TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30025100
Uniprot Best hitTNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1 (E=3.69372e-24)
Length (bp)1535
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30025100) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30025100) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30025100) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30025100) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025100

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30025100SMESG000015041.1 dd_Smed_v4_6890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30025100SMESG000015041.1 dd_Smed_v4_6890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025100SMESG000015041.1 dd_Smed_v4_6890_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30025100SMESG000015041.1 dd_Smed_v4_6890_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30025100SMESG000015041.1 dd_Smed_v4_6890_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 103.605 bits (257), Expect = 6.013e-23
Identity = 61/196 (31.12%), Postives = 99/196 (50.51%), Query Frame = 3
Query:  726 QETVENLKDENKDLKRLIDKQGLSVITL--------TPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            Q+ +E L  + + L+R I  + L++  L          TYD      F+W++++F+RK+Q+A   R   IFS  FY++  GYK+CL +Y NG     G  L +FF ++   ND  L WP   +V L +LD N  ++H +  F     S     SF +P +D N   G   F    ++ +  +  ++D I IK ++D
Sbjct:  311 QDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYD----GVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNN-REHVIDAFRPDVTSS----SFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 93.9745 bits (232), Expect = 7.564e-20
Identity = 65/244 (26.64%), Postives = 115/244 (47.13%), Query Frame = 3
Query:  630 MDELKQKLENCNQELNYFKK---QLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITLT------PTYDIHKP---------------KPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            +D   +KL+  ++E+  F++   + D+ +  +ESLQ  V  L+  +K   ++    GL    L+        +DI                     +W++ ++ R++Q+A + +   ++S PFY+ Y GYK+C  +Y NG    +G  L +FF I+  + D  L WP + +V L ++D  + + H    F     S     SF KP  + N   G   F++   L +   I K+DTI IK ++D
Sbjct:  240 IDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSS----SFKKPTGEMNIASGCPVFVAQTVLENGTYI-KDDTIFIKVIVD 478          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 93.9745 bits (232), Expect = 1.047e-19
Identity = 65/244 (26.64%), Postives = 115/244 (47.13%), Query Frame = 3
Query:  630 MDELKQKLENCNQELNYFKK---QLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITLT------PTYDIHKP---------------KPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            +D   +KL+  ++E+  F++   + D+ +  +ESLQ  V  L+  +K   ++    GL    L+        +DI                     +W++ ++ R++Q+A + +   ++S PFY+ Y GYK+C  +Y NG    +G  L +FF I+  + D  L WP + +V L ++D  + + H    F     S     SF KP  + N   G   F++   L +   I K+DTI IK ++D
Sbjct:  323 IDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSS----SFKKPTGEMNIASGCPVFVAQTVLENGTYI-KDDTIFIKVIVD 561          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 93.9745 bits (232), Expect = 1.047e-19
Identity = 65/244 (26.64%), Postives = 115/244 (47.13%), Query Frame = 3
Query:  630 MDELKQKLENCNQELNYFKK---QLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITLT------PTYDIHKP---------------KPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            +D   +KL+  ++E+  F++   + D+ +  +ESLQ  V  L+  +K   ++    GL    L+        +DI                     +W++ ++ R++Q+A + +   ++S PFY+ Y GYK+C  +Y NG    +G  L +FF I+  + D  L WP + +V L ++D  + + H    F     S     SF KP  + N   G   F++   L +   I K+DTI IK ++D
Sbjct:  323 IDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSS----SFKKPTGEMNIASGCPVFVAQTVLENGTYI-KDDTIFIKVIVD 561          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 93.5893 bits (231), Expect = 1.091e-19
Identity = 65/244 (26.64%), Postives = 115/244 (47.13%), Query Frame = 3
Query:  630 MDELKQKLENCNQELNYFKK---QLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITLT------PTYDIHKP---------------KPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            +D   +KL+  ++E+  F++   + D+ +  +ESLQ  V  L+  +K   ++    GL    L+        +DI                     +W++ ++ R++Q+A + +   ++S PFY+ Y GYK+C  +Y NG    +G  L +FF I+  + D  L WP + +V L ++D  + + H    F     S     SF KP  + N   G   F++   L +   I K+DTI IK ++D
Sbjct:  298 IDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSS----SFKKPTGEMNIASGCPVFVAQTVLENGTYI-KDDTIFIKVIVD 536          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 72.4034 bits (176), Expect = 2.663e-13
Identity = 47/182 (25.82%), Postives = 88/182 (48.35%), Query Frame = 3
Query:  759 KDLKRLIDKQGLSVITLTPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKL--CLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSES---KSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            +D+    D+Q   +       ++  P+  +W++ +  ++  +AK    T IFS PF S+  GYK+  C  ++ +G S   GK + ++  +L  + D  L WP    + +S+LD N   + +V    Y  +    K+ E   ++P  +RN   G   F S   L+ ++N  K+D I ++  +D
Sbjct:  238 RDMGSFNDRQTRILSAAETCTEMFGPQ-LIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSS--AGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRV-NITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCS---LAILQNYVKDDKIYVQIDVD 412          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 55.0694 bits (131), Expect = 4.660e-8
Identity = 37/125 (29.60%), Postives = 56/125 (44.80%), Query Frame = 3
Query:  909 IFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFK---ELSSMKNIFKNDTILI 1274
            I+S PFYS+  GYK+     P G      ++  VF C++  + D  L WP R  V  SIL  +  K   + K  Y +E    +    +PE  RN   G   F+      E ++  +IF    +L+
Sbjct:  183 IYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDD--KKELLTKTIYVNEMPEIQEFLERPEGLRNGTFGFQNFLPLAKVTEFAADGDIFIQIKVLL 305          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 72.4034 bits (176), Expect = 2.956e-13
Identity = 40/151 (26.49%), Postives = 72/151 (47.68%), Query Frame = 3
Query:  843 FLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRND-GIGDNEFISFKELSSMKNIFKNDTILIKCVIDP 1292
             LW++T++S K  +A+      + S PFY++  GYKL   M+ NG    E   + V+  +LP + D  L WP  H +  ++ +            ++  +      +F +P ++ +  G G   FIS + L S +   K DT+ ++  +DP
Sbjct:  333 LLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPT--WENFQRPSNEPDQLGFGFPRFISHELLHS-RPFIKGDTVFLRVKVDP 480          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 72.4034 bits (176), Expect = 3.150e-13
Identity = 40/151 (26.49%), Postives = 72/151 (47.68%), Query Frame = 3
Query:  843 FLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRND-GIGDNEFISFKELSSMKNIFKNDTILIKCVIDP 1292
             LW++T++S K  +A+      + S PFY++  GYKL   M+ NG    E   + V+  +LP + D  L WP  H +  ++ +            ++  +      +F +P ++ +  G G   FIS + L S +   K DT+ ++  +DP
Sbjct:  324 LLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPT--WENFQRPSNEPDQLGFGFPRFISHELLHS-RPFIKGDTVFLRVKVDP 471          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074275)

HSP 1 Score: 57.7658 bits (138), Expect = 1.252e-8
Identity = 42/151 (27.81%), Postives = 74/151 (49.01%), Query Frame = 3
Query:  843 FLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNT-LKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEF--ISFKELSSMKNIFKNDTILIKCVI 1286
             +WR+ ++S+K +++K    TI+ S  F +   GY L L +Y NG   ++G+ +     +L  + D  L+WP R Q  + I D  T + D + Y    F   KS            +D I  N++  I  K ++S +N  +ND++ I+  +
Sbjct:  336 LIWRIKDYSKKLEESK-QYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVADAEDYVKTIFVRKKS------------DDFIQSNQYFHIPHKVITS-RNYLRNDSMFIEVRV 472          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 57.3806 bits (137), Expect = 1.429e-8
Identity = 42/151 (27.81%), Postives = 74/151 (49.01%), Query Frame = 3
Query:  843 FLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNT-LKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEF--ISFKELSSMKNIFKNDTILIKCVI 1286
             +WR+ ++S+K +++K    TI+ S  F +   GY L L +Y NG   ++G+ +     +L  + D  L+WP R Q  + I D  T + D + Y    F   KS            +D I  N++  I  K ++S +N  +ND++ I+  +
Sbjct:  257 LIWRIKDYSKKLEESK-QYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVADAEDYVKTIFVRKKS------------DDFIQSNQYFHIPHKVITS-RNYLRNDSMFIEVRV 393          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074274)

HSP 1 Score: 57.3806 bits (137), Expect = 1.429e-8
Identity = 42/151 (27.81%), Postives = 74/151 (49.01%), Query Frame = 3
Query:  843 FLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNT-LKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEF--ISFKELSSMKNIFKNDTILIKCVI 1286
             +WR+ ++S+K +++K    TI+ S  F +   GY L L +Y NG   ++G+ +     +L  + D  L+WP R Q  + I D  T + D + Y    F   KS            +D I  N++  I  K ++S +N  +ND++ I+  +
Sbjct:  257 LIWRIKDYSKKLEESK-QYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVADAEDYVKTIFVRKKS------------DDFIQSNQYFHIPHKVITS-RNYLRNDSMFIEVRV 393          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 108.612 bits (270), Expect = 3.475e-26
Identity = 62/196 (31.63%), Postives = 101/196 (51.53%), Query Frame = 3
Query:  726 QETVENLKDENKDLKRLIDKQGLSVITL--------TPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            Q+ +E L ++ + L+R +  + LS++ +          TYD      F+W++++FS+K+QDA   R   +FS  FY++  GYK+CL +Y NG     G  L +FF ++   +D  L WP   +V L +LD N  ++H +  F           SF +P SD N   G   F    +L S  +  ++DTI IK ++D
Sbjct:   85 QDKIEILNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYD----GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN-REHIIDAF----RPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 271          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 108.612 bits (270), Expect = 3.475e-26
Identity = 62/196 (31.63%), Postives = 101/196 (51.53%), Query Frame = 3
Query:  726 QETVENLKDENKDLKRLIDKQGLSVITL--------TPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            Q+ +E L ++ + L+R +  + LS++ +          TYD      F+W++++FS+K+QDA   R   +FS  FY++  GYK+CL +Y NG     G  L +FF ++   +D  L WP   +V L +LD N  ++H +  F           SF +P SD N   G   F    +L S  +  ++DTI IK ++D
Sbjct:   85 QDKIEILNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYD----GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN-REHIIDAF----RPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 271          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 110.538 bits (275), Expect = 2.077e-25
Identity = 67/216 (31.02%), Postives = 109/216 (50.46%), Query Frame = 3
Query:  687 KQLDTNELFLESL-------QETVENLKDENKDLKRLIDKQGLSVITLTP--------TYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            K+++ + L +E++       QE +ENL ++ + L+R +  + L +             TYD      F+W++ EFSR++QDA   R   +FS  FYS+  GYK+CL +Y NG     G  L +FF ++  + D  L WP   +V L +LD N  ++H +  F     S     SF +P S+ N   G   F    +L+   +  ++DTI IK ++D
Sbjct:  322 KEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYD----GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNN-REHIIDAFRPDVSST----SFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 528          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 110.538 bits (275), Expect = 2.077e-25
Identity = 67/216 (31.02%), Postives = 109/216 (50.46%), Query Frame = 3
Query:  687 KQLDTNELFLESL-------QETVENLKDENKDLKRLIDKQGLSVITLTP--------TYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            K+++ + L +E++       QE +ENL ++ + L+R +  + L +             TYD      F+W++ EFSR++QDA   R   +FS  FYS+  GYK+CL +Y NG     G  L +FF ++  + D  L WP   +V L +LD N  ++H +  F     S     SF +P S+ N   G   F    +L+   +  ++DTI IK ++D
Sbjct:  322 KEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYD----GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNN-REHIIDAFRPDVSST----SFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 528          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 110.153 bits (274), Expect = 3.166e-25
Identity = 67/216 (31.02%), Postives = 109/216 (50.46%), Query Frame = 3
Query:  687 KQLDTNELFLESL-------QETVENLKDENKDLKRLIDKQGLSVITLTP--------TYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            K+++ + L +E++       QE +ENL ++ + L+R +  + L +             TYD      F+W++ EFSR++QDA   R   +FS  FYS+  GYK+CL +Y NG     G  L +FF ++  + D  L WP   +V L +LD N  ++H +  F     S     SF +P S+ N   G   F    +L+   +  ++DTI IK ++D
Sbjct:  335 KEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYD----GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNN-REHIIDAFRPDVSST----SFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 541          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 107.842 bits (268), Expect = 1.641e-24
Identity = 66/200 (33.00%), Postives = 100/200 (50.00%), Query Frame = 3
Query:  714 LESLQETVENLKDENKDLKRLIDKQGLSVITLT--------PTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            L + QE VE L  + + L+R + ++ L V  L          TYD      F+W+++EF +K+QDA   R   +FS PFY+N  GYK+CL +Y NG        L +FF ++   ND  L WP   +V L +LD N  ++H +  F     S     SF +P S+ N   G   F    +L    +  ++DTI +K ++D
Sbjct:  287 LRAAQEKVEALTTKVRQLERTLGQKELIVAELETRMQESELSTYD----GVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNN-REHVIDAFRPDVSSS----SFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVD 477          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 102.449 bits (254), Expect = 7.710e-23
Identity = 62/198 (31.31%), Postives = 97/198 (48.99%), Query Frame = 3
Query:  720 SLQETVENLKDENKDLKRLIDKQGLSVITLT--------PTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            + +E    L+  +  L+R + ++ L V  L          TYD      F+W+++EF +K+QDA   R   +FS PFY+N  GYK+CL +Y NG        L +FF ++   ND  L WP   +V L +LD N  ++H +  F     S     SF +P S+ N   G   F    +L    +  ++DTI +K ++D
Sbjct:  262 AAEELARQLRAADTRLERTLGQKELIVAELETRMQESELSTYD----GVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNN-REHVIDAFRPDVSSS----SFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVD 450          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 99.3673 bits (246), Expect = 1.083e-21
Identity = 61/208 (29.33%), Postives = 109/208 (52.40%), Query Frame = 3
Query:  684 KKQLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITLTPTYDIHKPKPF----LWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKN--IFKNDTILIKCVID 1289
            K++L T    LE+ ++ ++NL  + K    L+    + + +    + + +   +    +W++T++ RK+++A   R   IFS  FY+++ GY+LC   Y NG  + +G FL ++F ++  + D  L WP + +V L +LD +  K+H    F     S     SF +P+S+ N   G   F S  +L + KN    K+DT+ IK V+D
Sbjct:  282 KQRLST----LEAYKDRIDNLDGQFKKHDVLLSNHKMQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSS----SFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 481          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 99.7525 bits (247), Expect = 1.127e-21
Identity = 62/212 (29.25%), Postives = 110/212 (51.89%), Query Frame = 3
Query:  672 LNYFKKQLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITLTPTYDIHKPKPF----LWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKN--IFKNDTILIKCVID 1289
            L   K++L T    LE+ ++ ++NL  + K    L+    + + +    + + +   +    +W++T++ RK+++A   R   IFS  FY+++ GY+LC   Y NG  + +G FL ++F ++  + D  L WP + +V L +LD +  K+H    F     S     SF +P+S+ N   G   F S  +L + KN    K+DT+ IK V+D
Sbjct:  329 LESTKQRLST----LEAYKDRIDNLDGQFKKHDVLLSNHKMQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSS----SFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 532          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 99.7525 bits (247), Expect = 1.251e-21
Identity = 61/208 (29.33%), Postives = 109/208 (52.40%), Query Frame = 3
Query:  684 KKQLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITLTPTYDIHKPKPF----LWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKN--IFKNDTILIKCVID 1289
            K++L T    LE+ ++ ++NL  + K    L+    + + +    + + +   +    +W++T++ RK+++A   R   IFS  FY+++ GY+LC   Y NG  + +G FL ++F ++  + D  L WP + +V L +LD +  K+H    F     S     SF +P+S+ N   G   F S  +L + KN    K+DT+ IK V+D
Sbjct:  332 KQRLST----LEAYKDRIDNLDGQFKKHDVLLSNHKMQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSS----SFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 531          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 108.997 bits (271), Expect = 5.281e-25
Identity = 63/196 (32.14%), Postives = 101/196 (51.53%), Query Frame = 3
Query:  726 QETVENLKDENKDLKRLIDKQGLSVITL--------TPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            Q+ +E L ++ + L+R I  + L++  L          TYD      F+W++++F+RK+Q+A   R   IFS  FY++  GYK+CL +Y NG     G  L +FF ++   ND  L WP   +V L +LDHN  ++H +  F     S     SF +P SD N   G   F    ++ +  +  ++D I IK ++D
Sbjct:  311 QDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYD----GVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNN-REHVIDAFRPDVTSS----SFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 108.997 bits (271), Expect = 5.692e-25
Identity = 63/196 (32.14%), Postives = 101/196 (51.53%), Query Frame = 3
Query:  726 QETVENLKDENKDLKRLIDKQGLSVITL--------TPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            Q+ +E L ++ + L+R I  + L++  L          TYD      F+W++++F+RK+Q+A   R   IFS  FY++  GYK+CL +Y NG     G  L +FF ++   ND  L WP   +V L +LDHN  ++H +  F     S     SF +P SD N   G   F    ++ +  +  ++D I IK ++D
Sbjct:  318 QDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYD----GVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNN-REHVIDAFRPDVTSS----SFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 504          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 94.3597 bits (233), Expect = 2.778e-21
Identity = 48/150 (32.00%), Postives = 82/150 (54.67%), Query Frame = 3
Query:  843 FLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIF-KNDTILIKCVID 1289
             +W+VT++  K+++A       +FS PFY++  GY+LC   Y NG  + +G  L ++F ++  + D  L WP R +V L +LD +  K+H V  F    ++     SF +P+ + N   G   F+S   L + KN + K+DT+ +K  +D
Sbjct:   98 LIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETF----KADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 243          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 94.3597 bits (233), Expect = 2.778e-21
Identity = 48/150 (32.00%), Postives = 82/150 (54.67%), Query Frame = 3
Query:  843 FLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIF-KNDTILIKCVID 1289
             +W+VT++  K+++A       +FS PFY++  GY+LC   Y NG  + +G  L ++F ++  + D  L WP R +V L +LD +  K+H V  F    ++     SF +P+ + N   G   F+S   L + KN + K+DT+ +K  +D
Sbjct:   98 LIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETF----KADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 243          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 95.9005 bits (237), Expect = 1.753e-20
Identity = 49/150 (32.67%), Postives = 81/150 (54.00%), Query Frame = 3
Query:  843 FLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIF-KNDTILIKCVID 1289
             +W+VT++  K+++A       +FS PFY++  GY+LC   Y NG  + +G  L ++F ++  + D  L WP R +V L +LD +  K+H V  F     S     SF +P+ + N   G   F+S   L + KN + K+DT+ +K  +D
Sbjct:  400 LIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSS----SFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 545          
BLAST of TNF receptor-associated factor vs. UniProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 3.694e-24
Identity = 63/196 (32.14%), Postives = 101/196 (51.53%), Query Frame = 3
Query:  726 QETVENLKDENKDLKRLIDKQGLSVITL--------TPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            Q+ +E L ++ + L+R I  + L++  L          TYD      F+W++++F+RK+Q+A   R   IFS  FY++  GYK+CL +Y NG     G  L +FF ++   ND  L WP   +V L +LDHN  ++H +  F     S     SF +P SD N   G   F    ++ +  +  ++D I IK ++D
Sbjct:  311 QDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYD----GVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNN-REHVIDAFRPDVTSS----SFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. UniProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 2.888e-22
Identity = 61/196 (31.12%), Postives = 99/196 (50.51%), Query Frame = 3
Query:  726 QETVENLKDENKDLKRLIDKQGLSVITL--------TPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            Q+ +E L  + + L+R I  + L++  L          TYD      F+W++++F+RK+Q+A   R   IFS  FY++  GYK+CL +Y NG     G  L +FF ++   ND  L WP   +V L +LD N  ++H +  F     S     SF +P +D N   G   F    ++ +  +  ++D I IK ++D
Sbjct:  311 QDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYD----GVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNN-REHVIDAFRPDVTSS----SFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. UniProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 7.698e-20
Identity = 49/150 (32.67%), Postives = 81/150 (54.00%), Query Frame = 3
Query:  843 FLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIF-KNDTILIKCVID 1289
             +W+VT++  K+++A       +FS PFY++  GY+LC   Y NG  + +G  L ++F ++  + D  L WP R +V L +LD +  K+H V  F     S     SF +P+ + N   G   F+S   L + KN + K+DT+ +K  +D
Sbjct:  406 LIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSS----SFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 551          
BLAST of TNF receptor-associated factor vs. UniProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 5.030e-19
Identity = 65/244 (26.64%), Postives = 115/244 (47.13%), Query Frame = 3
Query:  630 MDELKQKLENCNQELNYFKK---QLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITLT------PTYDIHKP---------------KPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            +D   +KL+  ++E+  F++   + D+ +  +ESLQ  V  L+  +K   ++    GL    L+        +DI                     +W++ ++ R++Q+A + +   ++S PFY+ Y GYK+C  +Y NG    +G  L +FF I+  + D  L WP + +V L ++D  + + H    F     S     SF KP  + N   G   F++   L +   I K+DTI IK ++D
Sbjct:  323 IDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSS----SFKKPTGEMNIASGCPVFVAQTVLENGTYI-KDDTIFIKVIVD 561          
BLAST of TNF receptor-associated factor vs. UniProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 8.428e-19
Identity = 65/244 (26.64%), Postives = 114/244 (46.72%), Query Frame = 3
Query:  630 MDELKQKLENCNQELNYFKK---QLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITLT------PTYDIHKP---------------KPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            +D   +KL+  ++E+  F++   + D+ +  +ESLQ  V  L+  +K   +     GL    L+        +DI                     +W++ ++ R++Q+A + +   ++S PFY+ Y GYK+C  +Y NG    +G  L +FF I+  + D  L WP + +V L ++D  + + H    F     S     SF KP  + N   G   F++   L +   I K+DTI IK ++D
Sbjct:  322 IDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSS----SFKKPTGEMNIASGCPVFVAQTVLENGTYI-KDDTIFIKVIVD 560          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: gnl|BL_ORD_ID|167333943 (tr|A0A3L7HD98|A0A3L7HD98_CRIGR TNF receptor-associated factor OS=Cricetulus griseus OX=10029 GN=CgPICR_012378 PE=3 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 8.958e-24
Identity = 104/429 (24.24%), Postives = 175/429 (40.79%), Query Frame = 3
Query:  201 STQVDEKLLCMLCQRILINADRAPCGCKLCLNCCKEFMEKNRDHFPTC--------GFLKIENGKDFEANPSVNSKVWRIVVKCPNIFCDYECELGAMNDHVEEC--FLLQ--------------------------PSKGATNNVDKTFENLDLANI-VRGLNNKISILAEN----------EKQGKIEM----DELKQKLENCNQELNYFKKQLDTNELFLESL-------QETVENLKDENKDLKRLIDKQGLSVITL--------TPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
             T+++ K LC  C+ IL    +A CG + C  C    +     +   C        G   +E+   F  N +   +V  +   CPN  C ++  L     H E C  F L                           P +  T    +  EN +L +  V+ L   +++L  +          + Q   EM      L+QK       +    ++++   +  E+        Q+ +E L ++ + L+R I  + L++  L          TYD      F+W++++F+RK+Q+A   R   IFS  FY++  GYK+CL +Y NG     G  L +FF ++   ND  L WP   +V L +LD N  ++H +  F           SF +P SD N   G   F    ++ +  +  ++D I IK ++D
Sbjct:   25 GTKLEAKYLCSACRNILRRPFQAQCGHRYCSFCLNSILSSGPQNCAACVHEGLYEEGISILESSSAFPDN-AARREVESLPAVCPNDGCTWKGTLKEYEVHYEVCPKFPLTCDGCGKKKISREKFQDHVRSCNKCRVPCRFHTVGCSEMVENEELQDHEVKKLREHLALLLSSFLESPASQGSQSQAGPEMLQRCHSLEQKTATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEASTYD----GVFIWKISDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNN-REHVIDAF----RPDVTSSSFQRPLSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 443          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: gnl|BL_ORD_ID|174463719 (tr|A0A3Q3N138|A0A3Q3N138_9TELE TNF receptor-associated factor OS=Mastacembelus armatus OX=205130 PE=3 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.206e-23
Identity = 78/294 (26.53%), Postives = 142/294 (48.30%), Query Frame = 3
Query:  435 IFCDYECELGAMNDHVEECFLLQPSKGATNNVDKTFENLDLA-NIVRGLNNKISILAENEKQGKIEMDELKQKLENCNQELNYFKKQLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITL--------TPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            + CD   E   ++DH  +C               ++E+L+L  + + G+  K++ L+   ++ ++++   +  +   N+E+      ++         Q+ +E L ++ + L+R +  + LS++ +          TYD      F+W++++F++K+QDA   R   +FS  FY++  GYK+CL +Y NG     G  L +FF ++    D  L WP   +V L +LD N  K+H +  F     S     SF +P SD N   G   F S  +L S  +  ++DTI IK ++D
Sbjct:  221 VGCDTSVEKEKIHDHERQC---------------SYEHLNLLLHFIMGIKAKVAELSRRCQELELKVSTFENIVCVLNREMERSCATMEAYNRQHRLDQDKIEILNNKVRQLERTVSLRDLSIVEMEGKMREMSAATYD----GIFVWKISDFTKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHCDALLKWPFNQKVTLMLLDQNN-KEHIIDAFRPDISSS----SFQRPVSDMNIASGCPLFCSLSKLDSKNSYIRDDTIFIKAIVD 490          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: gnl|BL_ORD_ID|27024372 (tr|A0A5F8HHL1|A0A5F8HHL1_MONDO TNF receptor-associated factor OS=Monodelphis domestica OX=13616 GN=TRAF2 PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.546e-23
Identity = 111/428 (25.93%), Postives = 176/428 (41.12%), Query Frame = 3
Query:  195 ISSTQVDEKLLCMLCQRILINADRAPCGCKLCLNCCKEFMEKNRDHFPTC--------GFLKIENGKDFEANPSVNSKVWRIVVKCPNIFCDYECELGA--MNDHVEECFLLQ-PSK----GATNNVD----------KTFENL-DLANIV---RGLNNKIS-ILAENEKQG--------KIEMDELKQKLENC-----------------NQELNYFKKQLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITL--------TPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            I  T++++K LC  C+ IL    +A CG + C  C    +     +   C        G   +E+   F  N +   +V  +   C N  C ++  +      DHV+ C   + P K    G T  V+          K  E+L  L N V   R  +  I  +L + +  G          EM +  + LE C                 N+E+       +         QE +E L  + + L+R I  + L++  +          TYD      F+W++T+F+RK+Q+A   R   IFS  FY++  GYK+CL +Y NG     G  L +FF ++   ND  L WP   +V L +LD N  ++H +  F           SF +P SD N   G   F    ++ S  +  ++D I IK ++D
Sbjct:   68 ILGTKLEDKYLCSACKNILRRPFQAQCGHRYCSYCLTSIISTGPQNCAACIQEGIYEEGISILESSSAFPDN-AARREVESLPAVCVNDGCTWKGTIKEYEFQDHVKACGKCKGPCKFHVVGCTEMVENEKQQDHENQKVAEHLCMLLNFVLEARHFHGDIGPLLGQGDMGGWGNNSLALGPEMSKSTELLERCETLERKTVTFENIVCVLNREVERVSMTAEACSRQHRLDQEKIETLSSKVQQLERSIGLKDLAMADMEQKILEMEASTYD----GIFIWKITDFARKRQEAMAGRSPAIFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNN-REHVIDAF----RPDVTSSSFQRPVSDMNIASGCPLFCPVSKMESKNSYVRDDAIFIKAIVD 485          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: gnl|BL_ORD_ID|172707984 (tr|A0A2I0LIG5|A0A2I0LIG5_COLLI TNF receptor-associated factor 2 OS=Columba livia OX=8932 GN=TRAF2 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.818e-23
Identity = 91/375 (24.27%), Postives = 159/375 (42.40%), Query Frame = 3
Query:  195 ISSTQVDEKLLCMLCQRILINADRAPCGCKLCLNCCKEFMEKNRDHFPTC--------GFLKIENGKDFEANPSVNSKVWRIVVKCPNIFCDYECELGAMNDHVEEC--FLLQPSKGATNNVDKTFENLDLANIVRGLNNKISILAENEKQGKIEMDELKQKLENCNQELNYFKKQLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITLTPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            I  T+++ K LC  C+ IL    +A CG + C  C K+ +        +C        G   +E    F  N +   +V  +   C N  C ++  +     H E C  F L   +G    V +                K+   A + +Q +++    ++K+E  + ++   ++ +   +L +  ++E + N++                      TYD      F+W++TEF+RK+Q+A   R   IFS  FY++  GYK+CL +Y NG     G  L +FF ++   ND  L WP   +V L +LD N  ++H +  F           SF +P ++ N   G   F     + +  +  ++D I IK ++D
Sbjct:   23 ILGTKLEVKYLCSDCKNILRRPFQAQCGHRYCSYCLKKIISAGPQKCASCIQEGIYEEGISILETSSAFPDN-AARREVESLPAVCINSGCTWKGTIKEYEAHDEVCPEFPLT-CEGCGKKVPR---------------EKVPTEAYS-RQHRLD----QEKIETLSNKVRQLERSIGLKDLAMAEMEEKIRNME--------------------ASTYD----GVFIWKITEFARKRQEAITGRSPAIFSPAFYTSKYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNN-REHIIDAF----RPDVTSSSFQRPVTEMNIASGCPLFCPVSVMEAKNSYVRDDAIFIKAIVD 346          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: gnl|BL_ORD_ID|173102933 (tr|A0A1A8DMI9|A0A1A8DMI9_9TELE TNF receptor-associated factor 2 (Fragment) OS=Nothobranchius kadleci OX=1051664 GN=BX901915.1 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 5.866e-23
Identity = 61/197 (30.96%), Postives = 102/197 (51.78%), Query Frame = 3
Query:  726 QETVENLKDENKDLKRLIDKQGLSVITL--------TPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVIDP 1292
            Q+ +E L ++ + L+R +  + LS++ +          TYD      F+W++++F++K+QDA   R   +FS  FY++  GYK+CL +Y NG     G  L +FF ++   +D  L WP   +V L +LD N  ++H +  F           SF +P SD N   G   F    +L S  +  ++DTI +K ++DP
Sbjct:  150 QDKIEILNNKVRQLERTVSLRDLSIVEMEGKMREMSASTYD----GIFIWKISDFTKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN-REHIIDAF----RPDVSSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFVKTIVDP 337          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 108.997 bits (271), Expect = 3.172e-25
Identity = 63/196 (32.14%), Postives = 102/196 (52.04%), Query Frame = 3
Query:  726 QETVENLKDENKDLKRLIDKQGLSVITL--------TPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            Q+ +E L ++ + L+R +  + LS++ +          TYD      F+W++++FS+K+QDA   R   +FS  FY++  GYK+CL +Y NG     G  L +FF ++   +D  L WP   +V L +LD N  ++H +  F     S     SF +P SD N   G   F    +L S  +  ++DTI IK ++D
Sbjct:  269 QDKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYD----GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN-REHIIDAFRPDISSS----SFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 455          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 109.768 bits (273), Expect = 3.799e-25
Identity = 63/196 (32.14%), Postives = 102/196 (52.04%), Query Frame = 3
Query:  726 QETVENLKDENKDLKRLIDKQGLSVITL--------TPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            Q+ +E L ++ + L+R +  + LS++ +          TYD      F+W++++FS+K+QDA   R   +FS  FY++  GYK+CL +Y NG     G  L +FF ++   +D  L WP   +V L +LD N  ++H +  F     S     SF +P SD N   G   F    +L S  +  ++DTI IK ++D
Sbjct:  382 QDKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYD----GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN-REHIIDAFRPDISSS----SFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 568          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 108.612 bits (270), Expect = 8.373e-25
Identity = 69/232 (29.74%), Postives = 115/232 (49.57%), Query Frame = 3
Query:  639 LKQKLENCNQELNYFKKQLDTNELFLESL-------QETVENLKDENKDLKRLIDKQGLSVITLTP--------TYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            ++QK+      +    ++++   L LE+L       QE +ENL ++ + L+R +  + L +             TYD      F+W++++FSR++QDA   R   +FS  FYS+  GYK+CL +Y NG     G  L +FF ++  + D  L WP   +V L +LD N  ++H +  F     S     SF +P S+ N   G   F    +L+   +  ++DTI IK ++D
Sbjct:  305 VQQKMTALENIVCVLNREVERTVLRLEALTRQQQLDQEKIENLSNKVRQLERTLTMRDLQLAESEQALRELQFCTYD----GVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNN-REHIIDAFRPDISST----SFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 527          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 96.6709 bits (239), Expect = 5.629e-21
Identity = 65/254 (25.59%), Postives = 128/254 (50.39%), Query Frame = 3
Query:  573 GLNNKISILAENEKQGKI--EMDELKQKLENCNQELNYFKKQLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVI-----------TLTPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIF-KNDTILIKCVIDP 1292
            G N+K   L +++ + ++  ++  L+Q+L+     +    ++++  +L +  L+    N  +  + L+ ++ +Q   +I           +++   D+     FLWR+ + S+K ++A   +K+  +S  FY++  G+K+C+ +Y  G    +G  + +FF I+    D  LSWP + +V   ++D N  ++H V  F     S     SF +P S+ N   G   F    +L S K+ + K+DT+ IKCV+DP
Sbjct:  268 GANDKALSLHDDQAELEVGQQLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNMNLIQHLEAVVAEQQQRLIRKDLQISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQ-REHVVDAFRPDLRSA----SFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIKCVVDP 516          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 96.2857 bits (238), Expect = 8.925e-21
Identity = 65/254 (25.59%), Postives = 128/254 (50.39%), Query Frame = 3
Query:  573 GLNNKISILAENEKQGKI--EMDELKQKLENCNQELNYFKKQLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVI-----------TLTPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIF-KNDTILIKCVIDP 1292
            G N+K   L +++ + ++  ++  L+Q+L+     +    ++++  +L +  L+    N  +  + L+ ++ +Q   +I           +++   D+     FLWR+ + S+K ++A   +K+  +S  FY++  G+K+C+ +Y  G    +G  + +FF I+    D  LSWP + +V   ++D N  ++H V  F     S     SF +P S+ N   G   F    +L S K+ + K+DT+ IKCV+DP
Sbjct:  291 GANDKALSLHDDQAELEVGQQLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNMNLIQHLEAVVAEQQQRLIRKDLQISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQ-REHVVDAFRPDLRSA----SFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIKCVVDP 539          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 9.769e-22
Identity = 47/150 (31.33%), Postives = 77/150 (51.33%), Query Frame = 3
Query:  843 FLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVIDP 1292
             +W++ +++R++Q+A   R   ++S PFY++  GYK+C   Y NG     G  L +FF ++  + D  L WP R +V LS+LD    + H    F     S     SF +P+ D N   G   F+S   L    +   +DT+ ++ V+DP
Sbjct:  270 LVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASG----SFRRPDGDMNVASGCPLFVSHVALEG-SSYLVDDTVFVRVVVDP 414          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 3.768e-21
Identity = 48/149 (32.21%), Postives = 77/149 (51.68%), Query Frame = 3
Query:  843 FLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
             +W++ +++R++QDA   R   ++S PFY++  GY++C   Y NG     G  L +FF ++  + D  L WP R +V L++LD    +      F    +      SF +P SD N   G   F+S   L S  +  ++DTI IK V+D
Sbjct:  327 LVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTF----KPDPASSSFRRPTSDMNIASGCPLFVSHVALES-ASYLQDDTIFIKVVVD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 90.1225 bits (222), Expect = 2.902e-19
Identity = 71/272 (26.10%), Postives = 125/272 (45.96%), Query Frame = 3
Query:  543 ENLDLANI-VRGLNNKISILAENEKQGKIEMDELKQKLENCNQELNYFKKQLDTNELFLE--------------SLQETV--ENLKDENKDLKRLIDKQ------GLSVITLTPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            E L +AN  +R    K++++  +  + + E+ ELK++++   QE+    ++ D     +E              S+  T+  E  +D N+    L D Q       L ++  T +YD      ++W++ E++R+ Q+    +   I+S PFY    GYK C  +YPNG    +G  L +FF ++  + D  L WP R +V   +LD +     +V+             SF +P S+ N   G   FIS   L + +   ++DT+ IK  +D
Sbjct:  264 EALAVANQNLRTYQGKLNVIERSVAEQRRELAELKERIQL--QEVEAAIREQDRRLGMIENEASRGAAPSSGPGSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQMLEAT-SYD----GTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQD-----RVHDIGDTFRPDPTSSSFKRPTSNMNIASGCPLFISHTNLQT-RAYVRDDTMFIKIAVD 522          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 82.4185 bits (202), Expect = 8.374e-17
Identity = 62/257 (24.12%), Postives = 125/257 (48.64%), Query Frame = 3
Query:  528 VDKTFENLDLANIVRGLNNKISILAENEKQGKIEMDELKQKLENCNQELNYFKKQLDTNELFLESLQETVENLKDENKDLKRLID---KQGLSVITLTPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            + +  +N  + +++R + N  +  A++E    + + E    ++   +E+     +L  ++  +  L+  +E L D+   L+ L     ++ L+ +  T T+D       LW++T  + K+ +A   R T  +S  F++  +GYK+C  +Y NG        + +FF I+  + D  L WP R +V L +LD + + +H +  F     S     SF +P ++ N   G   F S ++L+    I ++DT+ +K ++D
Sbjct:  237 ISENIDNEAIGDVLRRVANVEAKGADHE----VLVVEAHSAVDELRREVGRLNVKLQESDDIIRRLERQLE-LHDQGTGLRNLAIADLEERLNTLQGT-TFD----SVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDNV-EHVIDAFRPDPSSS----SFQRPRAEMNIASGCPLFCSHEQLTQHAYI-RDDTMFLKIIVD 477          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO45915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA4])

HSP 1 Score: 80.1073 bits (196), Expect = 3.145e-16
Identity = 45/146 (30.82%), Postives = 74/146 (50.68%), Query Frame = 3
Query:  843 FLWRVTEFSRKQQDAKLDRKT-IIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIK 1277
            F+W++  FSRK  DAK  R +  + S+ FY++ +GYK+C G++ NG+    G+++ V   +   + D  L WP+  +   ++LD +     K    A F        S S+P +DR  G G   F+   E+       K++TI IK
Sbjct:  268 FIWKIQCFSRKLMDAKTGRASEPMISEAFYTSPHGYKMCAGVWLNGIGTGRGRYISVGLQVQSGEFDSILKWPLYPRYTFTLLDQSEDTKTKRDVVATFE-----PQSISRPSADRQLGKGARRFVLQDEVCGT-TYCKDNTIFIK 407          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 78.9518 bits (193), Expect = 1.042e-15
Identity = 40/150 (26.67%), Postives = 75/150 (50.00%), Query Frame = 3
Query:  843 FLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDH-NTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            FLW++ +F+ +  +AK    T I+S PFY++  GYKLC  ++PNG  +    +L +F  ++  + D  L WP +  + ++++D  N +   + +      +   C  SF +P  + N   G   F S   L + +     + + +K V+D
Sbjct:  382 FLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNGMNISETF------DPDPCSISFQRPTRNINVASGCPRFCSQTVLRT-RGYMNENCVFVKVVVD 524          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK7])

HSP 1 Score: 77.7962 bits (190), Expect = 1.594e-15
Identity = 42/151 (27.81%), Postives = 79/151 (52.32%), Query Frame = 3
Query:  843 FLWRVTEFSRKQQDAKLDRKTI-IFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVIDP 1292
            FLW+++ +  +   A    + + IFS PFY++  GYKL L  Y NG    +G  L ++  I+    D  L WP + ++   ++D +  ++H+ +  +      + +  F++P    N GIG+  F+  + L S + + K+D + IK V++P
Sbjct:  255 FLWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQSEKQNHRTHLLSPNRSLPNIKVVFNRPTVKENLGIGNPCFVPNEVLESGEYV-KDDVMFIKAVVEP 404          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 107.842 bits (268), Expect = 1.592e-24
Identity = 61/196 (31.12%), Postives = 102/196 (52.04%), Query Frame = 3
Query:  726 QETVENLKDENKDLKRLIDKQGLSVITL--------TPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            Q+ +E L ++ + L+R +  + LS++ +          TYD      F+W++++F++K+QDA   R   +FS  FY++  GYK+CL +Y NG     G  L +FF ++   +D  L WP   +V L +LD N  ++H +  F     S     SF +P SD N   G   F    +L S  +  +++TI IK ++D
Sbjct:  379 QDKIEILSNKVRQLERTVSLRDLSIVEMEGKMKDMSAATYD----GIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN-REHIIDAFRPDISSS----SFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIVD 565          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 105.145 bits (261), Expect = 9.469e-24
Identity = 72/237 (30.38%), Postives = 118/237 (49.79%), Query Frame = 3
Query:  624 IEMDELKQKLENCNQELNYFKKQLDTNELFLESL-------QETVENLKDENKDLKRLIDKQGLSVITLTP--------TYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            +++D+    LEN    LN   ++++ + L LE+        QE +ENL ++ + L+R +  + L +             TYD      F+W++T+FS ++Q+A   R   +FS  FYS+  GYK+CL +Y NG     G  L +FF ++ S+ D  L WP   +V L +LD N  ++H +  F     S     SF +P S+ N   G   F    +L+      ++DTI IK ++D
Sbjct:  288 VDLDKKVSALENIVCVLN---REVERSSLTLEAFSHQHRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYD----GIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNN-REHIIDAFRPDITST----SFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 512          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 105.145 bits (261), Expect = 1.068e-23
Identity = 72/237 (30.38%), Postives = 118/237 (49.79%), Query Frame = 3
Query:  624 IEMDELKQKLENCNQELNYFKKQLDTNELFLESL-------QETVENLKDENKDLKRLIDKQGLSVITLTP--------TYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            +++D+    LEN    LN   ++++ + L LE+        QE +ENL ++ + L+R +  + L +             TYD      F+W++T+FS ++Q+A   R   +FS  FYS+  GYK+CL +Y NG     G  L +FF ++ S+ D  L WP   +V L +LD N  ++H +  F     S     SF +P S+ N   G   F    +L+      ++DTI IK ++D
Sbjct:  295 VDLDKKVSALENIVCVLN---REVERSSLTLEAFSHQHRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYD----GIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNN-REHIIDAFRPDITST----SFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 519          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 104.375 bits (259), Expect = 2.764e-23
Identity = 62/217 (28.57%), Postives = 110/217 (50.69%), Query Frame = 3
Query:  663 NQELNYFKKQLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITL--------TPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            N+E+  F   ++ +    +  Q+ +E L ++ + L+R +  + L+V  +          T+D      F+WR+++F++K+QDA   R   +FS  FY++  GYK+CL +Y NG     G  L +FF ++   +D  L WP   +V L +LD +  ++H +  F     S     SF +P S+ N   G   F    +L +  +  ++DTI IK ++D
Sbjct:  385 NREVERFTTTMEASNRQHKLDQDKIEALSNKVRQLERTVGLKDLTVAEMEGRLREMAATTFD----GVFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQSN-REHIIDAFRPDVTSS----SFQRPVSEMNIASGCPLFCPLSKLDAKNSYIRDDTIFIKAIVD 592          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 94.7449 bits (234), Expect = 1.965e-20
Identity = 62/222 (27.93%), Postives = 106/222 (47.75%), Query Frame = 3
Query:  630 MDELKQKLENCNQELNYFKKQLDTNELFLESLQETVENLKDENKDLK--RLIDKQGLSVITLTPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            + +L+ ++E+    L+  + +L   E    +  ET  N  D+   +   RL D      +  T +Y+       +W++ ++ R++QDA   +   ++S PFY+ Y GYK+C  +Y NG    +G  L +FF ++  + D  L WP + +V L ++D    + H    F     S     SF +P ++ N   G   F+S   L S   I K+DTI IK  +D
Sbjct:  231 LRQLRDEMESLRGTLDTVRTRLSALEQGGRASLETQLNRHDDMLSVHEIRLADMDLRFQVLETASYN----GTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSS----SFRRPVAEMNIASGCPLFVSQSVLESGTYI-KDDTIFIKVTVD 443          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000015041.1 (SMESG000015041.1)

HSP 1 Score: 768.844 bits (1984), Expect = 0.000e+0
Identity = 376/380 (98.95%), Postives = 376/380 (98.95%), Query Frame = 3
Query:  156 MSHVQPTQKPFNIISSTQVDEKLLCMLCQRILINADRAPCGCKLCLNCCKEFMEKNRDHFPTCGFLKIENGKDFEANPSVNSKVWRIVVKCPNIFCDYECELGAMNDHVEECFLLQPSKGATNNVDKTFENLDLANIVRGLNNKISILAENEKQGKIEMDELKQKLENCNQELNYFKKQLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITLTPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVIDPK 1295
            MSHVQPTQKPFNIISSTQVDEKLLCMLCQRILINADRA CGCKLCLNCCKEFMEKNRDH PTCGFLKIENGKDFEAN SVNSKVWRIVVKCPNIFCDYECELGAMNDHVEECFLLQ SKGATNNVDKTFENLDLANIVRGLNNKISILAENEKQGKIEMDELKQKLENCNQELNYFKKQLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITLTPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVIDPK
Sbjct:    1 MSHVQPTQKPFNIISSTQVDEKLLCMLCQRILINADRASCGCKLCLNCCKEFMEKNRDHCPTCGFLKIENGKDFEANHSVNSKVWRIVVKCPNIFCDYECELGAMNDHVEECFLLQQSKGATNNVDKTFENLDLANIVRGLNNKISILAENEKQGKIEMDELKQKLENCNQELNYFKKQLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITLTPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVIDPK 380          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000011147.1 (SMESG000011147.1)

HSP 1 Score: 253.062 bits (645), Expect = 3.455e-79
Identity = 144/391 (36.83%), Postives = 223/391 (57.03%), Query Frame = 3
Query:  153 RMSHVQPTQKPFNIISSTQVDEKLLCMLCQRILINADRAPCGCKLCLNC----------CKEFMEKNRDHFPTCGFLKIENGKDFEANPSVNSKVWRIVVKCPNIFCDYECELGAMNDHVEECFLLQPSKGATNNVDKTFENLD-LANIVRGLNNKISILAENEKQGKIEMDELKQKLENCNQELNYFKKQLDTNELFLESLQETVENLKDENKDLKRLIDK-QGLSVITLTPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 1289
            ++S +    K + I     +D  LLC  C++++I+  +A CGC+ C NC          C  F   ++ H     F       +F+ +   + KV  + V CPN  C + C+L  + DH+  C             DK   +L+ +  I+  L        E E+Q K + + LK  L++ +QEL   ++ +  N+  +++L+E V  L +EN+ LKRLI+     S + +  +Y I K KPF+W++  FS KQ + + D    +FS+ FY++ NGYKLCLG+ PNG + + GK+LF+FFCI+    D NL WPM+ +V LSI+D  +LKD+K +KF Y   S+  +HSFSKP+ +RN+GIGDNEFISFKEL  + NI +ND+IL++C I+
Sbjct:    7 QLSAIWGLLKKYEIRPIQPIDNVLLCTCCRKLIIDPRKASCGCRFCENCSRKPSKIDNKCPNFHLASKLHSNIVTF-------NFQVDLETSLKVAHLEVFCPNNECQFICKLRFLADHLNIC----------EKKDKCVYSLENITGIIENLQKYAFRSMEIEEQHKTDFEFLKTNLKSRDQELVNTRRLISENQESIQTLEEAVNCLLEENETLKRLINSLNNSSALVVNHSYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFMFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLKDYKTFKFKYSKTSEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 380          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000014923.1 (SMESG000014923.1)

HSP 1 Score: 167.548 bits (423), Expect = 4.055e-46
Identity = 122/441 (27.66%), Postives = 206/441 (46.71%), Query Frame = 3
Query:  153 RMSHVQPTQKPFNIISSTQVDEKLLCMLCQRILINADRAPCGCKLCLNCCKEFMEKNR----DHFPTCGFLKIENGKDFEANPSVNSKVWRIVVKCPNIFCDYECELGAMNDHVEEC---------FLLQPSKGATNN--------VDKTFENLDLANIVRGLNNKISILAE---------NEKQGKIEM-------------------DE---LKQKLENCNQELNYFKKQLDTN---------ELFLESLQETVENLKDENKDLKRLIDKQGLSVITLTPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVIDP 1292
            R  ++      + + S T++   L+C++C+ +L NA   PCGC+ C  C + ++ +       +F  C    +   ++   + + NS++ RI+VKCP   C++  EL  + DH+  C         F +  S+G   +        VD       L N ++ L N+++++ E         +E Q K  +                   DE   LK KL+    +L   + QLD           EL LE+  E ++   DEN+    ++  +  S+   T +   H      W++  F++K+++A+      I+S+PFYS+ NGYK+CL ++P+G    +G  L VFF I+  +ND  L WPM+ +V + I++  +   H  YKF Y        H F KP++D N G G  +FI   EL     + KND I++KCV+ P
Sbjct:    5 RYENIWRILSEYRVNSMTEISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEELLNIDRNILLDNAANSRISRIIVKCPEPSCEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIELLLEN--EKLKYKSDENQRFSEILHGKLESLERETLSMKQH-FGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSHKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYG-YDFIKLDELIKNNKLLKNDRIVLKCVVAP 441          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070130.1 (SMESG000070130.1)

HSP 1 Score: 166.392 bits (420), Expect = 5.464e-46
Identity = 112/401 (27.93%), Postives = 187/401 (46.63%), Query Frame = 3
Query:  210 VDEKLLCMLCQRILINADRAPCGCKLCLNCCKEFMEKNRDHFPT----CGFLKIENGKDFEANPSVNSKVWRIVVKCPNIFCDYECELGAMNDHVEECFLLQPSKGATNNVDKTFENLDLANIVRGLNNKI----SILAENEKQGKIEMDELKQKLENCNQEL-----------NYFKKQLDTNELFLESLQETVENLKDENKDLKR--------------------LIDKQGLSVITLTPTYDIHK---PKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVI 1286
            + ++ LC++C  IL N  ++PCGC+ C+ C  +++     H P     C    I    D  A+  ++ K+ ++ VKCP   CDY  EL  + +H+              N+   + +  +  IV  L+++I     ++ E+    K E+  L   L++  QEL           N   +   T E+ ++ L ET++  K+EN  L                      L +K+      L P Y++       PF W++  F   Q + K  RK +  S PFYS+ NGYKLCL +YPNG+ N  G  + VFF I+    D +L WPM   V + ++D      +    F Y+S S   ++ + KP + +N GIG++++I  + L     I+ ND+I++KC +
Sbjct:   24 LSDEFLCVICNSILKNPYQSPCGCRFCMECIVDYLNDKETHCPGSSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKTLCDYRSELQNIGNHISS----HKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFANLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSFNQENYYLQNKEEDRKYILQPNYNVSTFDPIAPFKWQIYNFKVLQSEGK--RKPLT-SSPFYSHRNGYKLCLSVYPNGIGNGSGTHMAVFFHIMSGIFDDSLDWPMVLNVRICLVDQLYGNIYADKIFKYYSRSLEDQYKYEKPSTVKNMGIGESQYILLETLYRNSRIYSNDSIILKCYV 417          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000067208.1 (SMESG000067208.1)

HSP 1 Score: 160.614 bits (405), Expect = 1.310e-43
Identity = 114/408 (27.94%), Postives = 204/408 (50.00%), Query Frame = 3
Query:  222 LLCMLCQRILINADRAPCGCKLCLNCCKEFMEKNRDHFPTCG---FLKIENGKDFEANPSVNSKVWRIVVKCPNIFCDYECELGAMNDHVE----EC--FLLQPSKGATNNVD----KTFENLDLANI----VRGLNNKISILAENEKQGKIEMDELKQKL-------ENCNQE-LNYFKKQLDTNELFLESLQETVENLKDENKDLKRLIDKQGL----------------------------SVITLTPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVI 1286
            L+C++C+R+LINA ++ CGC+ C  C ++++E  +   P  G     ++ +  D + +   N K+ +  VKCP+  C ++ EL  M  H++    +C  F +  SK   NN D       E+ + AN+    ++ + N I+ L E E   K E+  L QKL        N N+E +   K++++ N++  ++L+  V NL +E K+ K+   K+                               ++ LT   +  K  PF+W++  FS K+  AK    + I SD FYS+ NGYK+CL ++P+G +  +  +L V F ++ S++D +L WPM   + + +++  T + H    +   S +      F +P    N  +  ++F+ F  ++S  N+ KND+I+IKCV+
Sbjct:   27 LICVICKRLLINAHQSCCGCRYCYKCIEKYLEDKKKLCPGKGEGCNEQLISLFDIQVDHVANVKISKATVKCPDTICQFKDELRKMESHIKSHQIKCPYFEIGCSKVDINNADINNHLNIEHGNHANLLIDSIQNMRNDIATLRE-ESLKKDEVLSLTQKLLEDMKIAHNRNEEVIETLKREINGNQIVAKNLKSEVANLNNELKNFKKTYKKENQIKSMNESQKSMNGNKGSPKTKVTINSPKPILELTNVINGVKYSPFIWKIENFSDKKNTAKNVCDSFILSDTFYSHVNGYKICLTIFPDGSNVSQNDWLSVGFHLMKSEHDKDLFWPMAMNITIGLVNQKTNQIHASETYNVNSVTDINRDRFFRPVFGMNGAVVAHKFVKFTAITSNANLCKNDSIVIKCVV 433          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF26.013e-2331.12TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF37.564e-2026.64TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.047e-1926.64TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.047e-1926.64TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.091e-1926.64TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-12.663e-1325.82TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-24.660e-829.60TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf42.956e-1326.49gene:FBgn0026319 transcript:FBtr0077429[more]
Traf43.150e-1326.49gene:FBgn0026319 transcript:FBtr0334401[more]
Traf-like1.252e-827.81gene:FBgn0030748 transcript:FBtr0074275[more]
Traf-like1.429e-827.81gene:FBgn0030748 transcript:FBtr0308606[more]
Traf-like1.429e-827.81gene:FBgn0030748 transcript:FBtr0074274[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX901915.13.475e-2631.63pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.13.475e-2631.63pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
traf2b2.077e-2531.02Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b2.077e-2531.02Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b3.166e-2531.02Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF21.641e-2433.00TNF receptor associated factor 2 [Source:NCBI gene... [more]
TRAF27.710e-2331.31TNF receptor associated factor 2 [Source:NCBI gene... [more]
slc12a11.083e-2129.33solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a11.127e-2129.25solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a11.251e-2129.33solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf25.281e-2532.14TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf25.692e-2532.14TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf52.778e-2132.00TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf52.778e-2132.00TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf51.753e-2032.67TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39429|TRAF2_MOUSE3.694e-2432.14TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN2.888e-2231.12TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|P70191|TRAF5_MOUSE7.698e-2032.67TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|Q13114|TRAF3_HUMAN5.030e-1926.64TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|Q60803|TRAF3_MOUSE8.428e-1926.64TNF receptor-associated factor 3 OS=Mus musculus O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|1673339438.958e-2424.24tr|A0A3L7HD98|A0A3L7HD98_CRIGR TNF receptor-associ... [more]
gnl|BL_ORD_ID|1744637191.206e-2326.53tr|A0A3Q3N138|A0A3Q3N138_9TELE TNF receptor-associ... [more]
gnl|BL_ORD_ID|270243721.546e-2325.93tr|A0A5F8HHL1|A0A5F8HHL1_MONDO TNF receptor-associ... [more]
gnl|BL_ORD_ID|1727079841.818e-2324.27tr|A0A2I0LIG5|A0A2I0LIG5_COLLI TNF receptor-associ... [more]
gnl|BL_ORD_ID|1731029335.866e-2330.96tr|A0A1A8DMI9|A0A1A8DMI9_9TELE TNF receptor-associ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2a3.172e-2532.14TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a3.799e-2532.14TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2b8.373e-2529.74TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf15.629e-2125.59TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf18.925e-2125.59TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000002130.19.769e-2231.33pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.13.768e-2132.21pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494642.902e-1926.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388738.374e-1724.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459153.145e-1630.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352371.042e-1526.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495451.594e-1527.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020861.21.592e-2431.12TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf2b9.469e-2430.38TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b1.068e-2330.38TNF receptor associated factor 2 [Source:NCBI gene... [more]
unm_sa8082.764e-2328.57TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf31.965e-2027.93TNF receptor associated factor 3 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015041.10.000e+098.95SMESG000015041.1[more]
SMESG000011147.13.455e-7936.83SMESG000011147.1[more]
SMESG000014923.14.055e-4627.66SMESG000014923.1[more]
SMESG000070130.15.464e-4627.93SMESG000070130.1[more]
SMESG000067208.11.310e-4327.94SMESG000067208.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025100 ID=SMED30025100|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1535bp
CGCGCATTACGGCTTGATTGAGAGCTACTTCAGTGAATTCAGGCAAAGCA
GTTACGGATTTCACAATTCAATCATTCTGTGCAATTTTTTTGTTTTTTTT
GCAACAGATTAGATAAATTCAGCAAGTTTCAGATCCGATTTTCGATTTAC
AAAGAATGTCTCATGTTCAACCGACTCAAAAACCTTTCAATATAATATCT
TCGACTCAAGTCGATGAGAAGCTATTGTGCATGTTGTGCCAGAGAATTTT
AATAAACGCCGATCGAGCCCCCTGTGGGTGTAAACTGTGCTTGAATTGTT
GCAAAGAATTCATGGAGAAAAACAGAGACCATTTTCCAACTTGTGGATTT
CTGAAAATTGAAAACGGGAAAGATTTCGAAGCTAACCCCAGCGTTAATAG
TAAGGTTTGGAGAATAGTTGTGAAATGTCCAAATATATTTTGTGACTATG
AATGTGAATTGGGAGCTATGAATGACCATGTTGAGGAGTGTTTCCTACTG
CAGCCGAGCAAAGGGGCAACAAATAATGTGGATAAGACCTTTGAAAATCT
GGATTTGGCAAATATCGTCAGAGGTCTTAACAACAAGATATCAATTTTAG
CAGAAAACGAAAAACAGGGTAAAATAGAAATGGATGAATTAAAACAAAAA
TTAGAAAATTGCAATCAAGAATTAAATTATTTCAAGAAACAGTTGGATAC
AAATGAGCTATTCTTAGAATCATTGCAAGAAACTGTTGAAAATTTGAAAG
ATGAAAATAAAGATCTCAAAAGGCTAATCGACAAACAAGGCCTTTCTGTG
ATAACTTTAACGCCAACTTATGACATTCATAAACCGAAACCATTTTTATG
GAGAGTAACAGAGTTTTCGAGGAAACAGCAAGACGCGAAATTGGATAGAA
AAACAATAATATTTAGCGACCCATTCTATTCCAATTACAATGGATATAAA
CTTTGCTTAGGAATGTACCCCAATGGTGTGAGCAATTTCGAAGGAAAGTT
TCTTTTCGTGTTCTTTTGCATTCTTCCCAGTCAAAACGATGGAAATCTCA
GTTGGCCTATGCGACATCAAGTTGCTCTTAGCATTCTAGATCACAACACA
TTAAAAGATCACAAAGTTTACAAATTCGCGTACTTTTCCGAGTCGAAAAG
CTGTGAGCATTCATTCTCGAAACCGGAATCGGACAGAAACGACGGCATTG
GAGACAATGAATTTATCAGTTTCAAGGAATTGTCGTCGATGAAAAATATT
TTCAAAAACGACACGATTCTCATTAAATGTGTTATTGACCCAAAATAGTC
GTTTTTATGTGATGAATTTTGATTTTTGAAGTAAATAATGGATCTATTGT
GCAGTGTTAGTCCTGGAGGTCTATAAAAATTTAAACGTTGCAAAAGGATA
AACATATGTCCCGTGGAATCTAGAGGAGATTCAACGCCTAAATTTTGGAC
TTCTGTCTTTTTATATTTTTCTTGTTGGGTGTTGAATTGATGATAAAGGA
AGGAGTAAATTGGGCTAGCAATAATATCATTCCGG
back to top

protein sequence of SMED30025100-orf-1

>SMED30025100-orf-1 ID=SMED30025100-orf-1|Name=SMED30025100-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=381bp
MSHVQPTQKPFNIISSTQVDEKLLCMLCQRILINADRAPCGCKLCLNCCK
EFMEKNRDHFPTCGFLKIENGKDFEANPSVNSKVWRIVVKCPNIFCDYEC
ELGAMNDHVEECFLLQPSKGATNNVDKTFENLDLANIVRGLNNKISILAE
NEKQGKIEMDELKQKLENCNQELNYFKKQLDTNELFLESLQETVENLKDE
NKDLKRLIDKQGLSVITLTPTYDIHKPKPFLWRVTEFSRKQQDAKLDRKT
IIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSW
PMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGD
NEFISFKELSSMKNIFKNDTILIKCVIDPK*
back to top

protein sequence of SMED30025100-orf-2

>SMED30025100-orf-2 ID=SMED30025100-orf-2|Name=SMED30025100-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=139bp
RNDIIASPIYSFLYHQFNTQQEKYKKTEVQNLGVESPLDSTGHMFILLQR
LNFYRPPGLTLHNRSIIYFKNQNSSHKNDYFGSITHLMRIVSFLKIFFID
DNSLKLINSLSPMPSFLSDSGFENECSQLFDSEKYANL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR043211TNF_rcpt-assoc_TRAF
IPR001841Znf_RING
IPR008974TRAF-like
IPR002083MATH/TRAF_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0005102signaling receptor binding
GO:0005164tumor necrosis factor receptor binding
GO:0005174CD40 receptor binding
GO:0008270zinc ion binding
GO:0008289lipid binding
GO:0016740transferase activity
GO:0019899enzyme binding
GO:0019901protein kinase binding
GO:0019903protein phosphatase binding
GO:0031435mitogen-activated protein kinase kinase kinase binding
GO:0031625ubiquitin protein ligase binding
GO:0031996thioesterase binding
GO:0032403protein complex binding
GO:0042802identical protein binding
GO:0046625sphingolipid binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0070207protein homotrimerization
GO:0070534protein K63-linked ubiquitination
GO:0071732cellular response to nitric oxide
GO:0090073positive regulation of protein homodimerization activity
GO:0097300programmed necrotic cell death
GO:1903265positive regulation of tumor necrosis factor-mediated signaling pathway
GO:1903721positive regulation of I-kappaB phosphorylation
GO:2001238positive regulation of extrinsic apoptotic signaling pathway
GO:0002726positive regulation of T cell cytokine production
GO:0006461protein complex assembly
GO:0006915apoptotic process
GO:0007165signal transduction
GO:0007250activation of NF-kappaB-inducing kinase activity
GO:0016567protein ubiquitination
GO:0030163protein catabolic process
GO:0032743positive regulation of interleukin-2 production
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0034351negative regulation of glial cell apoptotic process
GO:0042981regulation of apoptotic process
GO:0043066negative regulation of apoptotic process
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043507positive regulation of JUN kinase activity
GO:0043623cellular protein complex assembly
GO:0046328regulation of JNK cascade
GO:0051023regulation of immunoglobulin secretion
GO:0051091positive regulation of sequence-specific DNA binding transcription factor activity
GO:0051092positive regulation of NF-kappaB transcription factor activity
GO:0051291protein heterooligomerization
GO:0051865protein autoubiquitination
Vocabulary: cellular component
TermDefinition
GO:0097057TRAF2-GSTP1 complex
GO:1990604IRE1-TRAF2-ASK1 complex
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005938cell cortex
GO:0009898cytoplasmic side of plasma membrane
GO:0012506vesicle membrane
GO:0035631CD40 receptor complex
GO:0043234protein complex
GO:0045121membrane raft
GO:0000151ubiquitin ligase complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 152..214
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 16..115
coord: 162..378
NoneNo IPR availableCDDcd16449RING-HCcoord: 25..63
e-value: 0.00104271
score: 34.3653
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 18..68
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 186..380
e-value: 1.1E-41
score: 144.4
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 229..378
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 9..123
e-value: 8.4E-9
score: 37.4
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 16..115
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 162..378
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 25..63
score: 8.816
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 227..377
score: 19.777