------NEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            FI  + + +  K    PLPGY  RE+I+D  E  D     KI  + F  +   +K S D+ +TF  R+ + ++  +  +    E+S+   +H+  + E   F NW+++ L KD  C   +P+    D+L+  + DG++LCK+IN +V +T+DER +N      + F   ENL LA+NSA AIGC +VNIG ED+ +G  HL+LGL+WQVI+IGL   + L  +  L+ALL++ E+L+DL +L+PEELLLRW NYHLE AG  K I NF  DI+DS+ Y HLL Q+AP    +E +P I I    L+  +++KRAE ML     L  R F+   DV     RG    KLNLAF+ANLFN YPAL    + DI+   I  ET EE+T+RNWMNS+GV P V  +YSDL + LV+ QL + ++ P  V+W ++ +   P  K+    + + NC+Y ++  K K  F++V ++  ++K+    + L L +Q++R YT+ +L  +  G+K +D+ I+ W N+  + A K S ISSFKDP I+TS P+LDLIDAI P  +++ LL        E L +AK+ IS AR++GAR+YALP  LV+V  KMVMTV+ACLM
Sbjct:   37 FISLNELNDLFKAANLPLPGYRLREIIQDFMETGDSNKDGKISFDEFTTVFHNLKSS-DVAKTF--RKAINKKEGICAIGGTSEQSSAGTQHSYSEEENYAFVNWVNKALEKDQDCKHVIPMNPDTDDLFKAVGDGIVLCKMINLSVAETIDERAINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPHLVLGLLWQVIKIGLFADIELSRNEALIALLKDGESLEDLMKLSPEELLLRWANYHLENAGCNK-INNFSSDIKDSKAYYHLLNQVAPKGD-EEGIPAIDIDMTGLREKEDLKRAECMLLQTEKLGCRQFVTATDVV----RGN--PKLNLAFIANLFNKYPALHKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVP--VDWNRVNK--PPYSKLGENMKKIENCNYAVDLGKNKAKFSLVGIAGQDLKEGNHTLTLALLWQLMRRYTLNILEDIGGGQKVNDETILTWVNETLKEAEKCSSISSFKDPKISTSMPVLDLIDAIQPGCINYDLLKTEDLDETEKLNNAKYAISMARKVGARVYALPDDLVEVKPKMVMTVFACLM 629          
BLAST of Plastin 3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 437.573 bits (1124), Expect = 1.153e-143
Identity = 267/629 (42.45%), Postives = 382/629 (60.73%), Query Frame = 2
Query:  320 IETETLNELHDLFPSLKDE---FIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDK-----IPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKR---DEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALI--VDSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKV-FQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKL------LTNE-PLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  + L EL + F  +  +   +I    + +  K    PLPGY+ RE+I+ +  + DK     I  E F+ L  ++K S DI +TF  R+ +  +  +  +    E S+   +H+  + E+  F NWI++ L  DP C   LP+    ++L+  + DG++LCK+IN +VPDT+DERV+N      + F   ENL LA+NSA AIGC +VNIG ED+  G  HL LGL+WQVI+IGL   + L  +  L ALLR+ ETL+DL +L+PEELLLRW N+HLE AG  K I+NF  DI+DS  Y HLL QIAP  ++   + +   +S     D++KRAE ML  A  L  R F+ P DV           KLNLAFVANLFN YPAL   V+ DI+   +  ET EE+T+RNWMNS+GV P+V  +Y+DL++ LV+LQL D ++   V+W K+ +   PK     + L NC+Y +E  K    F++V +   ++ D  P + L L +Q++R YT+ +L  +  G+K +D+ I+ W N+    A K + I +FKD +I TS  ++DLIDAI P  ++++L      LT+E   ++AK+ IS ARRIG RIYALP+ LV+V  KMVMTV+ACLM
Sbjct:    9 ISKDDLEELREAFARIDTDDSGYISDYELHDLFKEANLPLPGYKVREIIQKLMNDGDKNKDGKICFEEFVFLVQELKSS-DIAKTF--RKAINRKEGICAIGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCKHVLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGAEDLKAGKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGWQK-ISNFSSDIKDSRAYFHLLNQIAPKGQKEGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVV------SGNPKLNLAFVANLFNKYPALTKPVNQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYNDLQDALVILQLYDKIKVP-VDWNKVNKPPYPKLGANMKKLENCNYAVELGKYPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRRYTLNVLECLGEGQKVNDEIIVNWVNRTLADAGKKTSIQNFKDKTICTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLVEVKPKMVMTVFACLM 624          
BLAST of Plastin 3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 435.647 bits (1119), Expect = 6.028e-143
Identity = 262/607 (43.16%), Postives = 373/607 (61.45%), Query Frame = 2
Query:  377 FIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDK-----IPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKR---DEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALI--VDSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKV-FQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKL------LTNE-PLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            +I    + +  K    PLPGY+ RE+I+ +  + DK     I  E F+ L  ++K S DI +TF  R+ +  +  +  +    E S+   +H+  + E+  F NWI++ L  DP C   LP+    ++L+  + DG++LCK+IN +VPDT+DERV+N      + F   ENL LA+NSA AIGC +VNIG ED+  G  HL LGL+WQVI+IGL   + L  +  L ALLR+ ETL+DL +L+PEELLLRW N+HLE AG  K I+NF  DI+DS  Y HLL QIAP  ++   + +   +S     D++KRAE ML  A  L  R F+ P DV           KLNLAFVANLFN YPAL   V+ DI+   +  ET EE+T+RNWMNS+GV P+V  +Y+DL++ LV+LQL D ++   V+W K+ +   PK     + L NC+Y +E  K    F++V +   ++ D  P + L L +Q++R YT+ +L  +  G+K +D+ I+ W N+    A K + I +FKD +I TS  ++DLIDAI P  ++++L      LT+E   ++AK+ IS ARRIG RIYALP+ LV+V  KMVMTV+ACLM
Sbjct:   30 YISDYELHDLFKEANLPLPGYKVREIIQKLMNDGDKNKDGKICFEEFVFLVQELKSS-DIAKTF--RKAINRKEGICAIGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCKHVLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGAEDLKAGKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGWQK-ISNFSSDIKDSRAYFHLLNQIAPKGQKEGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVV------SGNPKLNLAFVANLFNKYPALTKPVNQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYNDLQDALVILQLYDKIKVP-VDWNKVNKPPYPKLGANMKKLENCNYAVELGKYPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRRYTLNVLECLGEGQKVNDEIIVNWVNRTLADAGKKTSIQNFKDKTICTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin 3 vs. Ensembl Mouse
Match: Lcp1 (lymphocyte cytosolic protein 1 [Source:MGI Symbol;Acc:MGI:104808])

HSP 1 Score: 450.669 bits (1158), Expect = 5.788e-149
Identity = 267/630 (42.38%), Postives = 391/630 (62.06%), Query Frame = 2
Query:  320 IETETLNELHDLFPSLKDE---FIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-----KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKST-HAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPAL--IVDSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPK-KKVFQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDII-GWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            +  E + EL + F  +  +   +I  + + +  K    PLPGY  RE+ +++    D     KI  + F+ +   +K S ++ +TF  R+ + ++  +  +    E+S+   +H+  + E+  F NWI++ L  DP C   +P+    D+L+N + DG++LCK+IN +VPDT+DER +N      + F   ENL LA+NSA AIGC +VNIG ED+ +G  +L+LGL+WQVI+IGL   + L  +  L+ALLRE E+L+DL +L+PEELLLRW NYHLE AG TK ITNF  DI+DS+ Y HLL Q+AP    +E +P + I    L+  D+++RAE ML  A  L  R F+   DV     RG    KLNLAF+ANLFN YPAL    + DI+   +  ET EE+T+RNWMNS+GV P V  +YSDL + LV+ QL + ++ P  V+W ++ +   PK     + L NC+Y ++  K +  F++V ++  ++ +    + L L +Q++R YT+ +L  +  G+K + DII  W N   + A K+S I+SFKDP I+TS P+LDLIDAI P S+++ LL  E L D      AK+ IS AR+IGAR+YALP+ LV+VN KMVMTV+ACLM
Sbjct:    6 VSDEEMMELREAFAKVDTDGNGYISCNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGKISFDEFIKVFHGLK-STEVAKTF--RKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCTK-ITNFSTDIKDSKAYYHLLEQVAPKGD-EEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVV----RGN--PKLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVP--VDWNRVNKPPYPKLGGNMKKLENCNYAVDLGKNQAKFSLVGIAGQDLNEGNRTLTLALVWQLMRRYTLNILEDIGGGQKVNDDIIVNWVNTTLKEAQKSSSIASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. Ensembl Mouse
Match: Lcp1 (lymphocyte cytosolic protein 1 [Source:MGI Symbol;Acc:MGI:104808])

HSP 1 Score: 450.669 bits (1158), Expect = 5.788e-149
Identity = 267/630 (42.38%), Postives = 391/630 (62.06%), Query Frame = 2
Query:  320 IETETLNELHDLFPSLKDE---FIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-----KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKST-HAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPAL--IVDSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPK-KKVFQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDII-GWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            +  E + EL + F  +  +   +I  + + +  K    PLPGY  RE+ +++    D     KI  + F+ +   +K S ++ +TF  R+ + ++  +  +    E+S+   +H+  + E+  F NWI++ L  DP C   +P+    D+L+N + DG++LCK+IN +VPDT+DER +N      + F   ENL LA+NSA AIGC +VNIG ED+ +G  +L+LGL+WQVI+IGL   + L  +  L+ALLRE E+L+DL +L+PEELLLRW NYHLE AG TK ITNF  DI+DS+ Y HLL Q+AP    +E +P + I    L+  D+++RAE ML  A  L  R F+   DV     RG    KLNLAF+ANLFN YPAL    + DI+   +  ET EE+T+RNWMNS+GV P V  +YSDL + LV+ QL + ++ P  V+W ++ +   PK     + L NC+Y ++  K +  F++V ++  ++ +    + L L +Q++R YT+ +L  +  G+K + DII  W N   + A K+S I+SFKDP I+TS P+LDLIDAI P S+++ LL  E L D      AK+ IS AR+IGAR+YALP+ LV+VN KMVMTV+ACLM
Sbjct:    6 VSDEEMMELREAFAKVDTDGNGYISCNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGKISFDEFIKVFHGLK-STEVAKTF--RKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCTK-ITNFSTDIKDSKAYYHLLEQVAPKGD-EEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVV----RGN--PKLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVP--VDWNRVNKPPYPKLGGNMKKLENCNYAVDLGKNQAKFSLVGIAGQDLNEGNRTLTLALVWQLMRRYTLNILEDIGGGQKVNDDIIVNWVNTTLKEAQKSSSIASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. Ensembl Mouse
Match: Lcp1 (lymphocyte cytosolic protein 1 [Source:MGI Symbol;Acc:MGI:104808])

HSP 1 Score: 450.669 bits (1158), Expect = 5.788e-149
Identity = 267/630 (42.38%), Postives = 391/630 (62.06%), Query Frame = 2
Query:  320 IETETLNELHDLFPSLKDE---FIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-----KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKST-HAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPAL--IVDSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPK-KKVFQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDII-GWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            +  E + EL + F  +  +   +I  + + +  K    PLPGY  RE+ +++    D     KI  + F+ +   +K S ++ +TF  R+ + ++  +  +    E+S+   +H+  + E+  F NWI++ L  DP C   +P+    D+L+N + DG++LCK+IN +VPDT+DER +N      + F   ENL LA+NSA AIGC +VNIG ED+ +G  +L+LGL+WQVI+IGL   + L  +  L+ALLRE E+L+DL +L+PEELLLRW NYHLE AG TK ITNF  DI+DS+ Y HLL Q+AP    +E +P + I    L+  D+++RAE ML  A  L  R F+   DV     RG    KLNLAF+ANLFN YPAL    + DI+   +  ET EE+T+RNWMNS+GV P V  +YSDL + LV+ QL + ++ P  V+W ++ +   PK     + L NC+Y ++  K +  F++V ++  ++ +    + L L +Q++R YT+ +L  +  G+K + DII  W N   + A K+S I+SFKDP I+TS P+LDLIDAI P S+++ LL  E L D      AK+ IS AR+IGAR+YALP+ LV+VN KMVMTV+ACLM
Sbjct:    6 VSDEEMMELREAFAKVDTDGNGYISCNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGKISFDEFIKVFHGLK-STEVAKTF--RKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCTK-ITNFSTDIKDSKAYYHLLEQVAPKGD-EEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVV----RGN--PKLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVP--VDWNRVNKPPYPKLGGNMKKLENCNYAVDLGKNQAKFSLVGIAGQDLNEGNRTLTLALVWQLMRRYTLNILEDIGGGQKVNDDIIVNWVNTTLKEAQKSSSIASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. Ensembl Mouse
Match: Pls1 (plastin 1 (I-isoform) [Source:MGI Symbol;Acc:MGI:104809])

HSP 1 Score: 444.506 bits (1142), Expect = 1.640e-146
Identity = 265/629 (42.13%), Postives = 388/629 (61.69%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIKDV----PENLD-KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHDE--LYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV----DSDIEIRE-ETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPK-KKVFQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKD-IIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  E L EL + F  +      ++    +Q+  K    PLPGY+ RE+++ +      N D KI  E F+ L  ++K SKDI +TF  R+++ +R  +  +      S+   +H+  + E+  F NWI++ L  D  C+  LP+  ++  L+  L DG+LLCK+IN + PDT+DER +N      + F  +ENL LA+NSA AIGC +VNIG +D+ +G  HL+LGL+WQ+I++GL   + +  +  L+ALL++ E L++L +L+PEELLLRWVNYHL  AG  + I NF +DI+DS+ Y HLL QIAP   RD+  P ++I        +++KRA  ML  A  L  R F+ P DV           KLNLAFVANLFNTYP L      D D+ + E E+ EE+T+RNWMNS+GV PY+  +YSDL + LV+ QL ++++   V W ++ +   P      + + NC+Y +E  K +  F++V ++  ++ +    + L L +Q++R YT+K+LS +  G+K   D II W N+  ++ANK++ ISSFKD SI+TS P+LDLIDAI PN+V  +++  E L D      AK+ IS AR+IGARIYALP  LV+V  KMVMTV+ACLM
Sbjct:    8 ISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILVVADNNKDGKISFEEFVSLMQELK-SKDISKTF--RKIINKREGITAIGGTSSISSEGTQHSYSEEEKVAFVNWINKALENDADCSHLLPMNPNDGSLFKSLADGILLCKMINLSEPDTIDERAINKKKL--TPFTVSENLNLALNSASAIGCTVVNIGAQDLKEGKPHLVLGLLWQIIKVGLFADIEISRNEALIALLKDGEDLEELMKLSPEELLLRWVNYHLTNAG-WRTINNFSQDIKDSKAYFHLLNQIAPKGDRDDG-PAVAIDLSGFNEKNDLKRAGFMLQEADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNTYPCLHKPDNNDIDLNLLEGESKEERTFRNWMNSLGVNPYINHLYSDLADALVIFQLYEMIRVP-VNWSQVNKPPYPALGGNMKKIENCNYAVELGKNEAKFSLVGIAGQDLNEGNATLTLALVWQLMRRYTLKVLSDLGEGEKVTDDIIIKWVNQTLKSANKSTSISSFKDKSISTSLPVLDLIDAIAPNAVRQEMIKREHLTDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLM 622          
BLAST of Plastin 3 vs. Ensembl Mouse
Match: Pls3 (plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:104807])

HSP 1 Score: 438.728 bits (1127), Expect = 2.195e-144
Identity = 265/630 (42.06%), Postives = 382/630 (60.63%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIK----DVPENLD-KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV--DSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPKKKV-FQILGNCSYVIEYAKK-LNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDII-GWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPL------QDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  + L+EL + F  +    + FI    + E  K    PLPGY+ RE+I+    D   N D KI    F+ +  +VK S DI +TF  R+ +  +  +  +    E S+   +H+  + E+  F NWI++ L  DP C   +P+    D+L+  + DG++LCK+IN +VPDT+DER +N       + +  ENL LA+NSA AIGC +VNIG ED+  G  HL+LGL+WQ+I+IGL   + L  +  L ALLR+ ETL++L +L+PEELLLRW N+HLE +G  K I NF  DI+DS+ Y HLL QIAP  ++ E  P I I       TD++KRAE ML  A  L  R F+ P DV           KLNLAFVANLFN YPAL    + DI+   +  ET EE+T+RNWMNS+GV P+V  +Y+DL++ LV+LQL + ++ P  V+W K+ +   PK     + L NC+Y +E  K    F++V +   ++ D  P + L + +Q++R YT+ +L  +  G+K + DII  W N+    A K++ I SFKD +I++S  ++DLIDAI P  +++ L+ +  L       +AK+ +S ARRIGAR+YALP+ LV+V  KMVMTV+ACLM
Sbjct:    9 ISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKLMVDGDRNKDGKISFNEFVYIFQEVK-SSDIAKTF--RKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQ--ENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQK-INNFSADIKDSKAYFHLLNQIAPKGQK-EGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVP--VDWSKVNKPPYPKLGANMKKLENCNYAVELGKNPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGEGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin 3 vs. UniProt/SwissProt
Match: sp|Q61233|PLSL_MOUSE (Plastin-2 OS=Mus musculus OX=10090 GN=Lcp1 PE=1 SV=4)

HSP 1 Score: 450.669 bits (1158), Expect = 4.049e-148
Identity = 267/630 (42.38%), Postives = 391/630 (62.06%), Query Frame = 2
Query:  320 IETETLNELHDLFPSLKDE---FIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-----KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKST-HAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPAL--IVDSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPK-KKVFQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDII-GWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            +  E + EL + F  +  +   +I  + + +  K    PLPGY  RE+ +++    D     KI  + F+ +   +K S ++ +TF  R+ + ++  +  +    E+S+   +H+  + E+  F NWI++ L  DP C   +P+    D+L+N + DG++LCK+IN +VPDT+DER +N      + F   ENL LA+NSA AIGC +VNIG ED+ +G  +L+LGL+WQVI+IGL   + L  +  L+ALLRE E+L+DL +L+PEELLLRW NYHLE AG TK ITNF  DI+DS+ Y HLL Q+AP    +E +P + I    L+  D+++RAE ML  A  L  R F+   DV     RG    KLNLAF+ANLFN YPAL    + DI+   +  ET EE+T+RNWMNS+GV P V  +YSDL + LV+ QL + ++ P  V+W ++ +   PK     + L NC+Y ++  K +  F++V ++  ++ +    + L L +Q++R YT+ +L  +  G+K + DII  W N   + A K+S I+SFKDP I+TS P+LDLIDAI P S+++ LL  E L D      AK+ IS AR+IGAR+YALP+ LV+VN KMVMTV+ACLM
Sbjct:    6 VSDEEMMELREAFAKVDTDGNGYISCNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGKISFDEFIKVFHGLK-STEVAKTF--RKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCTK-ITNFSTDIKDSKAYYHLLEQVAPKGD-EEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVV----RGN--PKLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVP--VDWNRVNKPPYPKLGGNMKKLENCNYAVDLGKNQAKFSLVGIAGQDLNEGNRTLTLALVWQLMRRYTLNILEDIGGGQKVNDDIIVNWVNTTLKEAQKSSSIASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. UniProt/SwissProt
Match: sp|A6H742|PLSI_BOVIN (Plastin-1 OS=Bos taurus OX=9913 GN=PLS1 PE=2 SV=1)

HSP 1 Score: 448.358 bits (1152), Expect = 3.934e-147
Identity = 266/629 (42.29%), Postives = 384/629 (61.05%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-----KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV----DSDIEIRE-ETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPK-KKVFQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  E L EL + F  +      ++    +Q+  K    PLPGY+ RE+++ +    D     +I  E F+ L  ++K SKDI +TF  R+++ +R  +  +      S+   +H+  + E+  F NWI++ L  DP C   +P+    D L+  L DG+LLCK+IN + PDT+DER +N      + F  +ENL LA+NSA AIGC +VNIG +D+ +G  HL+LGL+WQ+I++GL   + +  +  L+ALL+E E L++L +L+PEELLL+WVNYHL  AG    I+NF  DI+DS  Y HLL QIAP   RD+  P I+I        +++KRAE ML  A  L  R F+ P DV           KLNLAFVANLFNTYP L      D D+ + E E+ EE+T+RNWMNS+GV PY+  +YSDL + LV+ QL ++++   V+W  + +   P      + + NC+Y +E  K K  F++V ++  ++ +    + L L +Q++R YT+ +LS +  G+K +D  II W N+  ++ANK + ISSFKD SI+TS P+LDLIDAI PN+V  +++  E L D      AK+ IS AR+IGARIYALP  LV+V  KMVMTV+ACLM
Sbjct:    8 ISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILAVADNNKDSRISFEEFVSLMQELK-SKDISKTF--RKIINKREGITAIGGTSSISSEGTQHSYSEEEKVAFVNWINKALENDPDCKHLIPMNPNDDSLFKSLADGILLCKMINLSEPDTIDERAINKKK--LTPFTISENLNLALNSASAIGCTVVNIGAQDLTEGKPHLVLGLLWQIIKVGLFADIEISRNEALIALLKEGEDLEELMRLSPEELLLQWVNYHLTNAGWPT-ISNFSHDIKDSRAYFHLLNQIAPKGDRDDG-PAIAIDLTGFSEKNDLKRAEFMLQEADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNTYPGLHKPDNNDIDVNLLEGESKEERTFRNWMNSLGVNPYINHLYSDLADALVIFQLYEMIRVP-VDWSHVNKPPYPALGGNMKKIENCNYAVELGKNKAKFSLVGIAGQDLNEGNSTLTLALVWQLMRRYTLNVLSDLGEGEKVNDAIIIEWVNQTLKSANKNTFISSFKDKSISTSLPVLDLIDAIAPNAVRQEMIKREDLSDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLM 622          
BLAST of Plastin 3 vs. UniProt/SwissProt
Match: sp|Q3V0K9|PLSI_MOUSE (Plastin-1 OS=Mus musculus OX=10090 GN=Pls1 PE=1 SV=1)

HSP 1 Score: 444.506 bits (1142), Expect = 1.147e-145
Identity = 265/629 (42.13%), Postives = 388/629 (61.69%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIKDV----PENLD-KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHDE--LYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV----DSDIEIRE-ETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPK-KKVFQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKD-IIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  E L EL + F  +      ++    +Q+  K    PLPGY+ RE+++ +      N D KI  E F+ L  ++K SKDI +TF  R+++ +R  +  +      S+   +H+  + E+  F NWI++ L  D  C+  LP+  ++  L+  L DG+LLCK+IN + PDT+DER +N      + F  +ENL LA+NSA AIGC +VNIG +D+ +G  HL+LGL+WQ+I++GL   + +  +  L+ALL++ E L++L +L+PEELLLRWVNYHL  AG  + I NF +DI+DS+ Y HLL QIAP   RD+  P ++I        +++KRA  ML  A  L  R F+ P DV           KLNLAFVANLFNTYP L      D D+ + E E+ EE+T+RNWMNS+GV PY+  +YSDL + LV+ QL ++++   V W ++ +   P      + + NC+Y +E  K +  F++V ++  ++ +    + L L +Q++R YT+K+LS +  G+K   D II W N+  ++ANK++ ISSFKD SI+TS P+LDLIDAI PN+V  +++  E L D      AK+ IS AR+IGARIYALP  LV+V  KMVMTV+ACLM
Sbjct:    8 ISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILVVADNNKDGKISFEEFVSLMQELK-SKDISKTF--RKIINKREGITAIGGTSSISSEGTQHSYSEEEKVAFVNWINKALENDADCSHLLPMNPNDGSLFKSLADGILLCKMINLSEPDTIDERAINKKKL--TPFTVSENLNLALNSASAIGCTVVNIGAQDLKEGKPHLVLGLLWQIIKVGLFADIEISRNEALIALLKDGEDLEELMKLSPEELLLRWVNYHLTNAG-WRTINNFSQDIKDSKAYFHLLNQIAPKGDRDDG-PAVAIDLSGFNEKNDLKRAGFMLQEADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNTYPCLHKPDNNDIDLNLLEGESKEERTFRNWMNSLGVNPYINHLYSDLADALVIFQLYEMIRVP-VNWSQVNKPPYPALGGNMKKIENCNYAVELGKNEAKFSLVGIAGQDLNEGNATLTLALVWQLMRRYTLKVLSDLGEGEKVTDDIIIKWVNQTLKSANKSTSISSFKDKSISTSLPVLDLIDAIAPNAVRQEMIKREHLTDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLM 622          
BLAST of Plastin 3 vs. UniProt/SwissProt
Match: sp|P19179|PLSI_CHICK (Plastin-1 OS=Gallus gallus OX=9031 GN=PLS1 PE=1 SV=1)

HSP 1 Score: 439.884 bits (1130), Expect = 7.154e-144
Identity = 261/612 (42.65%), Postives = 377/612 (61.60%), Query Frame = 2
Query:  377 FIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-----KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHDE--LYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAP-ADKRDEMLPPI--SILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALI----VDSDIEIRE-ETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILG-------NCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNE------PLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            ++    +Q+  K    PLPGY+ RE+I+ +    D     KI  E F+ L  ++K SKD+ +++  R+ + +++ +  +      ST   +H+  + E+  F NWI++ L  DP C   LP+   +  L+  L DG+LLCK+IN + PDT+DER +N      + F  +ENL LA+NSA AIGC +VNIG +D+ +G  HL+LGL+WQ+I++GL   + +  +  L+ALL E E LD L +L+PEELLLRWVNYHL  AG  K I+NF +DI+DS  Y HLL QIAP  D  DE+   I  S   + ++++RAE ML  A  L  R F+ P DV           KLNLAFVANLFNTYPAL        D+ + E E+ EE+T+RNWMNS+GV+PYV  +YSDL + L++ QL ++ +   V+W  +       K+ + +LG       NC+Y +E  K K  F++V ++  ++ +  P + L L +Q++R YT+ +LS +  G+K +D+ II W N+    ANK + I+SFKD SI+TS P+LDLIDAI P +V  +++  E       L +AK+ IS AR+IGARIYALP  LV+V  KMVMTV+ACLM
Sbjct:   30 YVSDYELQDLFKEASLPLPGYKVREIIEKIFAVTDSNKDGKINFEEFVSLIQELK-SKDVSKSY--RKSINKKLGITALGGTSSISTEGTQHSYSEEEKVAFVNWINKALQDDPDCKHILPMNPSDASLFKSLADGILLCKMINFSQPDTIDERAINKKK--LTPFTISENLNLALNSASAIGCTVVNIGSQDLQEGKPHLVLGLLWQIIKVGLFADIEISRNEALIALLNEGEELDQLMKLSPEELLLRWVNYHLANAGWQK-ISNFSQDIRDSRAYYHLLNQIAPKGDDFDEIHVEIDFSGFNDKNDLRRAECMLQQADKLGCRQFVTPADVV------AGNPKLNLAFVANLFNTYPALHKPDNSSYDLTLLEGESNEERTFRNWMNSLGVSPYVNHLYSDLSDALIIFQLYEMTRVP-VDWTHV------NKRPYPLLGGNMKKIENCNYAVELGKTKAKFSLVGIAGHDLNEGNPTLTLALIWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLANANKKTSITSFKDKSISTSLPVLDLIDAIAPKAVRQEMVKREDLSYQDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLM 622          
BLAST of Plastin 3 vs. UniProt/SwissProt
Match: sp|Q6P698|PLSL_DANRE (Plastin-2 OS=Danio rerio OX=7955 GN=lcp1 PE=2 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 2.229e-143
Identity = 267/629 (42.45%), Postives = 384/629 (61.05%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-----KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPI--KHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPP-----ISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV--DSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPK-KKVFQILGNCSYVIEYAKK-LNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  E + EL + F  +    +  I    +    K    PLPGY  RE+I+++   +D     KI  + F  +   +K S ++ +TF  R+ + ++  + +V    E+S   +H+  + E+  F NW+++ L KDP C   LP+    D+L+  + DG++LCK+IN +VPDT+DER +N      + F   ENL LA+NSA AIGC +VNIG ED+ +G +HL+LGL+WQVI+IGL   + +  +  L+ALLR+ E+L+DL +L+PEELLLRW NYHLE+AG  K I NF  DI+DS+ Y ++L Q+AP  KRDE   P     IS ++  D++KRAE ML  A  L  R F+   DV     RG    KLNLA+VANLFN YPAL    + DI+   I  ET EE+T+RNWMNS+GV P V  +Y DL + LV+ QL + ++   V+W K+ +   PK     + L NC+Y +E  KK   F++V ++  ++ +    + L L +Q++R YT+ +L  +  G+K  D+ I+ W N+    A K + IS FKD SI++S P+LDLIDAI P S+ + LL  E L D      AK+ IS AR+IGAR+YALP+ LV+V  KMVMTV+ACLM
Sbjct:    6 ISAEEMEELREAFTKVDVDGNGHISTDELNALFKAANLPLPGYRVREIIQEISRTMDLNQDGKITFDEFAKVVHDLK-SSEVAKTF--RKAINKKEGICSVAGTSEQSG-TQHSYSEEEKVAFVNWVNKALEKDPDCQHVLPMDPSTDDLFTAVGDGIVLCKMINLSVPDTIDERTINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIEISRNEALIALLRDGESLEDLVKLSPEELLLRWANYHLEEAGCPK-INNFSSDIKDSKAYYNILNQVAP--KRDEEGIPAIPIDISGIREKDDLKRAECMLEQADRLGCRQFVTATDVV----RGN--PKLNLAYVANLFNKYPALKKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYVDLADALVIFQLYEKIKVP-VDWDKVNKPPYPKLGSNMKKLENCNYAVELGKKEAKFSLVGIAGQDLNEGNRTLTLALLWQLMRRYTLNILEDLGDGQKIIDETIVQWVNETLTQAGKGT-ISGFKDGSISSSMPVLDLIDAIQPGSIRYDLLKAEDLTDEKKLNNAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLM 617          
BLAST of Plastin 3 vs. TrEMBL
Match: A0A0R3TJV9 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7397 PE=4 SV=2)

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 301/615 (48.94%), Postives = 447/615 (72.68%), Query Frame = 2
Query:  326 TETLNELHDLFPSLKDEFIERSNIQEALKVLGFPLPGYEFRELIKD--VPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKD-DEKSTH-AKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKH---DELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKV--LPGKKDDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDHQISN 2143
            +E + +L + FP+L   +I R+ ++EAL+ +GF L G +FR L+++  +    D I V+  M +   ++ +++  +  +++R L+ER D++    D  EKST  AKH+V  +EER F +WI+R+L  DP    +LPI H    ++Y++ +DG+LLCKLIN+AVPDT+DER +N   +  ++FK NENL LAVNSAE+IGCC+VN+GPEDI++  +HL+LGL+WQ+IRIGLLG++++ HH+EL+ LL   ET+D+L+ L+PE+LLLRWVN+HL+ AG T R+TNF  D+ DSE+Y+ LL QIAP DK+  ++P   I+  ++   RAE++L NA  L+A  FI P+D+    +RG +R+KL+LAFVANLFN YP L     +++  ETLEEKTYRNWMNSMGV P+V+D+ SDL++GL+ LQL+D+L+PG V W KI RVFD K+++FQ+  NC+YV+EYA  LN N+VNLS +++++    + LGL FQ++R+YTMK+LS++    G+  +KDI+ WAN+K  +      +SSF+DP+I+   P+++LI+AI P+SVD  ++  + L + +  IS AR+IGAR+YALP+HL DVN KM+MTV+ACLM LD Q++ 
Sbjct:  655 SEMIADLSETFPTLYRGWIARNQVKEALERVGFTLSGGDFRRLVEEEFLRPGYDHICVDTLMDILKMLQANQEKQQLIEKKRELRERADLRVYETDVQEKSTATAKHSVSPAEERAFIDWINRLLGSDPDLKHHLPIDHTIDGQIYDRCRDGLLLCKLINAAVPDTIDERCINKTPTKSNIFKINENLTLAVNSAESIGCCVVNVGPEDIEQCARHLVLGLIWQIIRIGLLGMISIQHHSELIDLLEPGETVDNLRFLSPEDLLLRWVNFHLQTAGNTHRMTNFTSDVIDSEVYATLLQQIAPEDKQSFLIPVTGIMAESNMYCRAEMVLENAEFLNAAAFITPDDIVNAAERGMDRDKLHLAFVANLFNLYPGLKSKPSVDV-PETLEEKTYRNWMNSMGVAPFVRDLSSDLRSGLIFLQLLDILEPGTVAWNKIARVFDQKRQIFQMQDNCAYVVEYANLLNVNVVNLSGEDLRNGERKLTLGLTFQLMRAYTMKMLSELHQCCGRLCEKDILDWANEKLVSVG-APMLSSFRDPTISNGVPVMNLINAIKPHSVDKTMVLKDKLANCRIAISTARKIGARVYALPEHLRDVNPKMIMTVFACLMALDIQLNG 1267          

HSP 2 Score: 523.857 bits (1348), Expect = 2.245e-166
Identity = 273/616 (44.32%), Postives = 398/616 (64.61%), Query Frame = 2
Query:  329 ETLNELHDLFPSL-KDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCA-----PYLPIKHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPG----KKDDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDHQISNA 2146
            E L +L+  FP L +   I    I+ AL+ LG P+ G+E RE+     +      ++    +++     K   +   +  +LK   + KT   D       KHTV  SEE+ FSNWI++ L+ D  C      P  P    ELY + ++G++L K+IN AVP+T+D+R +  G SLK++FK NENL L VNSA AIGCCMVNIGPEDI    +H++ GL+WQ+IR  ++  + L  H+EL +LL   ETL+ L  L PEELL+RWVN+HL  A   +R+TNF  DI DSEIY+ L+ QI P + R  ++    IL+ T   KRA++++ NA ILDA   + PED+    + G + +KLNL FVA LFN YP +    ++ I+ ETLEEKTYRNWMNSMGVTP V ++Y +L +GLVLLQLID++QPG V+WKK+ + FDPK+ +FQ+  NC  VIEYAK L   IVN+S ++I++     +LGLCFQ++R+YT KLL +   G    K +D  I+ WAN++ ++ ++ + ISSF+D S+A S+PI+ ++++IVP  V   +LT++   +A + +S  R+ GAR+YALP+H+   NQKM+MT++ACL++L +Q+  +
Sbjct:    6 EQLGDLYTAFPDLQRTGSIPADQIRNALEKLGCPVAGHELREMQATRNKIGSFCDLDELYQIYSIANAMKMDAKKIMKDAILKGIQEAKTYDTD----LGGKHTVTKSEEKAFSNWINKHLAGDKDCVALNLIPINPENDGELYERCKNGIILAKMINVAVPNTIDDRTLEKGESLKAIFKINENLTLVVNSAAAIGCCMVNIGPEDISGCRRHIVCGLIWQLIRKAIVDTITLAQHSELASLLLPGETLEQLANLKPEELLMRWVNFHLMNANSNRRLTNFTSDICDSEIYALLMEQITPLELRSRLISSKLILEETSLEKRAQMVMENAKILDAGTLLVPEDI-YTAKPGSHSDKLNLGFVATLFNMYPGMEPPGELNIQPETLEEKTYRNWMNSMGVTPIVSNLYGNLNDGLVLLQLIDIIQPGTVDWKKVTKTFDPKRAIFQMQSNCVLVIEYAKVLGIKIVNISGEDIREGATKQILGLCFQLMRAYTHKLLIQASGGGSTAKIEDSYIVSWANERLKSMSEPT-ISSFRDQSLANSRPIVAVLESIVPMGVSRNMLTDDNFSNAVYALSSCRKAGARVYALPEHICTCNQKMIMTIFACLIVLSYQVQES 615          
BLAST of Plastin 3 vs. TrEMBL
Match: A0A1I8JAL8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000734g5 PE=4 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 307/625 (49.12%), Postives = 431/625 (68.96%), Query Frame = 2
Query:  314 LLIETETLNELHDLFPSLKDE--FIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDKIPVEMFMMLHAKVK---ESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPI--KHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLK---SVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPAL--IVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK--DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTN--EPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDHQIS 2140
            LL   E + +L   FP L  +   + +  +++AL  +G  + G++ R+L+ D+         +  + L+ +VK     +D+  + ++    +++  +K ++    + T   HT+ DSE RG++ WI+++L KDP  +  LP+    DELY KL DG++LCKLINSAVPDT+ E+ MN  A LK   + F+ +ENL LAVNSAE+IGCC+VNIG  DI +   H+ILGL+WQ+IRIGL+  + L  H EL ALL   ETL+DLKQL+PEELLLRWVNY L KAG  KR+ NFK+DI DSE Y+HLL QIAPADKR EM  P  +L + D +KRA+ +L NA  LDA VF+  ED+A   + G+NREKLN+AFVANLFN YPA+  + D ++E+ EETLEEKT+RNWMNS+GV+P+VKD+YSDL+NGL+LL L+D ++PG+V W K+ + F P KK+FQ   NC+YVIE  +K+   + N+ A++I+D    + LGL FQM+R+YT+ LL ++  G +  DD +II WAN+K EAA K +++ SFKDPS+A    IL+L DAI P +VD  +     + L  A+F +S++R IG RIYALP+H+V VN+ M+MTV+ACLM+LD QI+
Sbjct:   11 LLDADENIADLLRKFPDLGKDGGTVSKDELRDALDAMGAKVSGFQLRDLLNDLMPTKTSFDKDALVTLYCQVKMKQPDRDVKDSMKKLHNPEDKQSMKKISGTGNEWTL--HTIGDSERRGYAGWINKMLEKDPDLSHLLPVDGNTDELYEKLGDGLVLCKLINSAVPDTIHEKAMNKLAQLKGGSAGFRMHENLVLAVNSAESIGCCIVNIGANDIKECRPHIILGLIWQIIRIGLMKDITLSQHKELAALLLPGETLEDLKQLSPEELLLRWVNYQLAKAGTDKRVHNFKDDIMDSEAYAHLLSQIAPADKRSEMRSPQEVLASADRLKRADGVLSNADKLDAAVFVVSEDIAFANEPGRNREKLNMAFVANLFNNYPAMEAVQDVEVEVIEETLEEKTFRNWMNSLGVSPFVKDLYSDLRNGLILLTLMDHIKPGVVPWSKVCKTFVPNKKLFQWQANCNYVIECGRKIGLPMTNIGAEDIRDGDRKLTLGLVFQMMRAYTLSLLMQLTGGTRKIDDDEIIQWANQKLEAAGKAARVKSFKDPSLADGMVILELADAIKPKTVDTSIAAGMKDQLDRARFILSKSRMIGGRIYALPEHVVQVNKNMIMTVFACLMILDFQIN 633          
BLAST of Plastin 3 vs. TrEMBL
Match: A0A564YG16 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5448 PE=4 SV=1)

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 302/615 (49.11%), Postives = 447/615 (72.68%), Query Frame = 2
Query:  326 TETLNELHDLFPSLKDEFIERSNIQEALKVLGFPLPGYEFRELIKD--VPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTV-TKDDEKSTH-AKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKH---DELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKV--LPGKKDDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDHQISN 2143
            +E + +L + FP+L   +I R+ ++EAL+ +GF L G +FR L+++       D I V+  M +   ++ +++  +   ++R L+ER D++   T+  E ST  AKH+V  +EER F +WI+R+L  DP    +LPI +    +LY++ +DG+LLCKLIN+AVPDT+DER +N   +  ++FK NENL LAVNSAE+IGCC+VN+GPEDI++  +HL+LGL+WQ+IRIGLLG++++ HH+EL+ LL   ET+D+L+ L+PE+LLLRWVN+HL+ AG T R+TNF  D+ DSE+Y+ LL QIAP DK+  ++P   I+  ++   RAE++L NA  L+A  FI P+D+    +RG +R+KL+LAFVANLFN YP L     +++  ETLEEKTYRNWMNSMGV P+V+D+ SDL++GL+ LQL+D+L+PGIV W KI RVFDPK+++FQ+  NC+YV+EYA  LN N+VNLS +++++    + LGL FQ++R+YTMK+LS++    G+  +KDI+ WAN+K  +      +SSF+DP+I+   P+++LI+AI P+S+D  ++  + L + +  IS AR+IGAR+YALP+HL DVN KMVMTV+ACLM LD Q++ 
Sbjct:   11 SEMIADLSETFPTLYRGWIPRNQVKEALERVGFTLSGGDFRRLVEEEFFRPGYDHICVDTLMDILKMLQSNQEKQQLIDKKRELRERADLRVYETEVQENSTATAKHSVSPAEERAFIDWINRLLGSDPDLKHHLPIDYTVDGQLYDRCRDGLLLCKLINTAVPDTIDERCINKAPTKSNIFKINENLTLAVNSAESIGCCVVNVGPEDIEQCARHLVLGLIWQIIRIGLLGMISIQHHSELIDLLEPGETVDNLRFLSPEDLLLRWVNFHLQTAGNTHRMTNFTSDVIDSEVYATLLQQIAPEDKQSFLIPVTGIMAESNMYCRAEMVLENAEFLNAAAFITPDDIVNAAERGMDRDKLHLAFVANLFNLYPGLKSKPSVDV-PETLEEKTYRNWMNSMGVAPFVRDLSSDLRSGLIFLQLLDILEPGIVGWNKIARVFDPKRQIFQMQDNCAYVVEYANLLNVNVVNLSGEDLRNGERKLTLGLTFQLMRAYTMKMLSELHQCYGRLCEKDILDWANEKLVSVG-APMLSSFRDPTISNGVPVMNLINAIKPHSIDKTMVLKDKLANCRIAISTARKIGARVYALPEHLRDVNPKMVMTVFACLMALDIQLNG 623          
BLAST of Plastin 3 vs. TrEMBL
Match: A0A158QUU3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6751 PE=4 SV=1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 302/617 (48.95%), Postives = 444/617 (71.96%), Query Frame = 2
Query:  326 TETLNELHDLFPSLKDEFIERSNIQEALKVLGFPLPGYEFRELIKD--VPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTV-TKDDEKSTH-AKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHD---ELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKV--LPGKKDDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDHQISNAK 2149
            +E + +L + FP+L   ++ R  ++EAL+  GFPL G +FR L+++  +    D I V+    +   +  +++  +  +++R L+ER D++   ++D E ST  AKH+V  +EER F +WI+R+L+ DP    +LPI H    +LY + +DG+LLCKLIN+AVP+T+DER +N   +  ++FK NENL LAVNSAE+IGCC+VN+GPEDI++  +HL+LGL+WQ+IRIGLLG++++ HH+E + LL   ET+D+L+ L+PE+LLLRWVN+HLE AG T R+TNF  DI DSEIY+ LL QIAP DK+  ++P   I+  ++   RAE++L NA  L A  FI PED+    +RG NR+KL+L FVANLFN YP L   + ++I  ETLEEKTYRNWMNSMGV P+V+D+ SDL++GL+ LQL+D+L+PG V W KIVRVFDPK+++FQ+  NC+YV+EYA  LN N+VNLS ++++     + LGL FQ++R+YTMK+LS++    G   +KDI+ WAN++  +      ++SF+D SI++  P+++LI+AI P+S+D  ++  + L + +  IS AR+IGAR+YALP+HL DVN KM+MTV+ACLM LD Q++  +
Sbjct:  619 SELVADLSESFPTLYRGWLPRHQVREALERAGFPLSGGDFRCLVEEEFLRPGYDHICVDTLTEILKMLLSNQEKQKLVEKKRELRERADLRVYESEDQENSTATAKHSVSPAEERAFIDWINRLLASDPDLRHHLPIDHSVDGQLYERCRDGLLLCKLINAAVPETIDERCINKTPNKANIFKINENLTLAVNSAESIGCCVVNVGPEDIEQCARHLVLGLIWQIIRIGLLGMISVQHHSEFIDLLEPGETVDNLRLLSPEDLLLRWVNFHLEMAGNTHRMTNFSSDIMDSEIYATLLQQIAPEDKQAFLIPVTGIMAESNMYCRAEMVLENAEFLSAAAFITPEDIVKAAERGMNRDKLHLVFVANLFNLYPGLKSKAPMDI-PETLEEKTYRNWMNSMGVAPFVRDLSSDLRSGLIFLQLLDVLEPGTVAWNKIVRVFDPKRQIFQMQDNCAYVVEYANLLNVNVVNLSGEDLRTGERKLTLGLTFQLMRAYTMKMLSELHQCCGHLVEKDILAWANERLVSVG-APMLASFRDCSISSGVPVMNLINAIKPHSIDKSMVLKDKLANCRIAISTARKIGARVYALPEHLRDVNPKMIMTVFACLMALDLQLNGVQ 1233          

HSP 2 Score: 495.738 bits (1275), Expect = 4.036e-156
Identity = 256/608 (42.11%), Postives = 390/608 (64.14%), Query Frame = 2
Query:  329 ETLNELHDLFPSLK-DEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPY--LPIKHD---ELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-----DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            E L++L+  FP L+ +  I   +I+ AL+ LG  + G+E REL            ++    ++++ K  K   +   +  +LK   + K      +     KHTV  SEE+ F+NWI++ L  DP C     +PI  +   +LY++ ++G++L K+IN AVP+T+D+R +    SLK++FK+NENL L VNSA AIGCCMVNIGPEDI  G +H++ GL+WQ+IR  ++  + L  H EL +LL   ETL++L  L PEELL+RWVN+HL  A  T+R+TNF  D+ DSEIY+ L+ QI P D R  ++    I++     KRA +++ NA +LDA   + PED+    + G + +KLNL F+A LFN YP L    D+ I+ ETLEEKTYRNWMNSMGVTP V ++YS+L +GLVLLQLID+++PG V+WK++   FD  + +FQ   NC  VIEY++K+   +VN+S ++I++     +LGLCFQ +R+YT KLL +   G+      +D +I+ W N + +   +T  I+ F+DP++A+++PI+ ++++IVP      +LTN+   +A + +S  R+ GAR+YALP+H+   N KM++T++ACL+
Sbjct:    6 EQLSDLYSAFPELQTNGAISADDIRPALEKLGCAIAGHELRELQGGRRRGNALCDLDELYHIYSQAKAIKIDSKKIIKDAILKGIREAKAY----DSEVGGKHTVTYSEEKAFTNWINKHLKGDPDCESLGLIPIDSEVDGQLYDRCKNGIILAKMINVAVPNTIDDRTLEKAESLKAIFKRNENLTLVVNSAAAIGCCMVNIGPEDISGGRRHIVCGLIWQLIRKAIVDTITLAQHGELASLLSPGETLEELASLKPEELLMRWVNFHLANANSTRRLTNFTTDLCDSEIYAILMEQITPLDLRARLINSKVIMEEPSLEKRAHMVMENAKLLDAGTLLIPEDI-YTAKPGSHSDKLNLGFIATLFNMYPGLETPGDLNIQPETLEEKTYRNWMNSMGVTPIVSNLYSNLSDGLVLLQLIDIIRPGTVDWKRVTTTFDSMRSLFQKQTNCVLVIEYSEKIGIKLVNISGEDIREGATKQILGLCFQFMRAYTHKLLKQA-SGEGSTAPIEDSEILAWVNDRLKLVGET-PINGFRDPALASARPIVAVLESIVPKGASRGMLTNDDFANAVYALSSCRKAGARVYALPEHICTCNNKMIVTIFACLI 606          
BLAST of Plastin 3 vs. TrEMBL
Match: A0A5K3ETD1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 302/617 (48.95%), Postives = 444/617 (71.96%), Query Frame = 2
Query:  326 TETLNELHDLFPSLKDEFIERSNIQEALKVLGFPLPGYEFRELIKD--VPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTV-TKDDEKSTH-AKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHD---ELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKV--LPGKKDDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDHQISNAK 2149
            +E + +L + FP+L   ++ R  ++EAL+  GFPL G +FR L+++  +    D I V+    +   +  +++  +  +++R L+ER D++   ++D E ST  AKH+V  +EER F +WI+R+L+ DP    +LPI H    +LY + +DG+LLCKLIN+AVP+T+DER +N   +  ++FK NENL LAVNSAE+IGCC+VN+GPEDI++  +HL+LGL+WQ+IRIGLLG++++ HH+E + LL   ET+D+L+ L+PE+LLLRWVN+HLE AG T R+TNF  DI DSEIY+ LL QIAP DK+  ++P   I+  ++   RAE++L NA  L A  FI PED+    +RG NR+KL+L FVANLFN YP L   + ++I  ETLEEKTYRNWMNSMGV P+V+D+ SDL++GL+ LQL+D+L+PG V W KIVRVFDPK+++FQ+  NC+YV+EYA  LN N+VNLS ++++     + LGL FQ++R+YTMK+LS++    G   +KDI+ WAN++  +      ++SF+D SI++  P+++LI+AI P+S+D  ++  + L + +  IS AR+IGAR+YALP+HL DVN KM+MTV+ACLM LD Q++  +
Sbjct:   11 SELVADLSESFPTLYRGWLPRHQVREALERAGFPLSGGDFRCLVEEEFLRPGYDHICVDTLTEILKMLLSNQEKQKLVEKKRELRERADLRVYESEDQENSTATAKHSVSPAEERAFIDWINRLLASDPDLRHHLPIDHSVDGQLYERCRDGLLLCKLINAAVPETIDERCINKTPNKANIFKINENLTLAVNSAESIGCCVVNVGPEDIEQCARHLVLGLIWQIIRIGLLGMISVQHHSEFIDLLEPGETVDNLRLLSPEDLLLRWVNFHLEMAGNTHRMTNFSSDIMDSEIYATLLQQIAPEDKQAFLIPVTGIMAESNMYCRAEMVLENAEFLSAAAFITPEDIVKAAERGMNRDKLHLVFVANLFNLYPGLKSKAPMDI-PETLEEKTYRNWMNSMGVAPFVRDLSSDLRSGLIFLQLLDVLEPGTVAWNKIVRVFDPKRQIFQMQDNCAYVVEYANLLNVNVVNLSGEDLRTGERKLTLGLTFQLMRAYTMKMLSELHQCCGHLVEKDILAWANERLVSVG-APMLASFRDCSISSGVPVMNLINAIKPHSIDKSMVLKDKLANCRIAISTARKIGARVYALPEHLRDVNPKMIMTVFACLMALDLQLNGVQ 625          
BLAST of Plastin 3 vs. Ensembl Cavefish
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:NCBI gene;Acc:30583])

HSP 1 Score: 449.899 bits (1156), Expect = 6.662e-149
Identity = 267/629 (42.45%), Postives = 392/629 (62.32%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-----KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPI--KHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV--DSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPK-KKVFQILGNCSYVIEYAKK-LNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  + + EL + F  +    + +I    + E  +V   PLPGY  RE+I+++   +D     KI  + F  +   +K S ++ +TF  R+ + ++  +  V    E+S   +H+  + E+  F NWI++ L KDP C   LP+    ++L+  + DG++LCK+IN +VPDT+DER +N      + F   ENL LA+NS+ AIGC +VNIG ED+ +G +HL+LGL+WQ+I+IGLL  + +  +  L+ALLR+ E+L+DL +L+PEELLLRW NYHLE+AG +K I NF  DI+DS+ Y ++L Q+AP    DE +PPI I    L+  +++KRAE ML  A  L  R F+ P DV     RG    KLNLAFVANLFN YPAL    + DI+   I  ET EE+T+RNWMNS+GV P V  +Y DL + L++ QL + ++ P  V+W K+ +   PK     + L NC+Y +E  KK   F++V ++  ++ +    + L L +Q++R YT+ +L  +  G+K +D  I+GW N   + A+K + IS FKD SI++S P+LDLIDAI P S+ + L+  E L D      AK+ IS AR+IGAR+YALP+ LV+V  KMVMTV+ACLM
Sbjct:    4 ISHDEMEELREAFSKVDVDSNGYISTDELNELFRVANLPLPGYRIREIIQELSATMDQNQDGKITFDEFAKVFHGLK-SSEVAKTF--RKAINKKEGICAVAGTSEQSG-TQHSYSEEEKVAFVNWINKALEKDPDCKHVLPMDPSSNDLFTAVGDGIVLCKMINLSVPDTIDERTINKKKL--TPFTIQENLNLALNSSSAIGCHVVNIGAEDLKEGRQHLVLGLLWQIIKIGLLADIEISRNEALIALLRDGESLEDLMKLSPEELLLRWANYHLEQAGCSK-INNFSSDIKDSKAYYNILNQVAPKGD-DEGIPPIIIDMTGLREKEDLKRAECMLDQADRLGCRQFVMPPDVV----RGN--PKLNLAFVANLFNKYPALKKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYGDLADALIIFQLYEKIKVP--VDWDKVNKPPYPKLGSNMKKLENCNYAVELGKKEAKFSLVGIAGQDLNEGNRTLTLALLWQLMRRYTLNILEDLGDGQKVNDDTIVGWVNDTLKQADKKT-ISGFKDGSISSSMPVLDLIDAIQPGSIRYDLIKAEDLSDEEKLNNAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLM 615          
BLAST of Plastin 3 vs. Ensembl Cavefish
Match: pls3 (plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-040718-10])

HSP 1 Score: 381.333 bits (978), Expect = 3.355e-123
Identity = 239/570 (41.93%), Postives = 338/570 (59.30%), Query Frame = 2
Query:  479 DKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDE-KSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYN-KLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAP---ADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV--DSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEW-KKIVRVFDPKKKV-FQILGNCSYVIEYAKKL-NFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDII-GWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            ++I    F+ +  ++K S DI ++F  R+ +  +  +  +    E  S   +H+  + E+  F NWI+  L KDP C   LP+    D L+   + DG++          D V   + NT  + +  +   ENL LA+NSA AIGC +VNIG  D+ +G  HL+LGL+WQ+I+IGL   + L  +  L ALLRE ETL+DL +L+PEELLLRW N+HL+ AG  K I NF  DI+DS+ Y HLL QIAP    +  D +   ++     D++KRAE ML  A  L  R F+ P DV           KLNLAFVANLFN YPAL    + DI+   +  ET EE+T+RNWMNS+GV P+V  +Y DL++ LV+LQL + ++ P  V+W  K+ +   PK     + L NC+Y ++  K    F++V +   ++ D  P + L L +Q++R YT+ +L  +  G+K + DII  W NK    A K++KISSFKD  I++S P+LDLIDAI P SV + L+    L D      AK+ +S AR+IGAR+YALP  LV+V  KMVMTV+ACLM
Sbjct:   10 NRISFNEFLSIFQELKSS-DIAKSF--RKAINRKEGILAIGGTSELSSAGTQHSYSEEEKFAFVNWINTALEKDPDCKHVLPMNPNTDSLFKFAIFDGIVFL--------DIVLLNICNTNVNFELNY---ENLNLALNSASAIGCHVVNIGALDLREGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLREGETLEDLMKLSPEELLLRWANFHLDNAGWHK-INNFSSDIKDSKAYFHLLNQIAPKGLKENEDRIDINMAGFNEKDDLKRAEAMLVQADRLGCRQFVTPADVV------SGNPKLNLAFVANLFNKYPALTKPENQDIDWGLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYERIKVP--VDWNNKVNKPPYPKLGANMKKLENCNYAVDLGKTTAKFSLVGIGGQDLNDGNPTLTLALVWQLMRRYTLNVLEDLGDGEKVNDDIIVNWVNKTLAGAGKSTKISSFKDKEISSSLPVLDLIDAIQPGSVHYDLVKTGSLSDQDKLENAKYAVSMARKIGARVYALPDDLVEVKPKMVMTVFACLM 556          
BLAST of Plastin 3 vs. Ensembl Cavefish
Match: pls1 (plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-030131-6205])

HSP 1 Score: 354.755 bits (909), Expect = 2.611e-112
Identity = 236/634 (37.22%), Postives = 356/634 (56.15%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFREL----IKDVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPI--KHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAP-ADKRDEMLPPI--SILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDS----DIEIRE-ETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPKKKVFQILG-------NCSYVIEYAKK-LNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTN------EPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I  E L +L + F  +      F+    +QE  +   F LPGY+ RE+    +       +KI  E F+ ++ +++ SK++  TF  R+ +  R  + +       S+   +H+  D E+  F NWI++ L+ DP C   +P+    D L  +    V L K+IN + PDT+DERV+NT    ++ F   ENL LA+NSA AIGC +VNI  +D+  GT HL+LGL+WQ+I+IGL   + +  +       ++  T+  + Q  P      W + H  +              QDS  Y HLL QI+P  D  DEM   I  S L   D+ +RAELML  A+ LD R F+ P+DV           KLN+AFVANLFN +PAL   +    D+ + E E+ E++T+RNWMNS+GV PYV  +YSDL +GL++LQL + +Q P  V+W+K+ R        + ILG       NC+Y +E  K+   F++V +  +NI + +    L L +Q++R YT+K+L+ +  G+K +D+ I+ W N   +   K S I +FKD SI+TS P++DLID I P ++  +++        + L +AK+ IS +R+IGA++YALP  LV+VN KMVMTV+ACLM
Sbjct:    8 ISREDLQDLREAFNKIDIDNSGFVSDFELQELFREASFSLPGYKVREIAEKFVAGDTNKDEKISFEEFVAIYQELR-SKEVRETF--RKTISRRDGIHSFGGTSGISSEGTQHSYADEEKVAFVNWINKALANDPDCKHLIPMDPTTDSLCAQFYTLVEL-KMINLSQPDTIDERVINTKK--RTTFTMTENLILALNSASAIGCTVVNIDSQDMIAGTPHLVLGLLWQIIKIGLFADIEISRNEG-----QKLTTIQHISQSCP------WGSIHDLQCLFFS---------QDSRAYFHLLDQISPKGDGDDEMRISIDMSGLNERDDERRAELMLRQAARLDCRQFVTPQDVVA------GNHKLNMAFVANLFNMFPALSRPANNGIDLAMLEGESREDRTFRNWMNSLGVNPYVNHLYSDLMDGLIILQLYERIQVP--VDWRKVNR------PPYSILGSNMKKLENCNYAVELGKREAKFSLVGIGGENINEGSAMHTLALVWQLMRRYTVKVLADIGHGEKVNDQIIVDWVNSTLQKGQKDSSIKNFKDKSISTSLPVIDLIDTIAPGAIKSEMVKRGDMSPEDKLNNAKYAISVSRKIGAKVYALPDDLVEVNPKMVMTVFACLM 601          
BLAST of Plastin 3 vs. Ensembl Cavefish
Match: flna (filamin A, alpha (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-030131-2145])

HSP 1 Score: 58.9214 bits (141), Expect = 2.047e-8
Identity = 53/207 (25.60%), Postives = 93/207 (44.93%), Query Frame = 2
Query:  737 LYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKN--ENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPA-----DKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEP 1336
            L   L DG+ L  L+     + + ++ M    + +  F++   EN+ +A+   +     +V+I  + I  G   LILGL+W +I          LH++  + +  E+E  DD KQ TP++ LL W+   L +      ITNF  D Q  +    L+   AP      D  D+  P   +    + M++A+  LG   ++     ++P
Sbjct:   68 LQTDLSDGLRLIGLL-----EVLSQKKMFRKYNQRPTFRQMQLENVSVALEFLDRENIKLVSIDSKAIVDGNLKLILGLIWTLI----------LHYSISMPMWDEEEDTDDAKQKTPKQRLLGWIQNKLPEL----PITNFSRDWQSGKALGALVDSCAPGLCPDWDSWDQTKP---VDNAREAMQQADEWLGVPQVITPEEIVDP 252          
BLAST of Plastin 3 vs. Ensembl Cavefish
Match: flncb (filamin C, gamma b (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-041008-175])

HSP 1 Score: 56.225 bits (134), Expect = 1.609e-7
Identity = 55/205 (26.83%), Postives = 96/205 (46.83%), Query Frame = 2
Query:  734 ELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFK--KNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRD-EMLPPISILKNT-DNMKRAELMLGNASILDARVFIEP 1336
            +L   L DG+ L  L+     + + ++ M      +  F+  K EN+ +A+   E     +V+I  + I  G   LILGL+W +I          LH++ +   + EDE  +D K+LTP++ LL W+   + +      I NF  D +D +    L+   AP    D EM  P   ++N  + M++A+  LG   ++     ++P
Sbjct:   39 DLQRDLSDGLKLIGLL-----EVLSQKKMYRKYHARPNFRQMKLENVSVALEFLEREHIKLVSIDSKAIVDGNLKLILGLIWTLI----------LHYS-ISMPMWEDEDDEDAKKLTPKQRLLGWIQNKVPQL----PINNFHRDWRDGKALGALVDNCAPGLCPDWEMWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDP 223          
BLAST of Plastin 3 vs. Ensembl Sea Lamprey
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:NCBI gene;Acc:30583])

HSP 1 Score: 234.572 bits (597), Expect = 6.662e-71
Identity = 145/337 (43.03%), Postives = 200/337 (59.35%), Query Frame = 2
Query: 1163 DIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEI------REETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKV-FQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            D QDS  Y HLL QIAP   + E  P + I      + D ++RAE ML  A  L  R F+ P DV           KLNLAFVANLFN YPAL   ++ +I        E+ EE+T+RNWMNS+GV P+V  +YSDL + LV++QL + ++   V+W K+ +   PK     + L NC+Y +E  K   F++V +   ++ D  P + L L +Q++R YT+++L  +  G+K +D+ I+ W N     A K+S I+SFK P  A S P  DLIDAI P S+ + L+  EPL D      AK+ IS AR+IGAR+YALP  LV+V  KMVMT++ACLM
Sbjct:    1 DPQDSRAYFHLLNQIAPKGDK-EGQPRVDIDFSGFNDKDELRRAE-MLVQADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNKYPALHKPANQDIDWGLLEAGESREERTFRNWMNSLGVNPFVNHLYSDLVDALVIIQLFEKIKTR-VDWNKVNKPPYPKLGANMKKLENCNYAVELGKTTKFSLVGIGGQDLNDGNPTLTLALVWQLMRKYTIQVLEDLGEGEKVNDEIIVNWVNHTLRDAGKSSSIASFKVPPTALSTPCWDLIDAIQPGSIRYDLVKEEPLTDDDRLDNAKYAISMARKIGARVYALPDDLVEVKPKMVMTMFACLM 328          

HSP 2 Score: 64.3142 bits (155), Expect = 2.934e-11
Identity = 64/238 (26.89%), Postives = 107/238 (44.96%), Query Frame = 2
Query:  650 EERGFSNWISRVLSKDPLCAPYLPIKHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGA--SLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFK-EDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMV 1354
            EER F NW++  L  +P          + LY+ L D +++ +L    +   VD   +N      L +  KK EN   AV   +     +V IG +D++ G   L L LVWQ++R          +  +++  L E E ++D       E+++ WVN+ L  AG +  I +FK      S     L+  I P   R +++     L + D +  A+  +  A  + ARV+  P+D+  V
Sbjct:  105 EERTFRNWMNS-LGVNPFV--------NHLYSDLVDALVIIQLFEK-IKTRVDWNKVNKPPYPKLGANMKKLENCNYAVELGKTTKFSLVGIGGQDLNDGNPTLTLALVWQLMR---------KYTIQVLEDLGEGEKVND-------EIIVNWVNHTLRDAGKSSSIASFKVPPTALSTPCWDLIDAIQPGSIRYDLVKE-EPLTDDDRLDNAKYAISMARKIGARVYALPDDLVEV 315          
BLAST of Plastin 3 vs. Ensembl Yeast
Match: SAC6 (Fimbrin, actin-bundling protein; cooperates with Scp1p in organization and maintenance of the actin cytoskeleton; phosphorylated by Cdc28p/Clb2p in metaphase on T103, to regulate conformation, and modulate actin filament binding affinity and actin cable dynamics; relocalizes from the plasma membrane to the cytoplasm upon DNA replication stress; human homologs PLS3 and LCP1 implicated in spinocerebellar ataxia type 2 (SCA2) can each complement yeast null mutant [Source:SGD;Acc:S000002536])

HSP 1 Score: 326.25 bits (835), Expect = 5.418e-102
Identity = 198/530 (37.36%), Postives = 308/530 (58.11%), Query Frame = 2
Query:  620 THAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHD--ELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSV--FKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPAL------------IVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKV--FQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLR---SYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLT-----NEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLD 2128
            T   HT+ + E R F+  I+ VL+ D      LP   D  +L+++ +DG++L KLIN +VPDT+D RV+N     K +  F+ +EN  + +NSA+AIGC +VN+  EDI +G +HLILGL+WQ+IR GLL  +++  H EL  LL +DETL+   +L PE++LLRW NYHL++A   +R+TNF +D+ D E Y+ LL Q+ PA      L   + L+ TD M+RAE +L NA  LD R ++ P  +           KLNLAFVA+LFNT+P L              D++ E      E + +  W+NS+ V P V  ++ DLK+GL+LLQ  + + PG V++K + +      ++  F+ L N +Y ++  +   F++V +   +I D    + LGL +Q++R   S TMK LS    G+   D  I+ WA  +     K S I SFKD +++ +  +LD+++ I P  VD+ L+T      E   +A+  IS AR++GA I+ +P+ + +V  ++++T  A LM L+
Sbjct:  131 TGTTHTINEEERREFTKHINSVLAGDQDIGDLLPFPTDTFQLFDECRDGLVLSKLINDSVPDTIDTRVLNWPKKGKELNNFQASENANIVINSAKAIGCVVVNVHSEDIIEGREHLILGLIWQIIRRGLLSKIDIKLHPELYRLLEDDETLEQFLRLPPEQILLRWFNYHLKQANWNRRVTNFSKDVSDGENYTILLNQLDPA------LCSKAPLQTTDLMERAEQVLQNAEKLDCRKYLTPSSLVA------GNPKLNLAFVAHLFNTHPGLEPIQEEEKPEIEEFDAEGE-----REARVFTLWLNSLDVDPPVISLFDDLKDGLILLQAYEKVMPGAVDFKHVNKRPASGAEISRFKALENTNYAVDLGRAKGFSLVGIEGSDIVDGNKLLTLGLVWQLMRRNISITMKTLSS--SGRDMSDSQILKWAQDQVTKGGKNSTIRSFKDQALSNAHFLLDVLNGIAPGYVDYDLVTPGNTEEERYANARLAISIARKLGALIWLVPEDINEVRARLIITFIASLMTLN 641          
BLAST of Plastin 3 vs. Ensembl Nematostella
Match: EDO32484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUX1])

HSP 1 Score: 410.223 bits (1053), Expect = 3.153e-134
Identity = 245/612 (40.03%), Postives = 363/612 (59.31%), Query Frame = 2
Query:  335 LNELHDLFPSL-KDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPAL-IVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKV---FQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK--DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD-----AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            + E+ D F    K+  I   +    +K     +PGY+ R +++DV +  +     +  +   K    K  G  F  ++ + +R  VK V  D   S    +H++ D E  GF++WI+  L  D      L    D L+N ++DGV++CKLIN +VP T+DER +N      +V+  +EN  L +NSA AIGC +VNIG ED+ +G  HL+LGL+WQVIRIGL   + + +   LV LL + E LDDL++L PE++LLRW N+ LE AG  +R+ NF  DI D+E YS LL +IAP        P + I    +  +D  K AEL+L NA  +  R F+  +DV       +   KLNLAFV NLFNT+P L  V+ ++   EET EEKT+RNW+NS+G+ P+V+++Y DL +G++L QL D +QPGIV + K+ +   P KK+    + L NC+Y I  A  L F++V +   +I D    ++L L +Q +R+YT+ +L K    +K   + +I+ W N+K  +A K + I+  KDP I TSK +LDLIDAI P ++++ ++     Q+     AK+ IS AR++GAR+YALP+ LV+   KMVMTV+ACLM
Sbjct:    1 MTEMRDGFAKFAKNNKISCDDFAAVMKECSEYVPGYKLRRVVEDVKKENEGQIDFLLFLKLFKDLSIKAAGGDF--KKAVDKREGVKEVGGDSSASAEGTRHSLTDDERIGFTDWINSCLGDDE----DLKEAQDGLFNAVKDGVVMCKLINWSVPHTIDERAINMKKL--NVYTIHENQTLVLNSAMAIGCNIVNIGAEDLIEGKPHLVLGLMWQVIRIGLFAKITIQNCPGLVQLLHDHEELDDLRRLAPEDILLRWFNFQLEDAGHHRRVNNFSSDISDAENYSVLLNKIAP--------PELGIDTPHVSESDPTKLAELVLTNADKMACRKFVRAKDVV------KGNAKLNLAFVCNLFNTFPCLEPVEHEMTDIEETREEKTFRNWINSLGIKPFVQNLYLDLDDGMILFQLFDQVQPGIVNYDKVNK--PPFKKMGAKMKKLENCNYAISVADLLKFSLVGVGGKDINDGNKMLILALLWQTMRAYTLTVLQKCAGSEKPVTEAEIVVWVNEKLSSAGKATTITGMKDPEIKTSKCVLDLIDAIKPKAINYSMVNAGECQEDAFLNAKYAISMARKVGARVYALPEDLVEGKSKMVMTVFACLM 588          
BLAST of Plastin 3 vs. Ensembl Nematostella
Match: EDO40382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7E1])

HSP 1 Score: 400.593 bits (1028), Expect = 8.031e-130
Identity = 254/640 (39.69%), Postives = 366/640 (57.19%), Query Frame = 2
Query:  335 LNELHDLFPSLKDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDK-IPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHDE----LYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKA----------GITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIREETLEEK---------TYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKV--------FQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKD--DKDIIGWANKKTEAANKT---SKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLML 2122
            L E  D F    +  I    +       G  +PGY+ RE+I +  ++ +  I  + F+ +  KV + K  G  F  + +L   + VK      E S    KH+    E+  F++WI+  L +D     YLPI   E    LY K++DG+LLCK+IN + P T+DERV+N    LK VF  +EN  L +NSA AIGC +VNIG  D+ +G KHL+LG++WQVIRIGL   + L +   L  LL+E ET++ L  L+PEELLLRWVN+HL K              K + NF +DI+DSE YS LLYQIAP  +   +  P S    TDN K+AE ML NA  +  R F+  +DV    Q      KLN+AFVANLF+T+P L    D E +E  L+E+         TYRNW+NSMG   YV  +YSD  +G++L ++ + ++PG V+W+K V   +P+ K          + + NC+Y ++  K+ NF+++ +   +I +   N+ LGL +QM+R+YT  LL+++ P      ++ I+ W NK  ++  KT   +K   FKDP I+TS  +LDLID I P  ++  L+  +PL D      A++ IS AR+IGA +YALP+ LV+V  KMV+TV+A LML
Sbjct:   19 LKESFDEFDVDHNGHITVKELGAVFSAAGAEVPGYKVREVISEYDKDQNGTIEFDEFVAMFKKVTD-KYRGAIF--KSLLSTNMGVKHSGGTSESSAEGTKHSHSKEEQVAFADWINSSLKEDESVHKYLPIDASEDSSDLYEKVKDGILLCKMINLSAPGTIDERVINK-PPLK-VFTIHENQTLVINSALAIGCNLVNIGAGDLAEGKKHLVLGVLWQVIRIGLFSKITLTNVPGLARLLQEGETIEGLHHLSPEELLLRWVNFHLGKYYDGQNYPPDDSRRKVVHNFSDDIKDSEAYSILLYQIAP--QSSGVDHPQSYYSTTDNSKKAEKMLRNAEKIGCRKFVRAKDVVSGNQ------KLNMAFVANLFSTFPNLPELDDDEGKEVGLDEEYQEETREELTYRNWINSMGCGRYVNWLYSDFFDGIILFKMFEHIRPGCVDWEKKV---NPEGKCKNARMGGKVKCIENCNYAVDLGKQFNFSLIGIQGQDIHEGVQNLTLGLIWQMMRAYTYTLLARLSPDDDHMTEEKIVEWVNKTLQSKKKTHLINKGHGFKDPDISTSLAVLDLIDCISPKMINPALINPDPLSDEDKLPNAQYAISMARKIGAVVYALPEDLVEVKPKMVLTVFASLML 642          
BLAST of Plastin 3 vs. Ensembl Nematostella
Match: EDO32486 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUX4])

HSP 1 Score: 102.834 bits (255), Expect = 3.287e-26
Identity = 48/99 (48.48%), Postives = 68/99 (68.69%), Query Frame = 2
Query: 1838 IIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD-----AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            I+ W N+K  +A K + I+  KDP I TSK +LDLIDAI P ++++ ++     Q+     AK+ IS AR++GAR+YALP+ LV+   KMVMTV+ACLM
Sbjct:    1 IVVWVNEKLSSAGKATTITGMKDPEIKTSKCVLDLIDAIKPKAINYSMVNAGECQEDAFLNAKYAISMARKVGARVYALPEDLVEGKSKMVMTVFACLM 99          
BLAST of Plastin 3 vs. Ensembl Nematostella
Match: EDO27717 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8H0])

HSP 1 Score: 80.8777 bits (198), Expect = 1.273e-18
Identity = 42/81 (51.85%), Postives = 56/81 (69.14%), Query Frame = 2
Query: 1898 FKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLML 2122
            FKDP I+TS  +LDLID I P  ++  L+  +PL D      A++ IS AR+IGA +YALP+ LV+V  KMV+TV+A LML
Sbjct:    1 FKDPDISTSLAVLDLIDCISPKMINPALINPDPLSDEDKLPNAQYAISMARKIGAVVYALPEDLVEVKPKMVLTVFASLML 81          
BLAST of Plastin 3 vs. Ensembl Medaka
Match: pls3 (plastin-3 [Source:NCBI gene;Acc:101161915])

HSP 1 Score: 448.358 bits (1152), Expect = 3.464e-148
Identity = 265/604 (43.87%), Postives = 371/604 (61.42%), Query Frame = 2
Query:  377 FIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDE-KSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV--DSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEW-KKIVRVFDPKKKV-FQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDII-GWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQD------AKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            FI    + E LK  G PLPGY  RE+++++  N D +I  + F+ +  +++ S+ + +TF  R+ +  +  +  +    E  S   +H+  + E   F NWI+  L KDP C   LP+    D L+  + DG++LCK+IN + PDT+DER +N      + F   ENL LA+NSA AIGC +VNIG  D+ +G  HL+LGL+WQ+I+IGL   + L  +  L ALLR+ ETL+DL +L+PEELLLRW NYHLE AG  K+I NF  DI+DS+ Y HLL QI+P  K DE  P I I        D++KRAE ML  A  L  R F+ P DV           KLNLAFVANLFN YPAL    + DI+   +  ET EE+T+RNWMNS+GV P+V  +Y DL++ LV+LQL + ++ P  V+W  K+ +   PK     + L NC+Y +E  +   F++V +   ++ D  P + L + +Q++R YT+ +L  +  G K + DII  W NK    A K++KISSFKD  I+TS  +L+LIDAI P SV+++L+    L D      AK+ IS AR+IGAR+YALP+ LV+V  KMVMTV+ACLM
Sbjct:   27 FISDYELSELLKEAGHPLPGYRVREILQELDRNKDNQISFDEFLAIVKELRGSQ-VAKTF--RKAINRKEGILAIGGTSELSSVGTQHSFSEEERFAFVNWINTALEKDPDCQHVLPMNPNTDSLFTSVGDGIVLCKMINLSAPDTIDERTINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGALDLKEGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANYHLENAGY-KKINNFSSDIKDSKAYFHLLNQISPKGK-DEGQPCIDINMAGFNEKDDLKRAEAMLQQADRLGCRQFVTPTDVV------NGNPKLNLAFVANLFNKYPALTKPENQDIDWGLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYEKIKIP--VDWNNKVNKPPYPKLGTNMKKLENCNYAVELGRSAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGDGDKVNDDIIVKWVNKTLADAEKSTKISSFKDKEISTSLSVLELIDAIQPGSVNYELIKTSSLSDADKLENAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLM 615          
BLAST of Plastin 3 vs. Ensembl Medaka
Match: lcp1 (plastin-2 [Source:NCBI gene;Acc:101162720])

HSP 1 Score: 436.032 bits (1120), Expect = 1.395e-143
Identity = 258/605 (42.64%), Postives = 378/605 (62.48%), Query Frame = 2
Query:  368 KDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDE-----MLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIV--DSDIE---IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPK-KKVFQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLT------NEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            K+ FI +  + E  K     LPGY  RE+I+++ +  +++  E F  +   +K S ++ +TF  R+ + ++  + +V +   K +  +H+  + E+  F NWI++ L KDP C   LP+    D+L+  + DG++LCK+IN +VPDT+DER +N      + F   ENL LA+NSA AIGC +VNIG ED+ +G +HL+LGL+WQVI+IGL   + L  +  L+ALLR+ E+L+DL +L+PEELLLRW NYHLE+AG  K I NF  DI+DS+ Y +LL Q+AP  K DE     ++  +S ++  +++KRAE ML  A  L  R F+ P DV     RG    KLNLAFVANLFN YPAL    + DI+   I  ET EE+T+RNWMNS+GV P V  +Y+D+ + LV+ QL + ++   V W ++ +   PK     + L NC+Y +E  K +  F++V ++  ++      + L L +Q++R YT+ +L  +  G+K  D  I+ W N     A K + ISSFKD SI++S P+LDLIDAI P S+ + L+        E L +AK+ IS AR+IGAR+YALP+ LV+V  KMVMTV+ACLM
Sbjct:   25 KNGFITKDELNELFKAANLALPGYRIREIIQELTKTSNQLTFEEFTHVVHGLK-STEVAKTF--RKAINKKEGICSV-EGTSKQSGTQHSYSEEEKVAFVNWINKALEKDPDCKHVLPMDPDSDDLFTAMGDGIILCKMINLSVPDTIDERTINKKKL--TPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIELSRNEALIALLRDGESLEDLMKLSPEELLLRWANYHLEEAGCGK-INNFSSDIKDSKAYYNLLNQVAP--KGDEEGIAAIIVDMSGIREKEDLKRAECMLDQADRLSCRQFVMPADVV----RGN--PKLNLAFVANLFNKYPALKKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYADIDDALVIFQLYEKIKVP-VNWDRVNKPPYPKLGSNMKKLENCNYAVELGKNEAKFSLVGIAGQDLNAGNRTLTLALLWQLMRRYTLNILEDLGDGQKVTDDTIVSWVNDTLTHAEKNT-ISSFKDMSISSSMPVLDLIDAIQPGSIRYDLVKAEDLTEEEKLNNAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLM 612          
BLAST of Plastin 3 vs. Ensembl Medaka
Match: ENSORLT00000011106.2 (plastin-3-like [Source:NCBI gene;Acc:101157305])

HSP 1 Score: 430.639 bits (1106), Expect = 2.301e-141
Identity = 256/625 (40.96%), Postives = 384/625 (61.44%), Query Frame = 2
Query:  320 IETETLNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLD-KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHA-KHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHD--ELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISI----LKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIE--IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKV----FQILGNCSYVIEYAK-KLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKD-IIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEP------LQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            +  E + E+ + F  +    + +I    + +  + +G PLPGY+ REL++ +  + D +I  + F  +  ++K+ + + + F  R+ L ++  +  +    E S+   +H++ + E   F+N+I+  L +DP C+ ++PI  +   L+  + DG+LLCKLIN +VPDT+DER +N      + F   ENL LA+NSA AIGC +VNIG +D+ +G  HL+LGL+WQ+I+IGL   + L  +  + ALL++ E+LD L +L+PEELLLRWVN+HL+  G++  ITNF  DI+DS++Y HLL QIAP D   E +P + I    L   D  KRAELML  A  L  R F+   DV           KLNLAFVA LFN +PAL    + E  + +E+ EE+T+RNWMNS+GVTP+V  IY DL++ +V+LQL + ++   V+W   V    P K V     + + NC+Y +E  K K  F++V +   ++ D    + L L +Q++R YT+ LL  +  G+    D II W NK    A+K+S I SFKD SI+TS P+LDLIDAI P SV+F+L+  +       L +AK+ +S AR+IGA++YALP+ LV+V  KMVMT++ACLM
Sbjct:    5 VSAEEIEEIREGFKKVDVDGNGYICAKELGDLFREVGCPLPGYQIRELLQKLDRDKDSRISFDEFTTIFKEMKDDR-MAQGF--RKALNKKEGIVAIGGTSEISSEGTQHSISEQERFAFTNYINTALGEDPDCSHFVPINPNTGALFKAVADGILLCKLINLSVPDTIDERTINKKKL--TPFTTQENLNLALNSASAIGCQVVNIGAQDLKEGKPHLVLGLLWQIIKIGLFAKIQLSRNKAIAALLQDGESLDVLMKLSPEELLLRWVNFHLKTVGMS--ITNFSADIKDSKVYFHLLEQIAP-DGSKEDVPRVEIDMTGLYEKDLKKRAELMLQQAERLGCREFVTATDVVT------GNAKLNLAFVATLFNKHPALTKPENQEWIVEDESREERTFRNWMNSLGVTPHVHYIYGDLQDAMVILQLYEKIKVK-VDWNNRVN-HPPFKGVGGGHLKKIENCNYAVELGKQKAGFSLVGIGGQDLYDGNEMLTLALMWQLMRRYTLNLLEDLGHGEVAGDDLIISWVNKTLAEADKSSSIKSFKDKSISTSLPVLDLIDAIQPESVNFELVKRDAESNADKLDNAKYAVSMARKIGAKVYALPEDLVEVKPKMVMTIFACLM 613          
BLAST of Plastin 3 vs. Ensembl Medaka
Match: pls1 (plastin-1 [Source:NCBI gene;Acc:101168586])

HSP 1 Score: 413.69 bits (1062), Expect = 1.133e-134
Identity = 266/639 (41.63%), Postives = 382/639 (59.78%), Query Frame = 2
Query:  335 LNELHDLFPSL---KDEFIERSNIQEALKVLGFPLPGYEFRELIKDV---PENLD-KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVT-KDDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK-HDE-LYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLP-------PISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALI--------VDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPKKKVFQILG-------NCSYVIEYAKKL-NFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDF---------KLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            L EL + F  +   K  F+    +QE  +     LPGY+ R++I+       N D KI  E F+ ++ K+K S+++  +F  R+VL ++  + +     D  S   +H+  D E+  F NWI++ L  DP C   LP+  +DE L++ L+DG+LLCK+IN + PDT+DERV+NT     + FK  ENL LA+NSA AIGC +VN+   D+  G  HL+LGL+WQVI++GL   + L  + +L+ALL + E L+ L  L+PEELLLRWVNYHL+ A  T++I NF +DI+DS  Y HLL Q+A     +EML         +  L   +  +RAELML  A+ +D R F+ P D+           KLNLAFVANLFN +P L          DS   I  ET EEKT+RNWMNS+GV+P V  +Y DL +GLV+LQL++ ++ P  V WKK   V +P    F +LG       NC+Y ++  K + +F++V +  +N+ + +    L L +Q++R YT+ +LS +  G+K  D+ I+ W N       K S+IS+FKD  I+TS P+ DLID IVP +V +         K+   + L +AK+ IS AR+IGAR+YALP  LV+VN KMVMT++ACLM
Sbjct:   13 LKELEEAFEKIDIDKSGFVSDYELQELFREASVYLPGYKVRDIIETFISGDTNKDQKISFEEFVYIYQKLK-SQELSDSF--RKVLSKKDGIHSFGGTSDISSEGTQHSYADEEKVAFVNWINKALKNDPDCHHVLPMNPNDESLFSSLRDGILLCKMINFSQPDTIDERVINTKKL--TTFKMTENLILALNSASAIGCRVVNVDAHDLKAGKPHLVLGLLWQVIKVGLFADIELSKNEDLIALLEDGEKLEHLMSLSPEELLLRWVNYHLQNAK-TQKIRNFSDDIKDSRAYFHLLNQLAI----EEMLENKRGIRIDMGGLSEFNLERRAELMLQQAAKMDCRQFVSPRDIT------AGNSKLNLAFVANLFNMHPGLRGAKANKGNWDS---IEAETREEKTFRNWMNSLGVSPSVNHLYWDLCDGLVILQLMEKVKVP--VNWKK---VNNPP---FSMLGGNMKKLENCNYAVQLGKNVAHFSLVGVGGENLNEGSRVHTLALVWQLMRRYTVMVLSDLGDGEKIGDQIILNWVNTTLGQKKKASQISNFKDKLISTSMPVFDLIDCIVPGAVKWDMVKKDARGKMSNEDKLDNAKYAISLARKIGARVYALPDDLVEVNPKMVMTLFACLM 624          
BLAST of Plastin 3 vs. Ensembl Medaka
Match: pls1 (plastin-1 [Source:NCBI gene;Acc:101168586])

HSP 1 Score: 411.764 bits (1057), Expect = 1.670e-133
Identity = 267/651 (41.01%), Postives = 384/651 (58.99%), Query Frame = 2
Query:  314 LLIETETLNELH-------DLFPSL-KDEFIERSNIQEALKVLGFPLPGYEFRELIKDV---PENLD-KIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVT-KDDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIK-HDE-LYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLP-------PISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALI--------VDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQ-PGIVEWKKIVRVFDPKKKVFQILG-------NCSYVIEYAKKL-NFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK-DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDF---------KLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 2119
            LL  T  L+ +H       D F  + K  F+    +QE  +     LPGY+ R++I+       N D KI  E F+ ++ K+K S+++  +F  R+VL ++  + +     D  S   +H+  D E+  F NWI++ L  DP C   LP+  +DE L++ L+DG+LLCK+IN + PDT+DERV+NT     + FK  ENL LA+NSA AIGC +VN+   D+  G  HL+LGL+WQVI++GL   + L  + +L+ALL + E L+ L  L+PEELLLRWVNYHL+ A  T++I NF +DI+DS  Y HLL Q+A     +EML         +  L   +  +RAELML  A+ +D R F+ P D+           KLNLAFVANLFN +P L          DS   I  ET EEKT+RNWMNS+GV+P V  +Y DL +GLV+LQL++ ++ P  V WKK+          F +LG       NC+Y ++  K + +F++V +  +N+ + +    L L +Q++R YT+ +LS +  G+K  D+ I+ W N       K S+IS+FKD  I+TS P+ DLID IVP +V +         K+   + L +AK+ IS AR+IGAR+YALP  LV+VN KMVMT++ACLM
Sbjct:   38 LLTHTHHLHYIHEAPLWSRDHFADIDKSGFVSDYELQELFREASVYLPGYKVRDIIETFISGDTNKDQKISFEEFVYIYQKLK-SQELSDSF--RKVLSKKDGIHSFGGTSDISSEGTQHSYADEEKVAFVNWINKALKNDPDCHHVLPMNPNDESLFSSLRDGILLCKMINFSQPDTIDERVINTKKL--TTFKMTENLILALNSASAIGCRVVNVDAHDLKAGKPHLVLGLLWQVIKVGLFADIELSKNEDLIALLEDGEKLEHLMSLSPEELLLRWVNYHLQNAK-TQKIRNFSDDIKDSRAYFHLLNQLAI----EEMLENKRGIRIDMGGLSEFNLERRAELMLQQAAKMDCRQFVSPRDIT------AGNSKLNLAFVANLFNMHPGLRGAKANKGNWDS---IEAETREEKTFRNWMNSLGVSPSVNHLYWDLCDGLVILQLMEKVKVP--VNWKKV------NNPPFSMLGGNMKKLENCNYAVQLGKNVAHFSLVGVGGENLNEGSRVHTLALVWQLMRRYTVMVLSDLGDGEKIGDQIILNWVNTTLGQKKKASQISNFKDKLISTSMPVFDLIDCIVPGAVKWDMVKKDARGKMSNEDKLDNAKYAISLARKIGARVYALPDDLVEVNPKMVMTLFACLM 661          
BLAST of Plastin 3 vs. Planmine SMEST
Match: SMESG000081113.1 (SMESG000081113.1)

HSP 1 Score: 1236.48 bits (3198), Expect = 0.000e+0
Identity = 613/613 (100.00%), Postives = 613/613 (100.00%), Query Frame = 2
Query:  314 LLIETETLNELHDLFPSLKDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDHQISNAKE 2152
            LLIETETLNELHDLFPSLKDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGLVLLQLIDLLQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDHQISNAKE
Sbjct:   10 LLIETETLNELHDLFPSLKDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGLVLLQLIDLLQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDHQISNAKE 622          
BLAST of Plastin 3 vs. Planmine SMEST
Match: SMESG000081126.1 (SMESG000081126.1)

HSP 1 Score: 1029.24 bits (2660), Expect = 0.000e+0
Identity = 526/610 (86.23%), Postives = 558/610 (91.48%), Query Frame = 2
Query:  314 LLIETETLNELHDLFPSLKDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDHQISN 2143
            L +E E + EL++ F +L + FIER NIQEALK+LGF L GY+ R+L+ ++P N D+IP+EMF+ +++K KE K       Q ++   + D + + +   + T A HT+CDSEERGFSNWISRVLSKDPLCA YLPIKHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGLVLLQLIDLLQPGIVEW KI++VFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLR YTM LLS VL  KKDDKDII WAN KTE ANK S+ISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM+LD  I++
Sbjct:   10 LSLEQEIIVELNNRFLTLSNGFIERKNIQEALKILGFSLAGYQLRDLMINIPTNHDEIPIEMFLEIYSKAKELKINPINSYQPKI---KSDKENIPRKVSEGTQAIHTICDSEERGFSNWISRVLSKDPLCASYLPIKHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGLVLLQLIDLLQPGIVEWSKIIKVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRFYTMTLLSSVLRDKKDDKDIIIWANLKTEQANKYSQISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMMLDFDINS 616          
BLAST of Plastin 3 vs. Planmine SMEST
Match: SMESG000070679.1 (SMESG000070679.1)

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 296/519 (57.03%), Postives = 400/519 (77.07%), Query Frame = 2
Query:  605 DDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVD----SDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPG----KKDDKDIIGWANKKTEAANKT-SKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDHQ 2134
            + +    A   V D+EER +S+WI++ L  + +C  YLPI +++LY    DGVLLCK+IN +VPDT+D R +N G  L+++F KNENL LAV SA +IGCC+VNIGP D+  G KH++LGL+WQ+IRIGL+G +NL +HAELVALLR+ E+L+DLKQL+PEE+L+RWVNYH+EKA +++RI+NF  DI DSEIY++L+ QIAP++ R +M+PP  IL++ DN++RAE +L NAS ++A+ F+E  D+AMVTQ+G+NREKLN+AFVA+LFN YPAL +      + +I EETLEEKTYRNWMNSMGV PY+  +YSDL+NG+ LL LID++QP  V W+ +   F+P +K+FQ+  NC   I YAKKLN  +V LSA+NI++    +VLGLCFQ+LR YT +LL K+ P       +DKDII WANKK ++  K+ S I SFKD +I +SKPIL LID+I PNSVD+ ++TN PL DAK+ I+ AR+IGA +YALPQH+VD+NQKM++T+YACLML+D Q
Sbjct:   20 NGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQ 538          
BLAST of Plastin 3 vs. Planmine SMEST
Match: SMESG000007726.1 (SMESG000007726.1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 295/612 (48.20%), Postives = 424/612 (69.28%), Query Frame = 2
Query:  317 LIETETLNELHDLFPSL-KDEFIERSNIQEALKVLGFPLPGYEFRELIKDVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVDVKTVTKDDEKSTHAKHTVCDSEERGFSNWISRVLSKDP-LCAPYLPIKH--DELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPAL---IVDSDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKK--DDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLL 2125
            ++  E +NEL+   P   ++ +I  ++++ A +++G  L   E +E I++   ++  + ++ F  +   +K+   I   F Q  + +E+ D+K  +KD+  +  +KHTV  +EERG+S WI+ +L  D  L   YLP  +  +++Y+K +DG+LLCKLIN AVP+T+DERV+N G SLK  FKK ENL LA+NSA +IGCC+VN+GP DI  GTKH++LGL+WQVIR GLLG +NL+++  L ALL   E++DDLK+L+PE+LL+RWVN+ L+KA    RI NFKED+ + E Y +LL+QIAP DK+  ++ P  I+K  D ++RAEL+L NA+ L+++VF+  ED+     RG+NREKLNLAF+ANLFN+YP+L     +  IEI EETLEEKTYRNW+NS G+   V   Y D  +GLV L + D L PG V W K+VR FD K+++FQ  GNC+ VIE  KK N  I N+S +NI++     +LGLCFQM+R  T+K+L K+  G K  DDKDII W N   E A KTS+I+SFKD +IATS P++DL+DAI P SV + L++++ L+DA + +S AR+IGA  + LP H+  +NQKM+MT++A LM++
Sbjct:    1 MLPLELINELNSRIPEYGENGYIYTTSLRTAFEIVGLELSEPEIKE-IENSLSSVKYLELKNFEEILLVLKKDSIINHVFTQMNLTQEKDDLKIYSKDE--NFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLEEIKNEIVIEIIEETLEEKTYRNWINSQGILTQVNTFYYDTTDGLVFLYIFDKLNPGCVNWSKVVRNFDSKRRLFQEQGNCNEVIEAGKKCNLKIQNMSGENIRNRDKVYILGLCFQMMRYNTIKVLEKLCGGGKKIDDKDIISWVNDTLEKAGKTSRITSFKDRNIATSLPVIDLVDAIKPGSVQYSLISSDRLKDASYAVSMARKIGANAFVLPDHIASLNQKMIMTLFASLMIV 609          
BLAST of Plastin 3 vs. Planmine SMEST
Match: SMESG000048251.1 (SMESG000048251.1)

HSP 1 Score: 308.531 bits (789), Expect = 5.489e-96
Identity = 171/506 (33.79%), Postives = 281/506 (55.53%), Query Frame = 2
Query:  647 SEERGFSNWISRVLSKDPLCAPYLPIK--HDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIRE------------ETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGXXXXXXXXXXQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLML 2122
            SE+R +S WI++VL+ DP C  YLP+    D++Y+K+QDGV+LCKL+N ++P  +DER MN G  L +  +K ENL L +N+A   GC M N    DI  G K+  +  +WQ+IRIG L  V   +H E+V L +  ++LDDL++ +  ++++R+ NYHL K+G+   + ++ +D +D  +Y+HL Y++APA  R +M+ P +I +      RA  ++ N   L A  F+  +D+    +R  +  KL+L  +  LF  +     + D+ +              E LEE T RN++NS  V P+   + +D +NG +L +L ++L+PG     K +  FD  +   Q + NC+ +++ A+    N  NL A+ I D+  + +LGL  +M+R+Y       V      +K+I+ WAN +   + K S + SF D  IA       +++++ P  VD   L N  L +A + +S A + G  +Y LP+H V+ N K V   +A LM+
Sbjct:   16 SEKRAYSRWINKVLANDPDCRQYLPLDPYGDDIYDKVQDGVILCKLLNISLPGAIDERTMNRGQRLLNYAQKMENLALVLNAARCRGCSMGNADINDIYAGVKYATIDFIWQIIRIGFLHDVTFHNHPEIVELKKVGDSLDDLREQSSHDIIIRYANYHLSKSGMRNFVNDYDDDFKDCLVYAHLTYRVAPATIRGKMISPTNITRERCVEARARNIIRNLEELGAESFLTEDDIINGFERRDSCSKLHLCTIGYLFKHF-----NGDLSVHRPVYRTKNNSGNGECLEELTCRNFLNSFDVYPFCNHVLNDCRNGWILGELFEVLRPGYTSGVKFILDFDSNRIHAQRVHNCTKIVKLAQNYVLNTPNLDAEKIADSDKSSILGLIVEMMRAY-------VCRDNYIEKEILDWANCQLRKSGKQSMMRSFGDRIIAEDNLFAVVLESVAPGLVDRSCLGNNKLLNAYYYVSIAHKAGIPVYTLPEHFVEGNAKFVALAFATLMV 509          
The following BLAST results are available for this feature:
BLAST of Plastin 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLS32.250e-14342.22plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091][more]
PLS32.250e-14342.22plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091][more]
LCP12.404e-14142.22lymphocyte cytosolic protein 1 [Source:HGNC Symbol... [more]
LCP12.404e-14142.22lymphocyte cytosolic protein 1 [Source:HGNC Symbol... [more]
PLS18.766e-14142.45plastin 1 [Source:HGNC Symbol;Acc:HGNC:9090][more]
back to top
BLAST of Plastin 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plst-11.678e-9546.11PLaSTin (Actin bundling protein) homolog [Source:... [more]
plst-18.042e-9545.45PLaSTin (Actin bundling protein) homolog [Source:... [more]
Y73B3B.13.011e-2941.67pep chromosome:WBcel235:X:209108:211241:-1 gene:WB... [more]
fln-14.293e-832.14FiLamiN (Actin binding protein) homolog [Source:U... [more]
fln-14.293e-832.14FiLamiN (Actin binding protein) homolog [Source:U... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Fim2.122e-15342.63gene:FBgn0024238 transcript:FBtr0074443[more]
Fim8.359e-15342.74gene:FBgn0024238 transcript:FBtr0074442[more]
Fim1.905e-15242.74gene:FBgn0024238 transcript:FBtr0074441[more]
back to top
BLAST of Plastin 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pls12.045e-14741.80plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-03... [more]
pls11.070e-14641.80plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-03... [more]
pls35.716e-14442.22plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pls35.716e-14442.22plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
lcp12.752e-14342.04lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx52.107e-14442.46sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018... [more]
snx52.441e-14442.46sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018... [more]
snx52.443e-14442.46sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018... [more]
colgalt21.153e-14342.45collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
colgalt26.028e-14343.16collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lcp15.788e-14942.38lymphocyte cytosolic protein 1 [Source:MGI Symbol;... [more]
Lcp15.788e-14942.38lymphocyte cytosolic protein 1 [Source:MGI Symbol;... [more]
Lcp15.788e-14942.38lymphocyte cytosolic protein 1 [Source:MGI Symbol;... [more]
Pls11.640e-14642.13plastin 1 (I-isoform) [Source:MGI Symbol;Acc:MGI:1... [more]
Pls32.195e-14442.06plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Plastin 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q61233|PLSL_MOUSE4.049e-14842.38Plastin-2 OS=Mus musculus OX=10090 GN=Lcp1 PE=1 SV... [more]
sp|A6H742|PLSI_BOVIN3.934e-14742.29Plastin-1 OS=Bos taurus OX=9913 GN=PLS1 PE=2 SV=1[more]
sp|Q3V0K9|PLSI_MOUSE1.147e-14542.13Plastin-1 OS=Mus musculus OX=10090 GN=Pls1 PE=1 SV... [more]
sp|P19179|PLSI_CHICK7.154e-14442.65Plastin-1 OS=Gallus gallus OX=9031 GN=PLS1 PE=1 SV... [more]
sp|Q6P698|PLSL_DANRE2.229e-14342.45Plastin-2 OS=Danio rerio OX=7955 GN=lcp1 PE=2 SV=1[more]
back to top
BLAST of Plastin 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3TJV92.245e-16648.94Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A1I8JAL80.000e+049.12Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A564YG160.000e+049.11Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A158QUU34.036e-15648.95Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3ETD10.000e+048.95Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lcp16.662e-14942.45lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
pls33.355e-12341.93plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pls12.611e-11237.22plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-03... [more]
flna2.047e-825.60filamin A, alpha (actin binding protein 280) [Sour... [more]
flncb1.609e-726.83filamin C, gamma b (actin binding protein 280) [So... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lcp16.662e-7143.03lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SAC65.418e-10237.36Fimbrin, actin-bundling protein; cooperates with S... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO324843.153e-13440.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403828.031e-13039.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324863.287e-2648.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277171.273e-1851.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pls33.464e-14843.87plastin-3 [Source:NCBI gene;Acc:101161915][more]
lcp11.395e-14342.64plastin-2 [Source:NCBI gene;Acc:101162720][more]
ENSORLT00000011106.22.301e-14140.96plastin-3-like [Source:NCBI gene;Acc:101157305][more]
pls11.133e-13441.63plastin-1 [Source:NCBI gene;Acc:101168586][more]
pls11.670e-13341.01plastin-1 [Source:NCBI gene;Acc:101168586][more]
back to top
BLAST of Plastin 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081113.10.000e+0100.00SMESG000081113.1[more]
SMESG000081126.10.000e+086.23SMESG000081126.1[more]
SMESG000070679.10.000e+057.03SMESG000070679.1[more]
SMESG000007726.10.000e+048.20SMESG000007726.1[more]
SMESG000048251.15.489e-9633.79SMESG000048251.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025105 ID=SMED30025105|Name=Plastin 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2318bp
AAAGTCATTTGGCGATGTTTGTGCGTGTGTGTATTCTTAATCAACGAATA
CCATTCAATGCTTTATTTGTAATCTGAACTACTTGATAACTATGCTACTA
CACAATCAATACTATGATAATTACGATGTAATACAATGATGCATTAGTTG
TGTATAGCGCATTCATTAGGTATAAATACGACTCCGCCATACGAAAATGT
AAATTCATTATCAATTATTACTTGAAAATCAAGGCCTAAGTTCAATTGTA
TAAAAATCCATTTTTCAGATAAAATTTAGTTCTAAAATGTCAAGATCTCA
GATATCTCAAAGTTTATTAATAGAAACTGAAACTTTAAATGAATTACATG
ATCTTTTTCCTAGTTTAAAAGATGAATTCATAGAACGATCGAATATTCAA
GAAGCATTAAAAGTACTTGGATTTCCATTGCCAGGATATGAGTTTCGAGA
ATTGATTAAAGATGTTCCAGAAAACTTGGACAAAATCCCTGTTGAAATGT
TTATGATGCTTCACGCCAAAGTTAAAGAATCGAAAGACATTGGAAGAACA
TTTCAACAAAGACGAGTTCTTAAAGAGAGAGTTGATGTTAAAACTGTTAC
CAAGGATGACGAAAAATCTACACACGCTAAACATACTGTTTGCGATTCAG
AAGAAAGAGGTTTCTCAAACTGGATAAGTAGAGTGTTATCTAAAGACCCA
CTTTGCGCGCCGTATCTACCTATTAAGCATGATGAACTCTATAATAAACT
CCAAGATGGTGTACTTCTATGCAAACTTATTAATTCGGCTGTCCCTGATA
CTGTAGATGAACGAGTAATGAATACTGGTGCAAGTTTGAAGAGTGTTTTC
AAGAAAAACGAGAATTTATGTTTAGCAGTTAATTCTGCTGAAGCTATCGG
ATGCTGCATGGTTAACATTGGACCGGAGGACATTGACAAAGGAACAAAAC
ATTTGATACTTGGATTGGTATGGCAAGTCATTAGAATTGGTTTACTAGGT
TTGGTAAATTTATTACATCACGCAGAGTTAGTTGCTCTATTGCGAGAAGA
TGAAACTTTGGACGATTTAAAACAATTGACTCCAGAAGAACTATTATTAA
GATGGGTGAACTATCATTTGGAGAAGGCTGGAATAACGAAACGCATCACG
AATTTCAAGGAAGACATTCAAGATTCAGAAATCTATTCTCATTTGTTATA
TCAAATTGCTCCAGCTGATAAACGAGATGAAATGTTGCCACCGATTTCAA
TTTTAAAAAACACTGACAATATGAAACGAGCTGAATTAATGCTTGGAAAT
GCTTCAATATTGGATGCTCGAGTTTTCATTGAGCCCGAAGATGTAGCAAT
GGTAACTCAAAGAGGACAAAATCGAGAAAAATTGAATTTAGCATTTGTTG
CTAATTTATTCAATACTTATCCAGCTCTAATTGTAGATTCAGATATTGAA
ATTCGAGAAGAAACTTTAGAAGAAAAAACATACAGAAATTGGATGAATTC
GATGGGAGTGACACCATATGTCAAAGACATTTATTCTGATTTGAAGAACG
GTTTAGTTTTGTTACAACTAATAGATTTGTTGCAGCCAGGAATTGTTGAA
TGGAAAAAAATTGTTCGTGTTTTCGATCCTAAAAAGAAAGTTTTCCAAAT
ACTCGGCAATTGCTCTTATGTAATAGAATATGCAAAGAAATTGAATTTCA
ACATTGTAAATCTTAGTGCAGATAACATCAAAGATGCCACACCAAATATG
GTTTTAGGATTATGCTTTCAAATGCTTCGCAGCTATACTATGAAACTGTT
AAGCAAAGTTTTACCTGGCAAAAAAGACGACAAAGATATTATCGGATGGG
CTAACAAGAAAACCGAAGCTGCAAATAAAACTTCAAAAATATCTAGTTTT
AAAGATCCATCTATTGCAACTTCCAAGCCTATATTGGACTTAATTGATGC
GATTGTTCCAAATTCCGTTGATTTTAAATTACTGACCAATGAGCCATTGC
AAGATGCTAAGTTTACCATTTCACAAGCTCGACGAATCGGAGCTCGAATT
TATGCGCTTCCGCAACATCTTGTTGATGTCAATCAAAAAATGGTAATGAC
TGTTTACGCATGTTTAATGTTGTTGGATCATCAAATCAGTAATGCAAAAG
AATGAAAAATTAACGTTCGAATTTTCAAGAATTACAACGAACTTTATTAG
TAATAATATTTACAATTTTCTCTTGTGATAATTTATAATTTTGATAATTA
ATTTTGATGCAAATGATTTGATCTTGTTTACTATATTAGCTTTCTAAGGA
ACAATTTATAACTGATAC
back to top

protein sequence of SMED30025105-orf-1

>SMED30025105-orf-1 ID=SMED30025105-orf-1|Name=SMED30025105-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=623bp
MSRSQISQSLLIETETLNELHDLFPSLKDEFIERSNIQEALKVLGFPLPG
YEFRELIKDVPENLDKIPVEMFMMLHAKVKESKDIGRTFQQRRVLKERVD
VKTVTKDDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHDE
LYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNS
AEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVA
LLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIY
SHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEP
EDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIEIREETLEEKTYR
NWMNSMGVTPYVKDIYSDLKNGLVLLQLIDLLQPGIVEWKKIVRVFDPKK
KVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSY
TMKLLSKVLPGKKDDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPIL
DLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQ
KMVMTVYACLMLLDHQISNAKE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0051015actin filament binding
GO:0005515protein binding
GO:0003779actin binding
Vocabulary: biological process
TermDefinition
GO:0051017actin filament bundle assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000103central nervous system
PLANA:0000208testis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR039959Fimbrin/Plastin
IPR001715CH-domain
IPR001589Actinin_actin-bd_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 218..322
e-value: 2.1E-16
score: 70.5
coord: 89..200
e-value: 8.4E-13
score: 58.5
coord: 337..436
e-value: 1.2E-11
score: 54.7
IPR001715Calponin homology domainPFAMPF00307CHcoord: 338..435
e-value: 5.9E-11
score: 42.5
coord: 218..321
e-value: 4.4E-14
score: 52.6
coord: 88..202
e-value: 4.4E-16
score: 59.0
coord: 9..57
e-value: 2.5E-6
score: 27.7
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 87..202
score: 16.368
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 335..438
score: 13.848
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 1..59
score: 12.244
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 216..324
score: 20.068
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 333..435
e-value: 1.2E-24
score: 88.4
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 62..198
e-value: 4.5E-34
score: 119.3
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 2..61
e-value: 2.6E-14
score: 55.1
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 213..331
e-value: 5.5E-29
score: 102.6
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 8..434
IPR039959Fimbrin/PlastinPANTHERPTHR19961FIMBRIN/PLASTINcoord: 6..441
NoneNo IPR availablePANTHERPTHR19961:SF18FI19014P1coord: 6..441
IPR001589Actinin-type actin-binding domain, conserved sitePROSITEPS00019ACTININ_1coord: 218..227