Ankyrin repeat and EF-hand domain-containing protein 1

Overview
NameAnkyrin repeat and EF-hand domain-containing protein 1
Smed IDSMED30025084
Length (bp)2749
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ankyrin repeat and EF-hand domain-containing protein 1 (SMED30025084) t-SNE clustered cells

Violin plots show distribution of expression levels for Ankyrin repeat and EF-hand domain-containing protein 1 (SMED30025084) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ankyrin repeat and EF-hand domain-containing protein 1 (SMED30025084) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ankyrin repeat and EF-hand domain-containing protein 1 (SMED30025084) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025084

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30025084h1SMcG0007903 SmedASXL_016932SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30025084h1SMcG0007903 dd_Smed_v4_12476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025084h1SMcG0007903 dd_Smed_v4_12476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025084h1SMcG0007903 dd_Smed_v4_12476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30025084h1SMcG0007903 dd_Smed_v6_12476_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025084h1SMcG0007903 dd_Smed_v4_12476_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Human
Match: ANKEF1 (ankyrin repeat and EF-hand domain containing 1 [Source:HGNC Symbol;Acc:HGNC:15803])

HSP 1 Score: 541.576 bits (1394), Expect = 3.298e-180
Identity = 320/776 (41.24%), Postives = 450/776 (57.99%), Query Frame = 3
Query:  141 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLG----KNNEP-WALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALP-PVKDKKGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALK----RANNLLS--YSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKA 2429
            M +A  RLE LQI KVLQC   KD  QI+KL   G   LINY EP NG + L +A+  ND+D + FLLDLGAHPDV D  G +  M AA+ GH  S E LAKA AD+ + D  GK VL+YC+ PT+RH  C   AL +  D+NN + +GK +   ACED  + +++CL  L+ GA+PN I  +TG+T LM A   G   I    L+ G + N  D     A H+AAK G F  L  L A+     +     N P+HYAA  G A CCK++ QRGC+ K KN + +  R +AK+ G K   KE+ + ER   KL     KN  P WAL L+DW+VE    + E   +LD    G ++K +FV +L   +   + E    I    +K + G  +  +F  G +Y+NK +++ ++  KKK+K  G KGK  K  +P+ ICV+PE    R  DGGPP   I   +  TD +RF+ ++PP + I+DD  WYI D ++ F N+N   K GDL S+K A + G  VD +D +YKT LM+A   GN+D+   L+  GA+VNA DNF WTPLH A H+G  DIVELL+ +GA++DA ++N +TPL RAIES R + V++LL  GAK Q+EN KG + +D+A  +AD R+I++IK K+D LP P +++K +G +      ++G       + +      P  S  +   K      N+L++  Y+ K     DI+F PR +         L++ R  RR+RF  E+DF D+F   F KN+TE+ +A
Sbjct:    1 MALADKRLENLQIYKVLQCVRNKDKKQIEKLTKLGYPELINYTEPINGLSALHLASVSNDIDMVSFLLDLGAHPDVQDRMGCTPTMRAAELGHELSMEILAKAKADMTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRACEDAHDVKDVCLTFLEKGANPNAINSSTGRTALMEASREGVVEIVRGILERGGEVNAFDNDRHHAAHFAAKGGFFDILKLLFAYNGDVGLISINGNTPLHYAAMGGFADCCKYIAQRGCDLKWKNLDHKTPRAVAKEGGFKAASKEIRRAERIANKLARPGAKNPNPLWALRLHDWSVEREAFLREAFAVLD-RGDGSISKNDFVMVLEERQDYASSEQLAAIAHLHEKTRGGGVNINEFFKGTRYLNKSFVLGSYGPKKKEKGMGKKGKKGKFVLPLPICVIPEYAFPRRQDGGPPYYMIETYKNVTDSSRFNRDHPPEHPIQDDSVWYIDDSEKVFSNINIITKAGDLASLKKAFESGIPVDMKDNYYKTPLMTACASGNIDVVKFLLEKGANVNATDNFLWTPLHFACHAGQQDIVELLVESGALIDAASINNSTPLNRAIESCRLDTVKYLLDIGAKFQLENRKGHSAMDVAKAYADYRIIDLIKEKLDNLPKPAENQKLKG-KTPPILKTEGPEIKKEEELLSSIYGVPTTSEGKKVQKGNVVHLNSLITSGYTKKV----DITFIPRRIWSPEATTAELIRKRELRRERFTHEVDF-DDFMMPFQKNITEKARA 769          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Human
Match: ANKEF1 (ankyrin repeat and EF-hand domain containing 1 [Source:HGNC Symbol;Acc:HGNC:15803])

HSP 1 Score: 541.576 bits (1394), Expect = 3.298e-180
Identity = 320/776 (41.24%), Postives = 450/776 (57.99%), Query Frame = 3
Query:  141 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLG----KNNEP-WALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALP-PVKDKKGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALK----RANNLLS--YSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKA 2429
            M +A  RLE LQI KVLQC   KD  QI+KL   G   LINY EP NG + L +A+  ND+D + FLLDLGAHPDV D  G +  M AA+ GH  S E LAKA AD+ + D  GK VL+YC+ PT+RH  C   AL +  D+NN + +GK +   ACED  + +++CL  L+ GA+PN I  +TG+T LM A   G   I    L+ G + N  D     A H+AAK G F  L  L A+     +     N P+HYAA  G A CCK++ QRGC+ K KN + +  R +AK+ G K   KE+ + ER   KL     KN  P WAL L+DW+VE    + E   +LD    G ++K +FV +L   +   + E    I    +K + G  +  +F  G +Y+NK +++ ++  KKK+K  G KGK  K  +P+ ICV+PE    R  DGGPP   I   +  TD +RF+ ++PP + I+DD  WYI D ++ F N+N   K GDL S+K A + G  VD +D +YKT LM+A   GN+D+   L+  GA+VNA DNF WTPLH A H+G  DIVELL+ +GA++DA ++N +TPL RAIES R + V++LL  GAK Q+EN KG + +D+A  +AD R+I++IK K+D LP P +++K +G +      ++G       + +      P  S  +   K      N+L++  Y+ K     DI+F PR +         L++ R  RR+RF  E+DF D+F   F KN+TE+ +A
Sbjct:    1 MALADKRLENLQIYKVLQCVRNKDKKQIEKLTKLGYPELINYTEPINGLSALHLASVSNDIDMVSFLLDLGAHPDVQDRMGCTPTMRAAELGHELSMEILAKAKADMTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRACEDAHDVKDVCLTFLEKGANPNAINSSTGRTALMEASREGVVEIVRGILERGGEVNAFDNDRHHAAHFAAKGGFFDILKLLFAYNGDVGLISINGNTPLHYAAMGGFADCCKYIAQRGCDLKWKNLDHKTPRAVAKEGGFKAASKEIRRAERIANKLARPGAKNPNPLWALRLHDWSVEREAFLREAFAVLD-RGDGSISKNDFVMVLEERQDYASSEQLAAIAHLHEKTRGGGVNINEFFKGTRYLNKSFVLGSYGPKKKEKGMGKKGKKGKFVLPLPICVIPEYAFPRRQDGGPPYYMIETYKNVTDSSRFNRDHPPEHPIQDDSVWYIDDSEKVFSNINIITKAGDLASLKKAFESGIPVDMKDNYYKTPLMTACASGNIDVVKFLLEKGANVNATDNFLWTPLHFACHAGQQDIVELLVESGALIDAASINNSTPLNRAIESCRLDTVKYLLDIGAKFQLENRKGHSAMDVAKAYADYRIIDLIKEKLDNLPKPAENQKLKG-KTPPILKTEGPEIKKEEELLSSIYGVPTTSEGKKVQKGNVVHLNSLITSGYTKKV----DITFIPRRIWSPEATTAELIRKRELRRERFTHEVDF-DDFMMPFQKNITEKARA 769          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 110.538 bits (275), Expect = 8.333e-24
Identity = 143/616 (23.21%), Postives = 240/616 (38.96%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELK--LLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFL---------TGKKYVNKLYLMSAF-----EXXXXXXXXXXXXXXXXXXIPIEICVMPESH--IMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPD----RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIK 2057
            N  T L +A+   + + +K LLD GA  D    +G + +   A+ GH    E L    A +     NG + L+        H  C++  L++NV +++V+ D  T L  A   G  + ++  +LL   A+PN                       +K L           +G T +H A K    K +  L   GA      ++   PIH AA  GH +    L   G +P   N  GE A  +A    A+    EV++                     + V++  ++  + K     L  S  + K + V  L++  A  N        P     ++G  D A FL         T KK    L++ + +          +K        +    P+ +    ++    +  +D G       K  Y T L+  + +N    +I      Y  D +    +   +++ AA+ G +D + L L +   V+  ++   T L  AA    +++   L+N GA V+A+    +TPLH   H G I IV  L+ + A V+AK  NG TPL +A +    +++  LL+  A        G T L +A       V++ +K
Sbjct:  261 NDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQ--GDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCG--HYKVAKVLLDKKANPN-----------------------AKAL-----------NGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMA----ARSGQAEVVR---------------------YLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGY-TPLHIAAKKN--QMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 810          

HSP 2 Score: 81.2629 bits (199), Expect = 8.171e-15
Identity = 49/133 (36.84%), Postives = 70/133 (52.63%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            AA+  D  +  L L+     D   +   T L  AAHYGN+++   L+N  A V+       TPLH A+  G  ++V+LL++ GA +DAK  +G TPL     S    VVE LL + A I  +   GL+PL +A
Sbjct:  203 AARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMA 335          

HSP 3 Score: 80.4925 bits (197), Expect = 1.281e-14
Identity = 53/160 (33.12%), Postives = 77/160 (48.12%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKG 2099
            AA  G ++ +   +  G   +T +   +TAL  AA  G  ++  +L+  GA V AK     TPLH +A  G  DIV+ L+  GA  +A   +G TPL  +      +V  FLL  GA + +   KG TPL +A  +    V N++  K  A P    K G
Sbjct:  434 AAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQK-SASPDAAGKSG 592          

HSP 4 Score: 78.5666 bits (192), Expect = 4.497e-14
Identity = 45/145 (31.03%), Postives = 81/145 (55.86%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA+ G L+     +K G  ++  ++    AL  A+  G++++   L+   A+V+A      T LH A+ +G  ++V++L+ NGA V+A++ NG TPL+ A + +   VV+FLL  GA   +    G TPL +A      +V++++
Sbjct:   42 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLL 186          

HSP 5 Score: 77.7962 bits (190), Expect = 8.496e-14
Identity = 52/162 (32.10%), Postives = 77/162 (47.53%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII---KAKVDA 2072
            + F  ++ AAK+G L+   L L+K    D   +   T L  AAHY N  + + L++ GA  +A     +TPLH AA    +DI   L+  GA  +A    G   +  A +    ++V  LL + A + + N  GLTPL LA       V  ++    A VDA
Sbjct:  558 KGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDA 719          

HSP 6 Score: 74.3294 bits (181), Expect = 9.053e-13
Identity = 46/151 (30.46%), Postives = 76/151 (50.33%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            F  ++ AA +G+++   L L +   VD   R   T L  A+  GN +M   L++ GA ++AK     TPLH  A SG   +VE+L++  A + +K  NG +PL  A +    N V+ LL+    +    +  LT L +A +    +V  ++
Sbjct:  230 FTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVL 380          

HSP 7 Score: 72.7886 bits (177), Expect = 2.967e-12
Identity = 56/170 (32.94%), Postives = 80/170 (47.06%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLI--NYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRG 2105
            F  +  A + G    + L L+     DT+ +    AL  AA   +      L+  +  ADV +K  F  TPLH AAH G I++  LL+N  A VD  A N  TPL  A +    N+V+ LL +GAKI  +   GLTPL         +V+ ++   +D   P+  K   G
Sbjct:  168 FTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGF--TPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEML---LDRAAPILSKTKNG 328          

HSP 8 Score: 72.4034 bits (176), Expect = 3.667e-12
Identity = 65/234 (27.78%), Postives = 105/234 (44.87%), Query Frame = 3
Query:  222 IKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGH--VASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA 917
            ++ LV +G +  +     D+ +T L I+      D ++ LL  GA P+     G + + ++A+ GH  VA+F  L   GA L +    G   L+  V+      E     L+ +   +   K G T L  A     +N+++ L+LL  GA P+   K  G TPL  A       I +  L+ G D N   R G  +VH AA+ G+   +  L    A  ++ + +   P+H AA
Sbjct:  476 VRYLVQDGAQ--VEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAF--LLDHGASLSITTKKGFTPLH--VAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAH--YDNQKVALLLLDQGASPHAAAK-NGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAA 699          

HSP 9 Score: 71.633 bits (174), Expect = 6.809e-12
Identity = 53/162 (32.72%), Postives = 77/162 (47.53%), Query Frame = 3
Query: 1623 AKHGD-LDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII---------KAKVDALP 2078
            A  GD L+ ++L L+    VD     Y TAL  AAH G+  +   L++  A+ NAK    +TPLH A     I ++ELL+ +GA + A   +G TP+  A      N+V  L+  GA     N +G T L +A     + V+  +         KAK D  P
Sbjct:  335 ATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTP 496          

HSP 10 Score: 66.6254 bits (161), Expect = 2.433e-10
Identity = 67/265 (25.28%), Postives = 105/265 (39.62%), Query Frame = 3
Query:  231 LVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKG 1022
            L+D+G    I   +   G T L +A     L+    LL   A PD     G + + +AA Y +      L   GA       NG   L+  ++  +   +   T L Y  D N V++ G   +  A ++G  + ++  +LL   A+ N+  K +G TPL  A      ++    +  G   +   + G T +H     GN K +  L    A+ +        P+H AA  GH      L Q   +P     NG  A  IA+  G
Sbjct:  545 LLDHGASLSITTKK---GFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLH--IAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEG--HVDMVSLLLGRNANVNLSNK-SGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLG 801          

HSP 11 Score: 63.1586 bits (152), Expect = 2.417e-9
Identity = 76/251 (30.28%), Postives = 108/251 (43.03%), Query Frame = 3
Query:  222 IKKLVDNGVEHLINYN-EPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNV---SKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQN--NPIHYAAAG-HASCCKFLGQ 953
            +K LV NG     N N +  NG T L +A  EN L+ +KFLLD GA   +   +G + + +A Q GH      L +       ND  GK V    +    R  +    AL    D NN    SK G T L  A   G  N  +  +LL   A  +   +    TPL  A   G+ ++    L  G   +   R G T +H  A+SG+ + +  L    A   +   T+N  +P+H A  G H +C + L Q
Sbjct:  117 VKVLVTNGA----NVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGK-VRLPALHIAARKDDTKAAALLLQND-NNADVESKSGFTPLHIAAHYGNIN--VATLLLNRAAAVDFTAR-NDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAA--PILSKTKNGLSPLHMATQGDHLNCVQLLLQ 349          

HSP 12 Score: 62.3882 bits (150), Expect = 4.263e-9
Identity = 46/181 (25.41%), Postives = 82/181 (45.30%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLK---------------------KGAKIQMEN--------SKGLTPLDLAYNWADSRVINIIKAKVDAL 2075
            A+K G ++ +   L++   VD   +   TAL  A+  G  ++   L+  GA+VNA+    +TPL+ AA    +++V+ L++NGA       +G TPL  A++     VV  LL+                     K A + ++N          G TPL +A ++ +  V  ++  +  A+
Sbjct:   75 ASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAV 255          

HSP 13 Score: 55.4546 bits (132), Expect = 5.885e-7
Identity = 37/133 (27.82%), Postives = 61/133 (45.86%), Query Frame = 3
Query: 1671 YKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVD 2069
            Y   +R      + + AA  G+L+  +  I  G D+N  +      LH A+  G +++V  L+   A VDA    G T L  A  + +  VV+ L+  GA +  ++  G TPL   Y  A    + ++K  +D
Sbjct:   26 YSRSSRKSDANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPL---YMAAQENHLEVVKFLLD 155          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Human
Match: TNKS (tankyrase [Source:HGNC Symbol;Acc:HGNC:11941])

HSP 1 Score: 108.612 bits (270), Expect = 2.573e-23
Identity = 155/652 (23.77%), Postives = 257/652 (39.42%), Query Frame = 3
Query:  177 IRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNG---KTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKT-----------VLFHACEDGKE-------NEEICLILLK------HGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMK------EVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTF---VNMNDAAKHGDLDSIKLALKKGYKVDTRD--RFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDL 2015
            +R++L+     D  ++K+LVD       N N  D      + L  A      D ++ LL +GA+    D  G   +  A  +GH      L   GAD    D N      +  +   +   C+   L++  D N  + DGK+           VL   C+  +        NEE  + LL       H +D          TPL  A       I    L+ G D +  D+ G   +H A   G+++    L   GA  +  D  Q  P+H AA+      C  L   G +P + N +G+ A  +A     ++ +        +++  R    L K  +  AL + ++      E      +  L       +K+  +LL+R  A +NE+ +  + P     +    D  + L   K+  K+  +         +              ++ C +  S+      G  P +          L  F++    +  ++   S     P RT      + +A+K GDL+++K  L     V+ RD    + T L  AA Y  + +  +L+++GADV+AKD     PLH+A   G  ++ ELL+ +GA V+   L   TPL  A    ++ + + LLK GA    +N  G TPLDL
Sbjct:  183 LRELLEACRNGDVSRVKRLVDAA-----NVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARD-NWNYTPLHEAAIKGKIDVCI-VLLQHGADPNIRNTDGKSALDLADPSAKAVLTGQCKSSEHVKFYRSGNEEKLMALLTPLNVNCHASD------GRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAARE-ADLAKVKKTLALEIINFKQPQSHETALHCAVASLHP----KRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVL--HKHGAKMNALDTLGQTALHRAALAGH--------LQTCRLLLSY------GSDPSI--------ISLQGFTAAQMGNEAVQQILSE--STPIRTSDVDYRLLEASKAGDLETVK-QLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDL 789          

HSP 2 Score: 86.2705 bits (212), Expect = 1.968e-16
Identity = 67/169 (39.64%), Postives = 87/169 (51.48%), Query Frame = 3
Query: 1581 IGDPDRTFVNMNDAAKHGDLDSI-KLALKKGYKV-DTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPP 2081
            I D  R    + DAAK G L  + KL   +     DT+ R   T L  AA Y NL++  +L+ +GADVNA+D     PLH+AA  G +DI  LLI     V+A      TPL  A +  R  +   LL  GA   M+N +G TPLDLA   AD    +I    +DA+PP
Sbjct:  797 IQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGR-NSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLA--TAD----DIRALLIDAMPP 958          

HSP 3 Score: 68.1662 bits (165), Expect = 6.677e-11
Identity = 40/105 (38.10%), Postives = 56/105 (53.33%), Query Frame = 3
Query: 1704 TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            T L  AA Y  + +   L+ +GADV+AKD     PLH+A   G  ++ ELL+ +GA V+A  L   TPL  A   +R  V   LL  GA   + N  G + +D+A
Sbjct:  371 TPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMA 475          

HSP 4 Score: 65.855 bits (159), Expect = 3.212e-10
Identity = 45/136 (33.09%), Postives = 73/136 (53.68%), Query Frame = 3
Query: 1617 DAAKHGDLDSIKLALKKGYKVDTRDRFYK--TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            +A ++GD+  +K  L     V+ +D   +  + L  AA +G  D+  HL+  GA+V+A+D+    PLH+A   G  ++V LL+  GA  +A+     TPL  A    + +V   LL+ GA   + N+ G + LDLA
Sbjct:  188 EACRNGDVSRVK-RLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLA 322          

HSP 5 Score: 59.6918 bits (143), Expect = 2.911e-8
Identity = 48/166 (28.92%), Postives = 78/166 (46.99%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGA-----VVDAK-ALNGATPLFRAI--------ESSRF-------NVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA  G  D ++  L+ G  V  RD      L +A  +G+ ++   L+  GAD NA+DN+++TPLH AA  G ID+  +L+ +GA       D K AL+ A P  +A+        E  +F        ++  L          + +  TPL LA  +   R++ ++
Sbjct:  223 AAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGQCKSSEHVKFYRSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLL 388          

HSP 6 Score: 57.3806 bits (137), Expect = 1.615e-7
Identity = 97/441 (22.00%), Postives = 162/441 (36.73%), Query Frame = 3
Query:  186 VLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSE---NDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILL------------------KHGADPNIIQKATGK------------TPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAK-----------------DKGAKDCMKEVIKV-----ERSFGKLGKNNEPWALG-------LYDWTVENMTEIVEELK--LLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFL 1313
            +LQ   E D  ++KK +      +IN+ +P + +T L  A +          + LL  GA+ +  + +  + + +AA+  H    E L K GA +   D  G+  L+   +    H +     L Y  D + +S  G    F A + G  NE +  IL                   K G    + Q  + +            TPL  A      S+    L  G D +  D+ G   +H A   G+++    L   GA  +V D  +  P+H AAA G    CK L + G +P  KN +G     + K                 D   K C+  V K+            G+N+ P  L        + ++ +E+  ++  + K  L+ L N+      +   LLI+    +N   +    P  +  + G       L
Sbjct:  493 LLQAAREADLAKVKKTL---ALEIINFKQPQSHETALHCAVASLHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHR--AALAGHLQTCRLLLSYGSDPSIISLQG----FTAAQMG--NEAVQQILSESTPIRTSDVDYRLLEASKAGDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALL 922          

HSP 7 Score: 56.225 bits (134), Expect = 3.615e-7
Identity = 68/292 (23.29%), Postives = 111/292 (38.01%), Query Frame = 3
Query:  183 KVLQCTYEKDYDQIKKLVDNGVEHLINYNEPD---NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEI--------------CLILLKHGADPNIIQ----KATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGE 992
            ++L+ +   D + +K+L  +      N N  D      T L  A   N +  +++LL  GA     D  G   +  A  YGH    E L + GA + + DL     L+   +  +   E  +  L++  D    ++DG T L    E   + +++              CL  ++    P  I     +    TPL  A    +  +    L+ G D N  D+ G   +H AA  G+      L  +    +  D     P+H AA  G    C  L   G +P +KN  G+
Sbjct:  653 RLLEASKAGDLETVKQLCSSQ-----NVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKY--EICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQ 937          

HSP 8 Score: 54.299 bits (129), Expect = 1.205e-6
Identity = 45/173 (26.01%), Postives = 77/173 (44.51%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDA--------------------KALNG--ATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
             V +++A  +G  +  +L ++ G  V+  D +  T L  AA  G  ++C  L+ +GAD   K+    TPL      G  DI +LL  + A++DA                    +   G  +TPL  A   +   V E+LL+ GA +  ++  GL PL  A ++    +  ++
Sbjct:  718 LVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPL-DLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALL 889          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Human
Match: TNKS (tankyrase [Source:HGNC Symbol;Acc:HGNC:11941])

HSP 1 Score: 108.612 bits (270), Expect = 2.573e-23
Identity = 155/652 (23.77%), Postives = 257/652 (39.42%), Query Frame = 3
Query:  177 IRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNG---KTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKT-----------VLFHACEDGKE-------NEEICLILLK------HGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMK------EVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTF---VNMNDAAKHGDLDSIKLALKKGYKVDTRD--RFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDL 2015
            +R++L+     D  ++K+LVD       N N  D      + L  A      D ++ LL +GA+    D  G   +  A  +GH      L   GAD    D N      +  +   +   C+   L++  D N  + DGK+           VL   C+  +        NEE  + LL       H +D          TPL  A       I    L+ G D +  D+ G   +H A   G+++    L   GA  +  D  Q  P+H AA+      C  L   G +P + N +G+ A  +A     ++ +        +++  R    L K  +  AL + ++      E      +  L       +K+  +LL+R  A +NE+ +  + P     +    D  + L   K+  K+  +         +              ++ C +  S+      G  P +          L  F++    +  ++   S     P RT      + +A+K GDL+++K  L     V+ RD    + T L  AA Y  + +  +L+++GADV+AKD     PLH+A   G  ++ ELL+ +GA V+   L   TPL  A    ++ + + LLK GA    +N  G TPLDL
Sbjct:  183 LRELLEACRNGDVSRVKRLVDAA-----NVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARD-NWNYTPLHEAAIKGKIDVCI-VLLQHGADPNIRNTDGKSALDLADPSAKAVLTGQCKSSEHVKFYRSGNEEKLMALLTPLNVNCHASD------GRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAARE-ADLAKVKKTLALEIINFKQPQSHETALHCAVASLHP----KRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVL--HKHGAKMNALDTLGQTALHRAALAGH--------LQTCRLLLSY------GSDPSI--------ISLQGFTAAQMGNEAVQQILSE--STPIRTSDVDYRLLEASKAGDLETVK-QLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDL 789          

HSP 2 Score: 86.2705 bits (212), Expect = 1.968e-16
Identity = 67/169 (39.64%), Postives = 87/169 (51.48%), Query Frame = 3
Query: 1581 IGDPDRTFVNMNDAAKHGDLDSI-KLALKKGYKV-DTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPP 2081
            I D  R    + DAAK G L  + KL   +     DT+ R   T L  AA Y NL++  +L+ +GADVNA+D     PLH+AA  G +DI  LLI     V+A      TPL  A +  R  +   LL  GA   M+N +G TPLDLA   AD    +I    +DA+PP
Sbjct:  797 IQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGR-NSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLA--TAD----DIRALLIDAMPP 958          

HSP 3 Score: 68.1662 bits (165), Expect = 6.677e-11
Identity = 40/105 (38.10%), Postives = 56/105 (53.33%), Query Frame = 3
Query: 1704 TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            T L  AA Y  + +   L+ +GADV+AKD     PLH+A   G  ++ ELL+ +GA V+A  L   TPL  A   +R  V   LL  GA   + N  G + +D+A
Sbjct:  371 TPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMA 475          

HSP 4 Score: 65.855 bits (159), Expect = 3.212e-10
Identity = 45/136 (33.09%), Postives = 73/136 (53.68%), Query Frame = 3
Query: 1617 DAAKHGDLDSIKLALKKGYKVDTRDRFYK--TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            +A ++GD+  +K  L     V+ +D   +  + L  AA +G  D+  HL+  GA+V+A+D+    PLH+A   G  ++V LL+  GA  +A+     TPL  A    + +V   LL+ GA   + N+ G + LDLA
Sbjct:  188 EACRNGDVSRVK-RLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLA 322          

HSP 5 Score: 59.6918 bits (143), Expect = 2.911e-8
Identity = 48/166 (28.92%), Postives = 78/166 (46.99%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGA-----VVDAK-ALNGATPLFRAI--------ESSRF-------NVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA  G  D ++  L+ G  V  RD      L +A  +G+ ++   L+  GAD NA+DN+++TPLH AA  G ID+  +L+ +GA       D K AL+ A P  +A+        E  +F        ++  L          + +  TPL LA  +   R++ ++
Sbjct:  223 AAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGQCKSSEHVKFYRSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLL 388          

HSP 6 Score: 57.3806 bits (137), Expect = 1.615e-7
Identity = 97/441 (22.00%), Postives = 162/441 (36.73%), Query Frame = 3
Query:  186 VLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSE---NDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILL------------------KHGADPNIIQKATGK------------TPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAK-----------------DKGAKDCMKEVIKV-----ERSFGKLGKNNEPWALG-------LYDWTVENMTEIVEELK--LLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFL 1313
            +LQ   E D  ++KK +      +IN+ +P + +T L  A +          + LL  GA+ +  + +  + + +AA+  H    E L K GA +   D  G+  L+   +    H +     L Y  D + +S  G    F A + G  NE +  IL                   K G    + Q  + +            TPL  A      S+    L  G D +  D+ G   +H A   G+++    L   GA  +V D  +  P+H AAA G    CK L + G +P  KN +G     + K                 D   K C+  V K+            G+N+ P  L        + ++ +E+  ++  + K  L+ L N+      +   LLI+    +N   +    P  +  + G       L
Sbjct:  493 LLQAAREADLAKVKKTL---ALEIINFKQPQSHETALHCAVASLHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHR--AALAGHLQTCRLLLSYGSDPSIISLQG----FTAAQMG--NEAVQQILSESTPIRTSDVDYRLLEASKAGDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALL 922          

HSP 7 Score: 56.225 bits (134), Expect = 3.615e-7
Identity = 68/292 (23.29%), Postives = 111/292 (38.01%), Query Frame = 3
Query:  183 KVLQCTYEKDYDQIKKLVDNGVEHLINYNEPD---NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEI--------------CLILLKHGADPNIIQ----KATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGE 992
            ++L+ +   D + +K+L  +      N N  D      T L  A   N +  +++LL  GA     D  G   +  A  YGH    E L + GA + + DL     L+   +  +   E  +  L++  D    ++DG T L    E   + +++              CL  ++    P  I     +    TPL  A    +  +    L+ G D N  D+ G   +H AA  G+      L  +    +  D     P+H AA  G    C  L   G +P +KN  G+
Sbjct:  653 RLLEASKAGDLETVKQLCSSQ-----NVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKY--EICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQ 937          

HSP 8 Score: 54.299 bits (129), Expect = 1.205e-6
Identity = 45/173 (26.01%), Postives = 77/173 (44.51%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDA--------------------KALNG--ATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
             V +++A  +G  +  +L ++ G  V+  D +  T L  AA  G  ++C  L+ +GAD   K+    TPL      G  DI +LL  + A++DA                    +   G  +TPL  A   +   V E+LL+ GA +  ++  GL PL  A ++    +  ++
Sbjct:  718 LVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPL-DLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALL 889          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 112.079 bits (279), Expect = 9.617e-25
Identity = 154/639 (24.10%), Postives = 252/639 (39.44%), Query Frame = 3
Query:  291 CLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADL---------------KLNDLNGKNVLY-----------------YCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEI----CVMP---ESH------IMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRT----FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIK 2057
             L IA  ++D      LL    +PDV    G + + IAA YGH    + L + GA++               K    N  N+L                  +C + +  H + ++  +     ++  +K+G   L  A +   ++ +    LL H A  + +      TPL  A   G   +    L    DPN+   +G T +H A K    K +  L  + A  +   ++   P+H AA  G  +   +L Q+G NP V+   GE    +A      D ++ +I   R+  K+          L+  +    T+IV  L L    NS    +  +  L I  K    EE+   +L   D N D T      L  KK    L+L S +                +   P++I     V P    +H       M  ++ G       K  Y T L+  + +N    EI      +  DP+      F  ++ +A+ G  +   L ++ G  V  +     TA+   A   ++ +   L N GA++N+K N  +TPLH A H G +++V+ L+ NGA V  K     TPL +A +    N V +LL+ GA    + + G TPL +A       V+  ++
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSG-HDQVVDLLVVQGAPISAKTKNGLAPLHMAAQG--DHVDAARTLLYHRAPVDDV-TVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI---RNGAKVDAQARELQTPLHIASRLGNTDIVI-LLLQAGANSNATTRDNYSPLHIAAKEG-QEEVAGILL---DHNADKT------LLTKKGFTPLHLASKY------GNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGY-TPLHIAAKKN--QMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 2 Score: 82.4185 bits (202), Expect = 1.417e-15
Identity = 48/145 (33.10%), Postives = 79/145 (54.48%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA+ GDL+ +   L+ G  ++T +     +L  A+  G+ ++   LI   A V+A      T LH A+ +G   IV +L+ NGA V+ +++NG TPL+ A + +   VV++LLK GA   +    G TPL +A      RV+ ++
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL 184          

HSP 3 Score: 79.7221 bits (195), Expect = 8.140e-15
Identity = 55/191 (28.80%), Postives = 89/191 (46.60%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGN---------------------------------LDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVD 2069
            + F  ++ A+K+G+L+ ++L L++G  VD   +   T L  AAHY N                                 +++   L+ + AD NAK    +TPLH +A  G  +I  LLI NG+ V AKA NG T +    +     V + L   GA+I  + + G TPL +A ++     +N++K  V+
Sbjct:  556 KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQ---LNMVKFLVE 743          

HSP 4 Score: 77.7962 bits (190), Expect = 3.562e-14
Identity = 53/154 (34.42%), Postives = 80/154 (51.95%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII---KAKVDA 2072
            AA+   +D+ +  L     VD     Y T L  AAH G++ +   L++  AD N++    +TPLH A     I +VELL+   A ++A   +G TPL  A      N+V +LL++GA   +E  +G TPL LA     + V+ ++    AKVDA
Sbjct:  333 AAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDA 486          

HSP 5 Score: 70.4774 bits (171), Expect = 4.998e-12
Identity = 71/295 (24.07%), Postives = 122/295 (41.36%), Query Frame = 3
Query:  189 LQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDG---------------------------KENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNG 989
            L+     D +++ +L+  G +  IN +   NG   L +A+ E   + ++ L+   A  D    +G +A+ IA+  G       L + GA++ +  +NG   LY      E H+E ++  L++  +    ++DG T L  A + G                           K++     +LL++  +P++  K +G TPL  A   G  ++    L+ G + N   RH  + +H A K G       L + GA  D        P+H AA +GH      L  +G     K  NG
Sbjct:   38 LRAARAGDLEKVLELLRAGTD--INTSNA-NGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ--ENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSK-SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNG 326          

HSP 6 Score: 65.855 bits (159), Expect = 1.458e-10
Identity = 71/284 (25.00%), Postives = 119/284 (41.90%), Query Frame = 3
Query:  168 ILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINY-----NEPD----NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNG 989
            +L+ R  ++ T E     +      G  +++ Y       PD     G+T L +A   N  D ++ L+  GA  D    E ++ + IA++ G+      L +AGA+      +  + L+  ++  E  +E     L +N D   ++K G T L  A + G  N E+  +LL+ G  P  I+     TPL  A    +  +    L+ G     A ++G T +H AAK    +    L  F A  +        P+H +A  GH      L + G +   K +NG
Sbjct:  411 LLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLH--IAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYG--NLEVVRLLLERGT-PVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNG 689          

HSP 7 Score: 64.6994 bits (156), Expect = 3.579e-10
Identity = 60/259 (23.17%), Postives = 107/259 (41.31%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIK 1052
            NG T L IA  +N +  ++ LL   A  +     G + + +AA  G +     L + GA+  +  + G+  L+      +   + +   +R    ++  +++ +T L  A   G  N +I ++LL+ GA+ N   +    +PL  A   G   +    L    D     + G T +H A+K GN + +  L   G   D+    Q  P+H AA   +      L + G + K    NG     IA  K   +    +++
Sbjct:  391 NGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQ--TDVVRVLIRNGAKVDAQARELQTPLHIASRLG--NTDIVILLLQAGANSNATTR-DNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 8 Score: 62.003 bits (149), Expect = 2.490e-9
Identity = 52/192 (27.08%), Postives = 83/192 (43.23%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALR 854
            NG T L IA  +N ++    LL   A P+     G + + ++AQ GH      L + G+D+     NG   ++ C    E H    +       ++N+ +  G T L  AC  G+ N  +   L+++GAD     +A+  TPL  A   G  +     L+ G  PN     G+T +  A + G    +  LR
Sbjct:  622 NGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQ--EDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLN--MVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 9 Score: 53.1434 bits (126), Expect = 1.060e-6
Identity = 36/118 (30.51%), Postives = 60/118 (50.85%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAK 1973
            A+K G  + ++  +K+  +VD   R   TAL  A+  G   +   L+  GA+VN +    +TPL+ AA     ++V+ L+ +GA       +G TPL  A++     VV  LL+  +K
Sbjct:   73 ASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK 190          

HSP 10 Score: 52.7582 bits (125), Expect = 1.310e-6
Identity = 64/255 (25.10%), Postives = 105/255 (41.18%), Query Frame = 3
Query:  288 TCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGA---DLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKAT--GKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDC 1034
            T L  A        +  L+  GA        G + + +AAQ  HV +  +L    A   D+ ++ L   +V  +C      H    +  L  + D N+ + +G T L  AC+  K   ++  +LLK+ A    I+  T  G TPL  A   G+ +I    L+ G +P+     G+T +H AA++     +  L   GA+ D        P+H A+  G+      L Q G N      +      IA  +G ++ 
Sbjct:  295 TPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHC-----GHVRVAKLLLDRSADPNSRALNGFTPLHIACK--KNRIKVVELLLKYRA---AIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEV 539          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 112.079 bits (279), Expect = 9.617e-25
Identity = 154/639 (24.10%), Postives = 252/639 (39.44%), Query Frame = 3
Query:  291 CLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADL---------------KLNDLNGKNVLY-----------------YCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEI----CVMP---ESH------IMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRT----FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIK 2057
             L IA  ++D      LL    +PDV    G + + IAA YGH    + L + GA++               K    N  N+L                  +C + +  H + ++  +     ++  +K+G   L  A +   ++ +    LL H A  + +      TPL  A   G   +    L    DPN+   +G T +H A K    K +  L  + A  +   ++   P+H AA  G  +   +L Q+G NP V+   GE    +A      D ++ +I   R+  K+          L+  +    T+IV  L L    NS    +  +  L I  K    EE+   +L   D N D T      L  KK    L+L S +                +   P++I     V P    +H       M  ++ G       K  Y T L+  + +N    EI      +  DP+      F  ++ +A+ G  +   L ++ G  V  +     TA+   A   ++ +   L N GA++N+K N  +TPLH A H G +++V+ L+ NGA V  K     TPL +A +    N V +LL+ GA    + + G TPL +A       V+  ++
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSG-HDQVVDLLVVQGAPISAKTKNGLAPLHMAAQG--DHVDAARTLLYHRAPVDDV-TVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI---RNGAKVDAQARELQTPLHIASRLGNTDIVI-LLLQAGANSNATTRDNYSPLHIAAKEG-QEEVAGILL---DHNADKT------LLTKKGFTPLHLASKY------GNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGY-TPLHIAAKKN--QMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 2 Score: 82.4185 bits (202), Expect = 1.417e-15
Identity = 48/145 (33.10%), Postives = 79/145 (54.48%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA+ GDL+ +   L+ G  ++T +     +L  A+  G+ ++   LI   A V+A      T LH A+ +G   IV +L+ NGA V+ +++NG TPL+ A + +   VV++LLK GA   +    G TPL +A      RV+ ++
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL 184          

HSP 3 Score: 79.7221 bits (195), Expect = 8.140e-15
Identity = 55/191 (28.80%), Postives = 89/191 (46.60%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGN---------------------------------LDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVD 2069
            + F  ++ A+K+G+L+ ++L L++G  VD   +   T L  AAHY N                                 +++   L+ + AD NAK    +TPLH +A  G  +I  LLI NG+ V AKA NG T +    +     V + L   GA+I  + + G TPL +A ++     +N++K  V+
Sbjct:  556 KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQ---LNMVKFLVE 743          

HSP 4 Score: 77.7962 bits (190), Expect = 3.562e-14
Identity = 53/154 (34.42%), Postives = 80/154 (51.95%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII---KAKVDA 2072
            AA+   +D+ +  L     VD     Y T L  AAH G++ +   L++  AD N++    +TPLH A     I +VELL+   A ++A   +G TPL  A      N+V +LL++GA   +E  +G TPL LA     + V+ ++    AKVDA
Sbjct:  333 AAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDA 486          

HSP 5 Score: 70.4774 bits (171), Expect = 4.998e-12
Identity = 71/295 (24.07%), Postives = 122/295 (41.36%), Query Frame = 3
Query:  189 LQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDG---------------------------KENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNG 989
            L+     D +++ +L+  G +  IN +   NG   L +A+ E   + ++ L+   A  D    +G +A+ IA+  G       L + GA++ +  +NG   LY      E H+E ++  L++  +    ++DG T L  A + G                           K++     +LL++  +P++  K +G TPL  A   G  ++    L+ G + N   RH  + +H A K G       L + GA  D        P+H AA +GH      L  +G     K  NG
Sbjct:   38 LRAARAGDLEKVLELLRAGTD--INTSNA-NGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ--ENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSK-SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNG 326          

HSP 6 Score: 65.855 bits (159), Expect = 1.458e-10
Identity = 71/284 (25.00%), Postives = 119/284 (41.90%), Query Frame = 3
Query:  168 ILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINY-----NEPD----NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNG 989
            +L+ R  ++ T E     +      G  +++ Y       PD     G+T L +A   N  D ++ L+  GA  D    E ++ + IA++ G+      L +AGA+      +  + L+  ++  E  +E     L +N D   ++K G T L  A + G  N E+  +LL+ G  P  I+     TPL  A    +  +    L+ G     A ++G T +H AAK    +    L  F A  +        P+H +A  GH      L + G +   K +NG
Sbjct:  411 LLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLH--IAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYG--NLEVVRLLLERGT-PVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNG 689          

HSP 7 Score: 64.6994 bits (156), Expect = 3.579e-10
Identity = 60/259 (23.17%), Postives = 107/259 (41.31%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIK 1052
            NG T L IA  +N +  ++ LL   A  +     G + + +AA  G +     L + GA+  +  + G+  L+      +   + +   +R    ++  +++ +T L  A   G  N +I ++LL+ GA+ N   +    +PL  A   G   +    L    D     + G T +H A+K GN + +  L   G   D+    Q  P+H AA   +      L + G + K    NG     IA  K   +    +++
Sbjct:  391 NGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQ--TDVVRVLIRNGAKVDAQARELQTPLHIASRLG--NTDIVILLLQAGANSNATTR-DNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 8 Score: 62.003 bits (149), Expect = 2.490e-9
Identity = 52/192 (27.08%), Postives = 83/192 (43.23%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALR 854
            NG T L IA  +N ++    LL   A P+     G + + ++AQ GH      L + G+D+     NG   ++ C    E H    +       ++N+ +  G T L  AC  G+ N  +   L+++GAD     +A+  TPL  A   G  +     L+ G  PN     G+T +  A + G    +  LR
Sbjct:  622 NGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQ--EDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLN--MVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 9 Score: 53.1434 bits (126), Expect = 1.060e-6
Identity = 36/118 (30.51%), Postives = 60/118 (50.85%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAK 1973
            A+K G  + ++  +K+  +VD   R   TAL  A+  G   +   L+  GA+VN +    +TPL+ AA     ++V+ L+ +GA       +G TPL  A++     VV  LL+  +K
Sbjct:   73 ASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK 190          

HSP 10 Score: 52.7582 bits (125), Expect = 1.310e-6
Identity = 64/255 (25.10%), Postives = 105/255 (41.18%), Query Frame = 3
Query:  288 TCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGA---DLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKAT--GKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDC 1034
            T L  A        +  L+  GA        G + + +AAQ  HV +  +L    A   D+ ++ L   +V  +C      H    +  L  + D N+ + +G T L  AC+  K   ++  +LLK+ A    I+  T  G TPL  A   G+ +I    L+ G +P+     G+T +H AA++     +  L   GA+ D        P+H A+  G+      L Q G N      +      IA  +G ++ 
Sbjct:  295 TPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHC-----GHVRVAKLLLDRSADPNSRALNGFTPLHIACK--KNRIKVVELLLKYRA---AIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEV 539          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 111.694 bits (278), Expect = 1.487e-24
Identity = 154/639 (24.10%), Postives = 252/639 (39.44%), Query Frame = 3
Query:  291 CLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADL---------------KLNDLNGKNVLY-----------------YCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEI----CVMP---ESH------IMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRT----FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIK 2057
             L IA  ++D      LL    +PDV    G + + IAA YGH    + L + GA++               K    N  N+L                  +C + +  H + ++  +     ++  +K+G   L  A +   ++ +    LL H A  + +      TPL  A   G   +    L    DPN+   +G T +H A K    K +  L  + A  +   ++   P+H AA  G  +   +L Q+G NP V+   GE    +A      D ++ +I   R+  K+          L+  +    T+IV  L L    NS    +  +  L I  K    EE+   +L   D N D T      L  KK    L+L S +                +   P++I     V P    +H       M  ++ G       K  Y T L+  + +N    EI      +  DP+      F  ++ +A+ G  +   L ++ G  V  +     TA+   A   ++ +   L N GA++N+K N  +TPLH A H G +++V+ L+ NGA V  K     TPL +A +    N V +LL+ GA    + + G TPL +A       V+  ++
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARS-GHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQG--DHVDAARTLLYHRAPVDDV-TVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI---RNGAKVDAQARELQTPLHIASRLGNTDIVI-LLLQAGANSNATTRDNYSPLHIAAKEG-QEEVAGILL---DHNADKT------LLTKKGFTPLHLASKY------GNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGY-TPLHIAAKKN--QMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 2 Score: 82.4185 bits (202), Expect = 1.344e-15
Identity = 48/145 (33.10%), Postives = 79/145 (54.48%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA+ GDL+ +   L+ G  ++T +     +L  A+  G+ ++   LI   A V+A      T LH A+ +G   IV +L+ NGA V+ +++NG TPL+ A + +   VV++LLK GA   +    G TPL +A      RV+ ++
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL 184          

HSP 3 Score: 79.7221 bits (195), Expect = 7.588e-15
Identity = 55/191 (28.80%), Postives = 89/191 (46.60%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGN---------------------------------LDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVD 2069
            + F  ++ A+K+G+L+ ++L L++G  VD   +   T L  AAHY N                                 +++   L+ + AD NAK    +TPLH +A  G  +I  LLI NG+ V AKA NG T +    +     V + L   GA+I  + + G TPL +A ++     +N++K  V+
Sbjct:  556 KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQ---LNMVKFLVE 743          

HSP 4 Score: 77.7962 bits (190), Expect = 3.676e-14
Identity = 53/154 (34.42%), Postives = 80/154 (51.95%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII---KAKVDA 2072
            AA+   +D+ +  L     VD     Y T L  AAH G++ +   L++  AD N++    +TPLH A     I +VELL+   A ++A   +G TPL  A      N+V +LL++GA   +E  +G TPL LA     + V+ ++    AKVDA
Sbjct:  333 AAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDA 486          

HSP 5 Score: 70.4774 bits (171), Expect = 5.658e-12
Identity = 71/295 (24.07%), Postives = 122/295 (41.36%), Query Frame = 3
Query:  189 LQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDG---------------------------KENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNG 989
            L+     D +++ +L+  G +  IN +   NG   L +A+ E   + ++ L+   A  D    +G +A+ IA+  G       L + GA++ +  +NG   LY      E H+E ++  L++  +    ++DG T L  A + G                           K++     +LL++  +P++  K +G TPL  A   G  ++    L+ G + N   RH  + +H A K G       L + GA  D        P+H AA +GH      L  +G     K  NG
Sbjct:   38 LRAARAGDLEKVLELLRAGTD--INTSNA-NGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ--ENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSK-SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNG 326          

HSP 6 Score: 65.4698 bits (158), Expect = 1.706e-10
Identity = 71/284 (25.00%), Postives = 119/284 (41.90%), Query Frame = 3
Query:  168 ILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINY-----NEPD----NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNG 989
            +L+ R  ++ T E     +      G  +++ Y       PD     G+T L +A   N  D ++ L+  GA  D    E ++ + IA++ G+      L +AGA+      +  + L+  ++  E  +E     L +N D   ++K G T L  A + G  N E+  +LL+ G  P  I+     TPL  A    +  +    L+ G     A ++G T +H AAK    +    L  F A  +        P+H +A  GH      L + G +   K +NG
Sbjct:  411 LLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLH--IAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYG--NLEVVRLLLERGT-PVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNG 689          

HSP 7 Score: 64.3142 bits (155), Expect = 4.444e-10
Identity = 60/259 (23.17%), Postives = 107/259 (41.31%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIK 1052
            NG T L IA  +N +  ++ LL   A  +     G + + +AA  G +     L + GA+  +  + G+  L+      +   + +   +R    ++  +++ +T L  A   G  N +I ++LL+ GA+ N   +    +PL  A   G   +    L    D     + G T +H A+K GN + +  L   G   D+    Q  P+H AA   +      L + G + K    NG     IA  K   +    +++
Sbjct:  391 NGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQ--TDVVRVLIRNGAKVDAQARELQTPLHIASRLG--NTDIVILLLQAGANSNATTR-DNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 8 Score: 62.003 bits (149), Expect = 2.480e-9
Identity = 52/192 (27.08%), Postives = 83/192 (43.23%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALR 854
            NG T L IA  +N ++    LL   A P+     G + + ++AQ GH      L + G+D+     NG   ++ C    E H    +       ++N+ +  G T L  AC  G+ N  +   L+++GAD     +A+  TPL  A   G  +     L+ G  PN     G+T +  A + G    +  LR
Sbjct:  622 NGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQ--EDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLN--MVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 9 Score: 53.1434 bits (126), Expect = 1.011e-6
Identity = 36/118 (30.51%), Postives = 60/118 (50.85%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAK 1973
            A+K G  + ++  +K+  +VD   R   TAL  A+  G   +   L+  GA+VN +    +TPL+ AA     ++V+ L+ +GA       +G TPL  A++     VV  LL+  +K
Sbjct:   73 ASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK 190          

HSP 10 Score: 52.7582 bits (125), Expect = 1.638e-6
Identity = 64/255 (25.10%), Postives = 105/255 (41.18%), Query Frame = 3
Query:  288 TCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGA---DLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKAT--GKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDC 1034
            T L  A        +  L+  GA        G + + +AAQ  HV +  +L    A   D+ ++ L   +V  +C      H    +  L  + D N+ + +G T L  AC+  K   ++  +LLK+ A    I+  T  G TPL  A   G+ +I    L+ G +P+     G+T +H AA++     +  L   GA+ D        P+H A+  G+      L Q G N      +      IA  +G ++ 
Sbjct:  295 TPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHC-----GHVRVAKLLLDRSADPNSRALNGFTPLHIACK--KNRIKVVELLLKYRA---AIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEV 539          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 111.694 bits (278), Expect = 1.487e-24
Identity = 154/639 (24.10%), Postives = 252/639 (39.44%), Query Frame = 3
Query:  291 CLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADL---------------KLNDLNGKNVLY-----------------YCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEI----CVMP---ESH------IMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRT----FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIK 2057
             L IA  ++D      LL    +PDV    G + + IAA YGH    + L + GA++               K    N  N+L                  +C + +  H + ++  +     ++  +K+G   L  A +   ++ +    LL H A  + +      TPL  A   G   +    L    DPN+   +G T +H A K    K +  L  + A  +   ++   P+H AA  G  +   +L Q+G NP V+   GE    +A      D ++ +I   R+  K+          L+  +    T+IV  L L    NS    +  +  L I  K    EE+   +L   D N D T      L  KK    L+L S +                +   P++I     V P    +H       M  ++ G       K  Y T L+  + +N    EI      +  DP+      F  ++ +A+ G  +   L ++ G  V  +     TA+   A   ++ +   L N GA++N+K N  +TPLH A H G +++V+ L+ NGA V  K     TPL +A +    N V +LL+ GA    + + G TPL +A       V+  ++
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARS-GHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQG--DHVDAARTLLYHRAPVDDV-TVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI---RNGAKVDAQARELQTPLHIASRLGNTDIVI-LLLQAGANSNATTRDNYSPLHIAAKEG-QEEVAGILL---DHNADKT------LLTKKGFTPLHLASKY------GNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGY-TPLHIAAKKN--QMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 2 Score: 82.4185 bits (202), Expect = 1.344e-15
Identity = 48/145 (33.10%), Postives = 79/145 (54.48%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA+ GDL+ +   L+ G  ++T +     +L  A+  G+ ++   LI   A V+A      T LH A+ +G   IV +L+ NGA V+ +++NG TPL+ A + +   VV++LLK GA   +    G TPL +A      RV+ ++
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL 184          

HSP 3 Score: 79.7221 bits (195), Expect = 7.588e-15
Identity = 55/191 (28.80%), Postives = 89/191 (46.60%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGN---------------------------------LDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVD 2069
            + F  ++ A+K+G+L+ ++L L++G  VD   +   T L  AAHY N                                 +++   L+ + AD NAK    +TPLH +A  G  +I  LLI NG+ V AKA NG T +    +     V + L   GA+I  + + G TPL +A ++     +N++K  V+
Sbjct:  556 KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQ---LNMVKFLVE 743          

HSP 4 Score: 77.7962 bits (190), Expect = 3.676e-14
Identity = 53/154 (34.42%), Postives = 80/154 (51.95%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII---KAKVDA 2072
            AA+   +D+ +  L     VD     Y T L  AAH G++ +   L++  AD N++    +TPLH A     I +VELL+   A ++A   +G TPL  A      N+V +LL++GA   +E  +G TPL LA     + V+ ++    AKVDA
Sbjct:  333 AAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDA 486          

HSP 5 Score: 70.4774 bits (171), Expect = 5.658e-12
Identity = 71/295 (24.07%), Postives = 122/295 (41.36%), Query Frame = 3
Query:  189 LQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDG---------------------------KENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNG 989
            L+     D +++ +L+  G +  IN +   NG   L +A+ E   + ++ L+   A  D    +G +A+ IA+  G       L + GA++ +  +NG   LY      E H+E ++  L++  +    ++DG T L  A + G                           K++     +LL++  +P++  K +G TPL  A   G  ++    L+ G + N   RH  + +H A K G       L + GA  D        P+H AA +GH      L  +G     K  NG
Sbjct:   38 LRAARAGDLEKVLELLRAGTD--INTSNA-NGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ--ENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSK-SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNG 326          

HSP 6 Score: 65.4698 bits (158), Expect = 1.706e-10
Identity = 71/284 (25.00%), Postives = 119/284 (41.90%), Query Frame = 3
Query:  168 ILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINY-----NEPD----NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNG 989
            +L+ R  ++ T E     +      G  +++ Y       PD     G+T L +A   N  D ++ L+  GA  D    E ++ + IA++ G+      L +AGA+      +  + L+  ++  E  +E     L +N D   ++K G T L  A + G  N E+  +LL+ G  P  I+     TPL  A    +  +    L+ G     A ++G T +H AAK    +    L  F A  +        P+H +A  GH      L + G +   K +NG
Sbjct:  411 LLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLH--IAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYG--NLEVVRLLLERGT-PVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNG 689          

HSP 7 Score: 64.3142 bits (155), Expect = 4.444e-10
Identity = 60/259 (23.17%), Postives = 107/259 (41.31%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIK 1052
            NG T L IA  +N +  ++ LL   A  +     G + + +AA  G +     L + GA+  +  + G+  L+      +   + +   +R    ++  +++ +T L  A   G  N +I ++LL+ GA+ N   +    +PL  A   G   +    L    D     + G T +H A+K GN + +  L   G   D+    Q  P+H AA   +      L + G + K    NG     IA  K   +    +++
Sbjct:  391 NGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQ--TDVVRVLIRNGAKVDAQARELQTPLHIASRLG--NTDIVILLLQAGANSNATTR-DNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 8 Score: 62.003 bits (149), Expect = 2.480e-9
Identity = 52/192 (27.08%), Postives = 83/192 (43.23%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALR 854
            NG T L IA  +N ++    LL   A P+     G + + ++AQ GH      L + G+D+     NG   ++ C    E H    +       ++N+ +  G T L  AC  G+ N  +   L+++GAD     +A+  TPL  A   G  +     L+ G  PN     G+T +  A + G    +  LR
Sbjct:  622 NGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQ--EDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLN--MVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 9 Score: 53.1434 bits (126), Expect = 1.011e-6
Identity = 36/118 (30.51%), Postives = 60/118 (50.85%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAK 1973
            A+K G  + ++  +K+  +VD   R   TAL  A+  G   +   L+  GA+VN +    +TPL+ AA     ++V+ L+ +GA       +G TPL  A++     VV  LL+  +K
Sbjct:   73 ASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK 190          

HSP 10 Score: 52.7582 bits (125), Expect = 1.638e-6
Identity = 64/255 (25.10%), Postives = 105/255 (41.18%), Query Frame = 3
Query:  288 TCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGA---DLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKAT--GKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDC 1034
            T L  A        +  L+  GA        G + + +AAQ  HV +  +L    A   D+ ++ L   +V  +C      H    +  L  + D N+ + +G T L  AC+  K   ++  +LLK+ A    I+  T  G TPL  A   G+ +I    L+ G +P+     G+T +H AA++     +  L   GA+ D        P+H A+  G+      L Q G N      +      IA  +G ++ 
Sbjct:  295 TPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHC-----GHVRVAKLLLDRSADPNSRALNGFTPLHIACK--KNRIKVVELLLKYRA---AIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEV 539          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 111.309 bits (277), Expect = 1.668e-24
Identity = 154/639 (24.10%), Postives = 252/639 (39.44%), Query Frame = 3
Query:  291 CLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADL---------------KLNDLNGKNVLY-----------------YCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEI----CVMP---ESH------IMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRT----FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIK 2057
             L IA  ++D      LL    +PDV    G + + IAA YGH    + L + GA++               K    N  N+L                  +C + +  H + ++  +     ++  +K+G   L  A +   ++ +    LL H A  + +      TPL  A   G   +    L    DPN+   +G T +H A K    K +  L  + A  +   ++   P+H AA  G  +   +L Q+G NP V+   GE    +A      D ++ +I   R+  K+          L+  +    T+IV  L L    NS    +  +  L I  K    EE+   +L   D N D T      L  KK    L+L S +                +   P++I     V P    +H       M  ++ G       K  Y T L+  + +N    EI      +  DP+      F  ++ +A+ G  +   L ++ G  V  +     TA+   A   ++ +   L N GA++N+K N  +TPLH A H G +++V+ L+ NGA V  K     TPL +A +    N V +LL+ GA    + + G TPL +A       V+  ++
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARS-GHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQG--DHVDAARTLLYHRAPVDDV-TVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI---RNGAKVDAQARELQTPLHIASRLGNTDIVI-LLLQAGANSNATTRDNYSPLHIAAKEG-QEEVAGILL---DHNADKT------LLTKKGFTPLHLASKY------GNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGY-TPLHIAAKKN--QMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 2 Score: 82.0333 bits (201), Expect = 1.574e-15
Identity = 48/145 (33.10%), Postives = 79/145 (54.48%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA+ GDL+ +   L+ G  ++T +     +L  A+  G+ ++   LI   A V+A      T LH A+ +G   IV +L+ NGA V+ +++NG TPL+ A + +   VV++LLK GA   +    G TPL +A      RV+ ++
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL 184          

HSP 3 Score: 79.7221 bits (195), Expect = 8.888e-15
Identity = 55/191 (28.80%), Postives = 89/191 (46.60%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGN---------------------------------LDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVD 2069
            + F  ++ A+K+G+L+ ++L L++G  VD   +   T L  AAHY N                                 +++   L+ + AD NAK    +TPLH +A  G  +I  LLI NG+ V AKA NG T +    +     V + L   GA+I  + + G TPL +A ++     +N++K  V+
Sbjct:  556 KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQ---LNMVKFLVE 743          

HSP 4 Score: 77.411 bits (189), Expect = 4.024e-14
Identity = 53/154 (34.42%), Postives = 80/154 (51.95%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII---KAKVDA 2072
            AA+   +D+ +  L     VD     Y T L  AAH G++ +   L++  AD N++    +TPLH A     I +VELL+   A ++A   +G TPL  A      N+V +LL++GA   +E  +G TPL LA     + V+ ++    AKVDA
Sbjct:  333 AAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDA 486          

HSP 5 Score: 70.0922 bits (170), Expect = 6.518e-12
Identity = 71/295 (24.07%), Postives = 122/295 (41.36%), Query Frame = 3
Query:  189 LQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDG---------------------------KENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNG 989
            L+     D +++ +L+  G +  IN +   NG   L +A+ E   + ++ L+   A  D    +G +A+ IA+  G       L + GA++ +  +NG   LY      E H+E ++  L++  +    ++DG T L  A + G                           K++     +LL++  +P++  K +G TPL  A   G  ++    L+ G + N   RH  + +H A K G       L + GA  D        P+H AA +GH      L  +G     K  NG
Sbjct:   38 LRAARAGDLEKVLELLRAGTD--INTSNA-NGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ--ENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSK-SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNG 326          

HSP 6 Score: 65.4698 bits (158), Expect = 1.900e-10
Identity = 71/284 (25.00%), Postives = 119/284 (41.90%), Query Frame = 3
Query:  168 ILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINY-----NEPD----NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNG 989
            +L+ R  ++ T E     +      G  +++ Y       PD     G+T L +A   N  D ++ L+  GA  D    E ++ + IA++ G+      L +AGA+      +  + L+  ++  E  +E     L +N D   ++K G T L  A + G  N E+  +LL+ G  P  I+     TPL  A    +  +    L+ G     A ++G T +H AAK    +    L  F A  +        P+H +A  GH      L + G +   K +NG
Sbjct:  411 LLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLH--IAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYG--NLEVVRLLLERGT-PVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNG 689          

HSP 7 Score: 63.929 bits (154), Expect = 5.252e-10
Identity = 60/259 (23.17%), Postives = 107/259 (41.31%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIK 1052
            NG T L IA  +N +  ++ LL   A  +     G + + +AA  G +     L + GA+  +  + G+  L+      +   + +   +R    ++  +++ +T L  A   G  N +I ++LL+ GA+ N   +    +PL  A   G   +    L    D     + G T +H A+K GN + +  L   G   D+    Q  P+H AA   +      L + G + K    NG     IA  K   +    +++
Sbjct:  391 NGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQ--TDVVRVLIRNGAKVDAQARELQTPLHIASRLG--NTDIVILLLQAGANSNATTR-DNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 8 Score: 61.6178 bits (148), Expect = 2.906e-9
Identity = 52/192 (27.08%), Postives = 83/192 (43.23%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALR 854
            NG T L IA  +N ++    LL   A P+     G + + ++AQ GH      L + G+D+     NG   ++ C    E H    +       ++N+ +  G T L  AC  G+ N  +   L+++GAD     +A+  TPL  A   G  +     L+ G  PN     G+T +  A + G    +  LR
Sbjct:  622 NGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQ--EDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLN--MVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 9 Score: 53.1434 bits (126), Expect = 1.089e-6
Identity = 36/118 (30.51%), Postives = 60/118 (50.85%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAK 1973
            A+K G  + ++  +K+  +VD   R   TAL  A+  G   +   L+  GA+VN +    +TPL+ AA     ++V+ L+ +GA       +G TPL  A++     VV  LL+  +K
Sbjct:   73 ASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK 190          

HSP 10 Score: 52.373 bits (124), Expect = 1.856e-6
Identity = 64/255 (25.10%), Postives = 105/255 (41.18%), Query Frame = 3
Query:  288 TCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGA---DLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKAT--GKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDC 1034
            T L  A        +  L+  GA        G + + +AAQ  HV +  +L    A   D+ ++ L   +V  +C      H    +  L  + D N+ + +G T L  AC+  K   ++  +LLK+ A    I+  T  G TPL  A   G+ +I    L+ G +P+     G+T +H AA++     +  L   GA+ D        P+H A+  G+      L Q G N      +      IA  +G ++ 
Sbjct:  295 TPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHC-----GHVRVAKLLLDRSADPNSRALNGFTPLHIACK--KNRIKVVELLLKYRA---AIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEV 539          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089172)

HSP 1 Score: 110.538 bits (275), Expect = 3.191e-24
Identity = 152/609 (24.96%), Postives = 238/609 (39.08%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAA-CASGSTSIPSKCLKLGVDPNT--ADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPP-------------VMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            NG   L +A  +  +D    LL  G   D    +G +A+ IA+  G       L    A++ +  LNG   LY  ++  E H  C  T L    + +  ++DG T L  A + G  +++I  +LL++           GK  L A   A+    + +  L L  DPN     + G T +H AA  GN      L    A  +        P+H A   G  S C  L  RG        +G      A   G      EVIK       L + N P            +T+    L  L +   G     E   LL+  KAP++E     +         G    A  L   K       ++ F       KK            +E+ +   ++I    + G               V+Y+ + + S DL     E P H                       AA+    D I++ L+   KVD   R  +T L  A+  GN+++ M L+ +GA++NA+ N  ++ LH AA  G  +IV++L+ NGA  +A    G TPL  A +  + NVV+ LL+ GA I  +    +TPL +A ++ +  ++ ++
Sbjct:   72 NGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLY--MAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQG--HDKIVAVLLEN--------DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSG----HVEVIK------HLLQQNAPI-----------LTKTKNGLSALHMAAQG--EHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKM-------VELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLH----------------------LAARANQADIIRILLRSA-KVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELL 615          

HSP 2 Score: 82.8037 bits (203), Expect = 1.168e-15
Identity = 63/214 (29.44%), Postives = 105/214 (49.07%), Query Frame = 3
Query:  282 GKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG 923
            G+T L +A   N  D I+ LL   A  D +  EG++ + +A++ G++     L + GA++     +  + L+  ++  E  +  ++  L    + N V+K G T L  AC+ GK+N  +  ILL++GA  +  Q     TPL  A    + SI    LK G  PN   R+G+ A+H A K    +  + L   GA  ++   +  +P+H AA G
Sbjct:  465 GETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALH--IAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQN--VVQILLQNGASIDF-QGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQG 672          

HSP 3 Score: 78.1814 bits (191), Expect = 3.234e-14
Identity = 52/178 (29.21%), Postives = 81/178 (45.51%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGN---------------------------------LDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWA 2030
            + F  ++ A K+G  + +++ L+ G  +D + +   T L  A HY N                                 L++ M L+ +GADVN      ++PLH AA  G +D+V+LL+  G V+ A A NG TPL  A +     V + LL+ GA I      G TPL +A ++ 
Sbjct:  562 KGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYG-VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYG 738          

HSP 4 Score: 75.8702 bits (185), Expect = 1.466e-13
Identity = 57/154 (37.01%), Postives = 80/154 (51.95%), Query Frame = 3
Query: 1623 AKHGDLD-SIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII--KAKVDAL 2075
            A  G+ D +  L L     VD     Y TAL  AAH G++ +   L++Y A+ NA+    +TPLH A     I +VELLI +GA + A   +G TPL  A      N+V +LL+  A   +   +G TPL LA     + +I I+   AKVDA+
Sbjct:  340 AAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAI 493          

HSP 5 Score: 74.7146 bits (182), Expect = 3.667e-13
Identity = 86/340 (25.29%), Postives = 140/340 (41.18%), Query Frame = 3
Query:  246 VEHLINYNEPDNGK-TCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKN-VLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKA-------------------------------TGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMT-EIVEELKL 1160
            ++H    N   N K + L IA  E   + ++ LL+ GA  + V  +G + + +A +YG     + L + GA +   D  GKN V    V+    +   +E  L+     N  +++G+  +  AC+  K   EI + LL+HGAD NII K+                                G TPL  A   G   +    L+ G + +   R+G T +H AA  G+   +       A  ++  +    P+H AA  GH      L +   NP     +G  A  IA + G    M E +K+  S   +  N     +G  +  ++ MT E+++E  L
Sbjct:  517 LQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASI---DFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACK--KNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVM-ESLKIVTSTSVINSN-----IGAIEEKLKVMTPELMQETLL 845          

HSP 6 Score: 67.781 bits (164), Expect = 4.661e-11
Identity = 44/152 (28.95%), Postives = 78/152 (51.32%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIK 2057
            F  ++ AA+ G++D ++L L+ G  +    +   T L  AA  G++ +   L+ +GA+++ +    +TPLH AAH G +D+V+  I N A ++  +  G TPL +A +     ++  LL+  A        G T L +A N     V+  +K
Sbjct:  663 FSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLK 813          

HSP 7 Score: 65.855 bits (159), Expect = 1.889e-10
Identity = 50/144 (34.72%), Postives = 72/144 (50.00%), Query Frame = 3
Query: 1680 DTRDRFYKTALMSAAHYGNLDMCMHLINY--GADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRG 2105
            D R +    AL  AA   +++    L+ +   AD+ +K  F  TPLH AAH G +DI  LL+NN A V+  A +  TPL  A +  + ++   LL +GAKI      GLTPL  A   + S  + +IK  +    P+  K   G
Sbjct:  195 DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGF--TPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCA---SRSGHVEVIKHLLQQNAPILTKTKNG 333          

HSP 8 Score: 63.1586 bits (152), Expect = 1.112e-9
Identity = 69/232 (29.74%), Postives = 105/232 (45.26%), Query Frame = 3
Query:  246 VEHLINYN-----EPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVL-YYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG 923
            +  LI YN     +  NG T L +A  EN  +  + LL  GA+P +   +G + + +A Q GH        K  A L  ND+ GK  L    ++  +      +  L+++ + + VSK G T L  A   G  N +I  +LL + AD N + K    TPL  AC  G  S+ +  L  G   + A R G T +H A++SG+ + +  L    A          + +H AA G
Sbjct:  122 INQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGH-------DKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYG--NVDIATLLLNNKADVNYVAKHN-ITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQG 343          

HSP 9 Score: 60.4622 bits (145), Expect = 7.487e-9
Identity = 42/147 (28.57%), Postives = 71/147 (48.30%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKG--YKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA+ GD+  +   L  G    +++ +     AL  AA  G +D+C  L+  G  ++       T LH A+ +G  D++  LI   A V+ ++LNG TPL+ A + +  N    LL  GA   +    G TPL +A      +++ ++
Sbjct:   45 AARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVL 191          

HSP 10 Score: 60.077 bits (144), Expect = 1.078e-8
Identity = 40/145 (27.59%), Postives = 71/145 (48.97%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AAK G  + +++ L+ G + +   +   T L  A  YG  ++   L+  GA ++ +     TPLH A H     IVELL+ NG+  +  A NG   +  A + +   +   LL+ GA + + +  G +PL LA    +  ++ ++
Sbjct:  537 AAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 11 Score: 53.5286 bits (127), Expect = 1.110e-6
Identity = 59/231 (25.54%), Postives = 93/231 (40.26%), Query Frame = 3
Query:  258 INYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFL 947
            +NY    N  T L +A     L     LL  GA  D    +G + +  A++ GHV   + L +  A +     NG + L+  ++    H E     L     ++ V+ D  T L  A   G  + ++  +LL + A+PN  +   G TPL  AC      +    +K G +       G T +H A+  G    ++ L    A  D+       P+H AA A  A   + L
Sbjct:  260 VNYVAKHN-ITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALH--MAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCG--HVKVAKLLLDYKANPNA-RALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRIL 484          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0300497)

HSP 1 Score: 110.538 bits (275), Expect = 3.191e-24
Identity = 152/609 (24.96%), Postives = 238/609 (39.08%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAA-CASGSTSIPSKCLKLGVDPNT--ADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPP-------------VMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            NG   L +A  +  +D    LL  G   D    +G +A+ IA+  G       L    A++ +  LNG   LY  ++  E H  C  T L    + +  ++DG T L  A + G  +++I  +LL++           GK  L A   A+    + +  L L  DPN     + G T +H AA  GN      L    A  +        P+H A   G  S C  L  RG        +G      A   G      EVIK       L + N P            +T+    L  L +   G     E   LL+  KAP++E     +         G    A  L   K       ++ F       KK            +E+ +   ++I    + G               V+Y+ + + S DL     E P H                       AA+    D I++ L+   KVD   R  +T L  A+  GN+++ M L+ +GA++NA+ N  ++ LH AA  G  +IV++L+ NGA  +A    G TPL  A +  + NVV+ LL+ GA I  +    +TPL +A ++ +  ++ ++
Sbjct:   72 NGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLY--MAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQG--HDKIVAVLLEN--------DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSG----HVEVIK------HLLQQNAPI-----------LTKTKNGLSALHMAAQG--EHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKM-------VELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLH----------------------LAARANQADIIRILLRSA-KVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELL 615          

HSP 2 Score: 82.8037 bits (203), Expect = 1.168e-15
Identity = 63/214 (29.44%), Postives = 105/214 (49.07%), Query Frame = 3
Query:  282 GKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG 923
            G+T L +A   N  D I+ LL   A  D +  EG++ + +A++ G++     L + GA++     +  + L+  ++  E  +  ++  L    + N V+K G T L  AC+ GK+N  +  ILL++GA  +  Q     TPL  A    + SI    LK G  PN   R+G+ A+H A K    +  + L   GA  ++   +  +P+H AA G
Sbjct:  465 GETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALH--IAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQN--VVQILLQNGASIDF-QGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQG 672          

HSP 3 Score: 78.1814 bits (191), Expect = 3.234e-14
Identity = 52/178 (29.21%), Postives = 81/178 (45.51%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGN---------------------------------LDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWA 2030
            + F  ++ A K+G  + +++ L+ G  +D + +   T L  A HY N                                 L++ M L+ +GADVN      ++PLH AA  G +D+V+LL+  G V+ A A NG TPL  A +     V + LL+ GA I      G TPL +A ++ 
Sbjct:  562 KGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYG-VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYG 738          

HSP 4 Score: 75.8702 bits (185), Expect = 1.466e-13
Identity = 57/154 (37.01%), Postives = 80/154 (51.95%), Query Frame = 3
Query: 1623 AKHGDLD-SIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII--KAKVDAL 2075
            A  G+ D +  L L     VD     Y TAL  AAH G++ +   L++Y A+ NA+    +TPLH A     I +VELLI +GA + A   +G TPL  A      N+V +LL+  A   +   +G TPL LA     + +I I+   AKVDA+
Sbjct:  340 AAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAI 493          

HSP 5 Score: 74.7146 bits (182), Expect = 3.667e-13
Identity = 86/340 (25.29%), Postives = 140/340 (41.18%), Query Frame = 3
Query:  246 VEHLINYNEPDNGK-TCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKN-VLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKA-------------------------------TGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMT-EIVEELKL 1160
            ++H    N   N K + L IA  E   + ++ LL+ GA  + V  +G + + +A +YG     + L + GA +   D  GKN V    V+    +   +E  L+     N  +++G+  +  AC+  K   EI + LL+HGAD NII K+                                G TPL  A   G   +    L+ G + +   R+G T +H AA  G+   +       A  ++  +    P+H AA  GH      L +   NP     +G  A  IA + G    M E +K+  S   +  N     +G  +  ++ MT E+++E  L
Sbjct:  517 LQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASI---DFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACK--KNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVM-ESLKIVTSTSVINSN-----IGAIEEKLKVMTPELMQETLL 845          

HSP 6 Score: 67.781 bits (164), Expect = 4.661e-11
Identity = 44/152 (28.95%), Postives = 78/152 (51.32%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIK 2057
            F  ++ AA+ G++D ++L L+ G  +    +   T L  AA  G++ +   L+ +GA+++ +    +TPLH AAH G +D+V+  I N A ++  +  G TPL +A +     ++  LL+  A        G T L +A N     V+  +K
Sbjct:  663 FSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLK 813          

HSP 7 Score: 65.855 bits (159), Expect = 1.889e-10
Identity = 50/144 (34.72%), Postives = 72/144 (50.00%), Query Frame = 3
Query: 1680 DTRDRFYKTALMSAAHYGNLDMCMHLINY--GADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRG 2105
            D R +    AL  AA   +++    L+ +   AD+ +K  F  TPLH AAH G +DI  LL+NN A V+  A +  TPL  A +  + ++   LL +GAKI      GLTPL  A   + S  + +IK  +    P+  K   G
Sbjct:  195 DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGF--TPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCA---SRSGHVEVIKHLLQQNAPILTKTKNG 333          

HSP 8 Score: 63.1586 bits (152), Expect = 1.112e-9
Identity = 69/232 (29.74%), Postives = 105/232 (45.26%), Query Frame = 3
Query:  246 VEHLINYN-----EPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVL-YYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG 923
            +  LI YN     +  NG T L +A  EN  +  + LL  GA+P +   +G + + +A Q GH        K  A L  ND+ GK  L    ++  +      +  L+++ + + VSK G T L  A   G  N +I  +LL + AD N + K    TPL  AC  G  S+ +  L  G   + A R G T +H A++SG+ + +  L    A          + +H AA G
Sbjct:  122 INQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGH-------DKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYG--NVDIATLLLNNKADVNYVAKHN-ITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQG 343          

HSP 9 Score: 60.4622 bits (145), Expect = 7.487e-9
Identity = 42/147 (28.57%), Postives = 71/147 (48.30%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKG--YKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA+ GD+  +   L  G    +++ +     AL  AA  G +D+C  L+  G  ++       T LH A+ +G  D++  LI   A V+ ++LNG TPL+ A + +  N    LL  GA   +    G TPL +A      +++ ++
Sbjct:   45 AARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVL 191          

HSP 10 Score: 60.077 bits (144), Expect = 1.078e-8
Identity = 40/145 (27.59%), Postives = 71/145 (48.97%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AAK G  + +++ L+ G + +   +   T L  A  YG  ++   L+  GA ++ +     TPLH A H     IVELL+ NG+  +  A NG   +  A + +   +   LL+ GA + + +  G +PL LA    +  ++ ++
Sbjct:  537 AAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 11 Score: 53.5286 bits (127), Expect = 1.110e-6
Identity = 59/231 (25.54%), Postives = 93/231 (40.26%), Query Frame = 3
Query:  258 INYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFL 947
            +NY    N  T L +A     L     LL  GA  D    +G + +  A++ GHV   + L +  A +     NG + L+  ++    H E     L     ++ V+ D  T L  A   G  + ++  +LL + A+PN  +   G TPL  AC      +    +K G +       G T +H A+  G    ++ L    A  D+       P+H AA A  A   + L
Sbjct:  260 VNYVAKHN-ITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALH--MAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCG--HVKVAKLLLDYKANPNA-RALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRIL 484          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089171)

HSP 1 Score: 110.538 bits (275), Expect = 3.191e-24
Identity = 152/609 (24.96%), Postives = 238/609 (39.08%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAA-CASGSTSIPSKCLKLGVDPNT--ADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPP-------------VMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            NG   L +A  +  +D    LL  G   D    +G +A+ IA+  G       L    A++ +  LNG   LY  ++  E H  C  T L    + +  ++DG T L  A + G  +++I  +LL++           GK  L A   A+    + +  L L  DPN     + G T +H AA  GN      L    A  +        P+H A   G  S C  L  RG        +G      A   G      EVIK       L + N P            +T+    L  L +   G     E   LL+  KAP++E     +         G    A  L   K       ++ F       KK            +E+ +   ++I    + G               V+Y+ + + S DL     E P H                       AA+    D I++ L+   KVD   R  +T L  A+  GN+++ M L+ +GA++NA+ N  ++ LH AA  G  +IV++L+ NGA  +A    G TPL  A +  + NVV+ LL+ GA I  +    +TPL +A ++ +  ++ ++
Sbjct:   72 NGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLY--MAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQG--HDKIVAVLLEN--------DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSG----HVEVIK------HLLQQNAPI-----------LTKTKNGLSALHMAAQG--EHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKM-------VELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLH----------------------LAARANQADIIRILLRSA-KVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELL 615          

HSP 2 Score: 82.8037 bits (203), Expect = 1.168e-15
Identity = 63/214 (29.44%), Postives = 105/214 (49.07%), Query Frame = 3
Query:  282 GKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG 923
            G+T L +A   N  D I+ LL   A  D +  EG++ + +A++ G++     L + GA++     +  + L+  ++  E  +  ++  L    + N V+K G T L  AC+ GK+N  +  ILL++GA  +  Q     TPL  A    + SI    LK G  PN   R+G+ A+H A K    +  + L   GA  ++   +  +P+H AA G
Sbjct:  465 GETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALH--IAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQN--VVQILLQNGASIDF-QGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQG 672          

HSP 3 Score: 78.1814 bits (191), Expect = 3.234e-14
Identity = 52/178 (29.21%), Postives = 81/178 (45.51%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGN---------------------------------LDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWA 2030
            + F  ++ A K+G  + +++ L+ G  +D + +   T L  A HY N                                 L++ M L+ +GADVN      ++PLH AA  G +D+V+LL+  G V+ A A NG TPL  A +     V + LL+ GA I      G TPL +A ++ 
Sbjct:  562 KGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYG-VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYG 738          

HSP 4 Score: 75.8702 bits (185), Expect = 1.466e-13
Identity = 57/154 (37.01%), Postives = 80/154 (51.95%), Query Frame = 3
Query: 1623 AKHGDLD-SIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII--KAKVDAL 2075
            A  G+ D +  L L     VD     Y TAL  AAH G++ +   L++Y A+ NA+    +TPLH A     I +VELLI +GA + A   +G TPL  A      N+V +LL+  A   +   +G TPL LA     + +I I+   AKVDA+
Sbjct:  340 AAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAI 493          

HSP 5 Score: 74.7146 bits (182), Expect = 3.667e-13
Identity = 86/340 (25.29%), Postives = 140/340 (41.18%), Query Frame = 3
Query:  246 VEHLINYNEPDNGK-TCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKN-VLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKA-------------------------------TGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMT-EIVEELKL 1160
            ++H    N   N K + L IA  E   + ++ LL+ GA  + V  +G + + +A +YG     + L + GA +   D  GKN V    V+    +   +E  L+     N  +++G+  +  AC+  K   EI + LL+HGAD NII K+                                G TPL  A   G   +    L+ G + +   R+G T +H AA  G+   +       A  ++  +    P+H AA  GH      L +   NP     +G  A  IA + G    M E +K+  S   +  N     +G  +  ++ MT E+++E  L
Sbjct:  517 LQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASI---DFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACK--KNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVM-ESLKIVTSTSVINSN-----IGAIEEKLKVMTPELMQETLL 845          

HSP 6 Score: 67.781 bits (164), Expect = 4.661e-11
Identity = 44/152 (28.95%), Postives = 78/152 (51.32%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIK 2057
            F  ++ AA+ G++D ++L L+ G  +    +   T L  AA  G++ +   L+ +GA+++ +    +TPLH AAH G +D+V+  I N A ++  +  G TPL +A +     ++  LL+  A        G T L +A N     V+  +K
Sbjct:  663 FSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLK 813          

HSP 7 Score: 65.855 bits (159), Expect = 1.889e-10
Identity = 50/144 (34.72%), Postives = 72/144 (50.00%), Query Frame = 3
Query: 1680 DTRDRFYKTALMSAAHYGNLDMCMHLINY--GADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRG 2105
            D R +    AL  AA   +++    L+ +   AD+ +K  F  TPLH AAH G +DI  LL+NN A V+  A +  TPL  A +  + ++   LL +GAKI      GLTPL  A   + S  + +IK  +    P+  K   G
Sbjct:  195 DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGF--TPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCA---SRSGHVEVIKHLLQQNAPILTKTKNG 333          

HSP 8 Score: 63.1586 bits (152), Expect = 1.112e-9
Identity = 69/232 (29.74%), Postives = 105/232 (45.26%), Query Frame = 3
Query:  246 VEHLINYN-----EPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVL-YYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG 923
            +  LI YN     +  NG T L +A  EN  +  + LL  GA+P +   +G + + +A Q GH        K  A L  ND+ GK  L    ++  +      +  L+++ + + VSK G T L  A   G  N +I  +LL + AD N + K    TPL  AC  G  S+ +  L  G   + A R G T +H A++SG+ + +  L    A          + +H AA G
Sbjct:  122 INQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGH-------DKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYG--NVDIATLLLNNKADVNYVAKHN-ITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQG 343          

HSP 9 Score: 60.4622 bits (145), Expect = 7.487e-9
Identity = 42/147 (28.57%), Postives = 71/147 (48.30%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKG--YKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA+ GD+  +   L  G    +++ +     AL  AA  G +D+C  L+  G  ++       T LH A+ +G  D++  LI   A V+ ++LNG TPL+ A + +  N    LL  GA   +    G TPL +A      +++ ++
Sbjct:   45 AARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVL 191          

HSP 10 Score: 60.077 bits (144), Expect = 1.078e-8
Identity = 40/145 (27.59%), Postives = 71/145 (48.97%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AAK G  + +++ L+ G + +   +   T L  A  YG  ++   L+  GA ++ +     TPLH A H     IVELL+ NG+  +  A NG   +  A + +   +   LL+ GA + + +  G +PL LA    +  ++ ++
Sbjct:  537 AAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 11 Score: 53.5286 bits (127), Expect = 1.110e-6
Identity = 59/231 (25.54%), Postives = 93/231 (40.26%), Query Frame = 3
Query:  258 INYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFL 947
            +NY    N  T L +A     L     LL  GA  D    +G + +  A++ GHV   + L +  A +     NG + L+  ++    H E     L     ++ V+ D  T L  A   G  + ++  +LL + A+PN  +   G TPL  AC      +    +K G +       G T +H A+  G    ++ L    A  D+       P+H AA A  A   + L
Sbjct:  260 VNYVAKHN-ITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALH--MAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCG--HVKVAKLLLDYKANPNA-RALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRIL 484          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089173)

HSP 1 Score: 110.538 bits (275), Expect = 3.191e-24
Identity = 152/609 (24.96%), Postives = 238/609 (39.08%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAA-CASGSTSIPSKCLKLGVDPNT--ADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPP-------------VMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            NG   L +A  +  +D    LL  G   D    +G +A+ IA+  G       L    A++ +  LNG   LY  ++  E H  C  T L    + +  ++DG T L  A + G  +++I  +LL++           GK  L A   A+    + +  L L  DPN     + G T +H AA  GN      L    A  +        P+H A   G  S C  L  RG        +G      A   G      EVIK       L + N P            +T+    L  L +   G     E   LL+  KAP++E     +         G    A  L   K       ++ F       KK            +E+ +   ++I    + G               V+Y+ + + S DL     E P H                       AA+    D I++ L+   KVD   R  +T L  A+  GN+++ M L+ +GA++NA+ N  ++ LH AA  G  +IV++L+ NGA  +A    G TPL  A +  + NVV+ LL+ GA I  +    +TPL +A ++ +  ++ ++
Sbjct:   72 NGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLY--MAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQG--HDKIVAVLLEN--------DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSG----HVEVIK------HLLQQNAPI-----------LTKTKNGLSALHMAAQG--EHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKM-------VELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLH----------------------LAARANQADIIRILLRSA-KVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELL 615          

HSP 2 Score: 82.8037 bits (203), Expect = 1.168e-15
Identity = 63/214 (29.44%), Postives = 105/214 (49.07%), Query Frame = 3
Query:  282 GKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG 923
            G+T L +A   N  D I+ LL   A  D +  EG++ + +A++ G++     L + GA++     +  + L+  ++  E  +  ++  L    + N V+K G T L  AC+ GK+N  +  ILL++GA  +  Q     TPL  A    + SI    LK G  PN   R+G+ A+H A K    +  + L   GA  ++   +  +P+H AA G
Sbjct:  465 GETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALH--IAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQN--VVQILLQNGASIDF-QGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQG 672          

HSP 3 Score: 78.1814 bits (191), Expect = 3.234e-14
Identity = 52/178 (29.21%), Postives = 81/178 (45.51%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGN---------------------------------LDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWA 2030
            + F  ++ A K+G  + +++ L+ G  +D + +   T L  A HY N                                 L++ M L+ +GADVN      ++PLH AA  G +D+V+LL+  G V+ A A NG TPL  A +     V + LL+ GA I      G TPL +A ++ 
Sbjct:  562 KGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYG-VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYG 738          

HSP 4 Score: 75.8702 bits (185), Expect = 1.466e-13
Identity = 57/154 (37.01%), Postives = 80/154 (51.95%), Query Frame = 3
Query: 1623 AKHGDLD-SIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII--KAKVDAL 2075
            A  G+ D +  L L     VD     Y TAL  AAH G++ +   L++Y A+ NA+    +TPLH A     I +VELLI +GA + A   +G TPL  A      N+V +LL+  A   +   +G TPL LA     + +I I+   AKVDA+
Sbjct:  340 AAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAI 493          

HSP 5 Score: 74.7146 bits (182), Expect = 3.667e-13
Identity = 86/340 (25.29%), Postives = 140/340 (41.18%), Query Frame = 3
Query:  246 VEHLINYNEPDNGK-TCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKN-VLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKA-------------------------------TGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMT-EIVEELKL 1160
            ++H    N   N K + L IA  E   + ++ LL+ GA  + V  +G + + +A +YG     + L + GA +   D  GKN V    V+    +   +E  L+     N  +++G+  +  AC+  K   EI + LL+HGAD NII K+                                G TPL  A   G   +    L+ G + +   R+G T +H AA  G+   +       A  ++  +    P+H AA  GH      L +   NP     +G  A  IA + G    M E +K+  S   +  N     +G  +  ++ MT E+++E  L
Sbjct:  517 LQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASI---DFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACK--KNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVM-ESLKIVTSTSVINSN-----IGAIEEKLKVMTPELMQETLL 845          

HSP 6 Score: 67.781 bits (164), Expect = 4.661e-11
Identity = 44/152 (28.95%), Postives = 78/152 (51.32%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIK 2057
            F  ++ AA+ G++D ++L L+ G  +    +   T L  AA  G++ +   L+ +GA+++ +    +TPLH AAH G +D+V+  I N A ++  +  G TPL +A +     ++  LL+  A        G T L +A N     V+  +K
Sbjct:  663 FSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLK 813          

HSP 7 Score: 65.855 bits (159), Expect = 1.889e-10
Identity = 50/144 (34.72%), Postives = 72/144 (50.00%), Query Frame = 3
Query: 1680 DTRDRFYKTALMSAAHYGNLDMCMHLINY--GADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRG 2105
            D R +    AL  AA   +++    L+ +   AD+ +K  F  TPLH AAH G +DI  LL+NN A V+  A +  TPL  A +  + ++   LL +GAKI      GLTPL  A   + S  + +IK  +    P+  K   G
Sbjct:  195 DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGF--TPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCA---SRSGHVEVIKHLLQQNAPILTKTKNG 333          

HSP 8 Score: 63.1586 bits (152), Expect = 1.112e-9
Identity = 69/232 (29.74%), Postives = 105/232 (45.26%), Query Frame = 3
Query:  246 VEHLINYN-----EPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVL-YYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG 923
            +  LI YN     +  NG T L +A  EN  +  + LL  GA+P +   +G + + +A Q GH        K  A L  ND+ GK  L    ++  +      +  L+++ + + VSK G T L  A   G  N +I  +LL + AD N + K    TPL  AC  G  S+ +  L  G   + A R G T +H A++SG+ + +  L    A          + +H AA G
Sbjct:  122 INQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGH-------DKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYG--NVDIATLLLNNKADVNYVAKHN-ITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQG 343          

HSP 9 Score: 60.4622 bits (145), Expect = 7.487e-9
Identity = 42/147 (28.57%), Postives = 71/147 (48.30%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKG--YKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA+ GD+  +   L  G    +++ +     AL  AA  G +D+C  L+  G  ++       T LH A+ +G  D++  LI   A V+ ++LNG TPL+ A + +  N    LL  GA   +    G TPL +A      +++ ++
Sbjct:   45 AARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVL 191          

HSP 10 Score: 60.077 bits (144), Expect = 1.078e-8
Identity = 40/145 (27.59%), Postives = 71/145 (48.97%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AAK G  + +++ L+ G + +   +   T L  A  YG  ++   L+  GA ++ +     TPLH A H     IVELL+ NG+  +  A NG   +  A + +   +   LL+ GA + + +  G +PL LA    +  ++ ++
Sbjct:  537 AAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 11 Score: 53.5286 bits (127), Expect = 1.110e-6
Identity = 59/231 (25.54%), Postives = 93/231 (40.26%), Query Frame = 3
Query:  258 INYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFL 947
            +NY    N  T L +A     L     LL  GA  D    +G + +  A++ GHV   + L +  A +     NG + L+  ++    H E     L     ++ V+ D  T L  A   G  + ++  +LL + A+PN  +   G TPL  AC      +    +K G +       G T +H A+  G    ++ L    A  D+       P+H AA A  A   + L
Sbjct:  260 VNYVAKHN-ITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALH--MAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCG--HVKVAKLLLDYKANPNA-RALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRIL 484          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Fly
Match: CG10011 (gene:FBgn0039590 transcript:FBtr0085319)

HSP 1 Score: 106.686 bits (265), Expect = 6.726e-23
Identity = 74/266 (27.82%), Postives = 133/266 (50.00%), Query Frame = 3
Query:  282 GKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSP---TERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSF 1067
            G+T L  A      D +K L++ GA  + VD +G+++++ A+  GH    E L + GA++   DL+G++ L  CV+    +  + + + T L +  + + +  DG + L  +  +G  N E+C +LL++ ADP++     G+TPL AAC +G  ++    L  G   +  D  G+T +   A  GN +++  L   G      D+    P+HYAA  G    C  L + G      ++ G+ A  +A  +G   C++ ++ +  SF
Sbjct: 1350 GRTALRAAAWSGHEDILKLLIESGADVNSVDRQGRTSLIAASYMGHYDIVEILLENGANVNHLDLDGRSAL--CVAALCGSSGYSKVISTLLDHGANTDQLDNDGMSPLLVSSFEG--NAEVCELLLENAADPDLAD-FMGRTPLWAACTAGHATVVKLLLFWGCGIDCMDSEGRTVLSIGAAQGNVETVRQLLDRGLDETHRDNAGWTPLHYAAFEGFHEVCLQLLESGAKIDECDNEGKTALHLAAQEGRLHCVQALLDIHSSF 1610          

HSP 2 Score: 71.633 bits (174), Expect = 3.393e-12
Identity = 81/303 (26.73%), Postives = 132/303 (43.56%), Query Frame = 3
Query:  204 EKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLA---KAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGK--LGKNNEP 1094
            + + + +++L+D G++     N    G T L  A  E   +    LL+ GA  D  D EGK+A+ +AAQ G +   ++L     +  D K +D  GK    + ++  E H + +E  L++  D+N+   D +T L+    + K  E +  +L     D NI   + G+T L  A   G   +    ++ G D N+ D   +T +H  A  GN   +  L  +GA  D         +  +A  GH  C   L Q G NP   +  G     +A    AK     ++K+  S+ K      NEP
Sbjct: 1528 QGNVETVRQLLDRGLDETHRDNA---GWTPLHYAAFEGFHEVCLQLLESGAKIDECDNEGKTALHLAAQEGRLHCVQALLDIHSSFVDQKAHD--GKTA--FRLACLEGHMDTVEFLLKFCCDVNSKDADSRTTLYILALENKL-EIVKYLLDMTNVDVNI-PDSEGRTALHVAAWQGHADMVKTLIEAGADVNSMDLEARTPLHSCAWQGNHDVMNILLYYGALADHACKQGATALGISAQEGHEKCVIALLQFGANPYKSDHCGRTPIKLA----AKSSRTSILKIFESYTKNEASNPNEP 1817          

HSP 3 Score: 65.855 bits (159), Expect = 1.786e-10
Identity = 53/168 (31.55%), Postives = 86/168 (51.19%), Query Frame = 3
Query: 1611 MNDAAKHGDLDSIKLALKK-GYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAI---ESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGR 2102
            +  A+  G  + ++L + +   K+D  D+  +TAL +AA  G+ D+   LI  GADVN+ D    T L  A++ G  DIVE+L+ NGA V+   L+G + L  A     S    V+  LL  GA     ++ G++PL ++    ++ V  ++     A P + D  GR
Sbjct: 1320 LRSASWGGHSEVVRLLIAQPACKIDLADKEGRTALRAAAWSGHEDILKLLIESGADVNSVDRQGRTSLIAASYMGHYDIVEILLENGANVNHLDLDGRSALCVAALCGSSGYSKVISTLLDHGANTDQLDNDGMSPLLVSSFEGNAEVCELLLENA-ADPDLADFMGR 1486          

HSP 4 Score: 65.0846 bits (157), Expect = 3.638e-10
Identity = 44/128 (34.38%), Postives = 64/128 (50.00%), Query Frame = 3
Query: 1677 VDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKA 2060
            V+  D   +TAL  AA  G+ DM   LI  GADVN+ D    TPLH  A  G  D++ +L+  GA+ D     GAT L  + +      V  LL+ GA     +  G TP+ LA   + + ++ I ++
Sbjct: 1678 VNIPDSEGRTALHVAAWQGHADMVKTLIEAGADVNSMDLEARTPLHSCAWQGNHDVMNILLYYGALADHACKQGATALGISAQEGHEKCVIALLQFGANPYKSDHCGRTPIKLAAKSSRTSILKIFES 1805          

HSP 5 Score: 64.6994 bits (156), Expect = 4.346e-10
Identity = 38/113 (33.63%), Postives = 55/113 (48.67%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLL 1958
            A   G    +KL L  G  +D  D   +T L   A  GN++    L++ G D   +DN  WTPLH+AA  G  ++   L+ +GA +D     G T L  A +  R + V+ LL
Sbjct: 1492 ACTAGHATVVKLLLFWGCGIDCMDSEGRTVLSIGAAQGNVETVRQLLDRGLDETHRDNAGWTPLHYAAFEGFHEVCLQLLESGAKIDECDNEGKTALHLAAQEGRLHCVQALL 1604          

HSP 6 Score: 61.2326 bits (147), Expect = 5.191e-9
Identity = 71/282 (25.18%), Postives = 119/282 (42.20%), Query Frame = 3
Query:  228 KLVDNGVEHLINYNEPDN-GKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLG---VDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYD-DTQNNPIHYAAAGHASCCKF-LGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKV 1055
            K++   ++H  N ++ DN G + L +++ E + +  + LL+  A PD+ DF G++ +  A   GH    + L   G  +   D  G+ VL   +   + + E +   L   +D  +    G T L +A  +G    E+CL LL+ GA  +      GKT L  A   G        L +    VD    D  GKTA   A   G+  ++  L  F    +  D D++      A        K+ L     +  + +S G  A  +A  +G  D +K +I+ 
Sbjct: 1433 KVISTLLDHGANTDQLDNDGMSPLLVSSFEGNAEVCELLLENAADPDLADFMGRTPLWAACTAGHATVVKLLLFWGCGIDCMDSEGRTVL--SIGAAQGNVETVRQLLDRGLDETHRDNAGWTPLHYAAFEGF--HEVCLQLLESGAKIDECDNE-GKTALHLAAQEGRLHCVQALLDIHSSFVDQKAHD--GKTAFRLACLEGHMDTVEFLLKFCCDVNSKDADSRTTLYILALENKLEIVKYLLDMTNVDVNIPDSEGRTALHVAAWQGHADMVKTLIEA 1707          

HSP 7 Score: 59.3066 bits (142), Expect = 1.879e-8
Identity = 44/148 (29.73%), Postives = 75/148 (50.68%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAA---HSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA  G  D +KL ++ G  V++ DR  +T+L++A++ G+ D+   L+  GA+VN  D    + L  AA    SG   ++  L+++GA  D    +G +PL  +       V E LL+  A   + +  G TPL  A     + V+ ++
Sbjct: 1357 AAWSGHEDILKLLIESGADVNSVDRQGRTSLIAASYMGHYDIVEILLENGANVNHLDLDGRSALCVAALCGSSGYSKVISTLLDHGANTDQLDNDGMSPLLVSSFEGNAEVCELLLENAADPDLADFMGRTPLWAACTAGHATVVKLL 1504          

HSP 8 Score: 55.4546 bits (132), Expect = 2.840e-7
Identity = 74/331 (22.36%), Postives = 134/331 (40.48%), Query Frame = 3
Query:  312 ENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVA------SFES----------------------------------------LAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAAC---ASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYA-AAGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEEL 1154
            E  L+  K  +DL    ++ D+ G++A+ IAA+ GH+       SF                                          +A+    + L D  G+  L    +    H++ L+  +    D+N+V + G+T L  A   G  + +I  ILL++GA+ N +    G++ L  A    +SG + + S  L  G + +  D  G + +  ++  GN +    L    A  D+ D     P+  A  AGHA+  K L   GC     +S G    +I   +G  + +++++  +R   +  ++N  W   L+    E   E+  +L
Sbjct: 1252 ERALNACKSPIDL----EIEDYNGQTALNIAARNGHLEVVKLLLSFSQPCNDGTGRMKRVDVNHADRDGWTPLRSASWGGHSEVVRLLIAQPACKIDLADKEGRTALR--AAAWSGHEDILKLLIESGADVNSVDRQGRTSLIAASYMG--HYDIVEILLENGANVNHLD-LDGRSALCVAALCGSSGYSKVISTLLDHGANTDQLDNDGMSPLLVSSFEGNAEVCELLLENAADPDLADFMGRTPLWAACTAGHATVVKLLLFWGCGIDCMDSEGRTVLSIGAAQGNVETVRQLL--DRGLDETHRDNAGWT-PLHYAAFEGFHEVCLQL 1570          

HSP 9 Score: 51.6026 bits (122), Expect = 4.514e-6
Identity = 50/184 (27.17%), Postives = 84/184 (45.65%), Query Frame = 3
Query:  378 EGKSAIMIAAQYGHVASFE---SLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYN------------VDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYD 884
            +GK+ I I A  G+    E   +  K+  DL++ D NG+  L   ++    H E ++  L ++            VD+N+  +DG T L  A   G  + E+  +L+   A    +    G+T L AA  SG   I    ++ G D N+ DR G+T++  A+  G++  +  L   GA  +  D
Sbjct: 1234 KGKALIHILANDGNHQLLERALNACKSPIDLEIEDYNGQTALN--IAARNGHLEVVKLLLSFSQPCNDGTGRMKRVDVNHADRDGWTPLRSASWGG--HSEVVRLLIAQPACKIDLADKEGRTALRAAAWSGHEDILKLLIESGADVNSVDRQGRTSLIAASYMGHYDIVEILLENGANVNHLD 1413          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Zebrafish
Match: ankef1a (ankyrin repeat and EF-hand domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-041001-196])

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 320/787 (40.66%), Postives = 451/787 (57.31%), Query Frame = 3
Query:  150 AQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG-HASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKL--GKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGI--VNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKK-----------------GRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKASGLED 2444
            A+ RL++LQI ++LQC  + D   I+KL+  GV+ LIN  EP +G   L +A   N  D ++FL+D GA PDV D  G++ +M+AA+ G+      LAK  AD+KL D+ GK VL+YC+ PT+RH  CL+  L  N D+NNVS+ G  V   ACE  ++ E +CL +L+ GADPN   + TG+T LM A  +G+  +    LK G + N  D+    A H+AA+ G F+ +  L A+ A         + P+H+AA+G +  CC+FL QRGCNPK+KN  G   R IAKD G K  +KE+ K ER  GK   G  N PWAL L+DW+ EN  E+    +       G+  V K  FV +L  L APL++     +L   DK ++G  +  DFL G KY+ K Y+M+++  KKKK  K GK K  K  +P+ IC +P+  I R  DGGPP   I   Q++TD  R+  ++ P   IEDD +WYI +P++ ++N+N   K GD++S++LAL +   VD +DRFYKT LM+A   GN +M   L++ GADVNA D F WTPLHHA H+G +DI++LL+  GA VD  ALNGATPL RAIES R + VE+L+K GAKI   N      LD+A+ +AD RV+++++AK++  P  KD K                 G   +K G   +    + S  K   +       S +++   R N L           DISF PR    N      L+     RRQRF +E+DF D+F+  F+KN+ ++     L D
Sbjct:    6 AKGRLQVLQIYRLLQCIQDGDKTYIEKLISMGVDDLINLTEPRDGNGVLHLAAVTNKPDMLEFLVDQGARPDVQDRSGRTPLMLAAELGYDGIVSLLAKKNADMKLVDIEGKGVLFYCLHPTKRHMRCLQVVLNGNADVNNVSEAGIPVFLLACEQAQDCEGMCLSILERGADPNATNQETGRTALMEAARAGALELVRAILKKGGNVNALDKKRFHAAHFAAEKGFFEIIKVLSAYRADVGGVTTEGDTPLHFAASGGYTDCCRFLAQRGCNPKLKNQEGLLPRQIAKDCGHKATVKELKKAERLHGKSSKGGTNGPWALMLHDWSHENENELRSAFESATDGFIGVEFVPKGTFVSVLKELHAPLDDVQIHILLLALDKRREGFININDFLRGLKYLPKTYVMASYGPKKKKAAKAGKTKKSKFNLPLPICTVPQDLIHRRDDGGPPHFMIESWQHATDTQRYDRDHRPERPIEDDTAWYIDEPEKIYINLNYCVKTGDIESLRLALSQKVPVDVKDRFYKTPLMAACASGNYEMAKFLLDNGADVNACDQFKWTPLHHACHAGQLDIIQLLLEAGASVDRPALNGATPLMRAIESCRPSCVEYLIKAGAKINAVNKTEQNCLDVAHAYADFRVVDLLQAKINTQPRPKDNKKPQPVKIHHKPTPASTPGSIKEKQGPVPTPTASSNSAVKKAMKKDSVIVHS-TQITSGRLNKL-----------DISFVPRTNWQNHLTTRDLMDRMARRRQRFSFEVDF-DDFKMPFNKNIQKKSMEFELTD 779          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Zebrafish
Match: ankef1a (ankyrin repeat and EF-hand domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-041001-196])

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 320/787 (40.66%), Postives = 451/787 (57.31%), Query Frame = 3
Query:  150 AQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG-HASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKL--GKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGI--VNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKK-----------------GRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKASGLED 2444
            A+ RL++LQI ++LQC  + D   I+KL+  GV+ LIN  EP +G   L +A   N  D ++FL+D GA PDV D  G++ +M+AA+ G+      LAK  AD+KL D+ GK VL+YC+ PT+RH  CL+  L  N D+NNVS+ G  V   ACE  ++ E +CL +L+ GADPN   + TG+T LM A  +G+  +    LK G + N  D+    A H+AA+ G F+ +  L A+ A         + P+H+AA+G +  CC+FL QRGCNPK+KN  G   R IAKD G K  +KE+ K ER  GK   G  N PWAL L+DW+ EN  E+    +       G+  V K  FV +L  L APL++     +L   DK ++G  +  DFL G KY+ K Y+M+++  KKKK  K GK K  K  +P+ IC +P+  I R  DGGPP   I   Q++TD  R+  ++ P   IEDD +WYI +P++ ++N+N   K GD++S++LAL +   VD +DRFYKT LM+A   GN +M   L++ GADVNA D F WTPLHHA H+G +DI++LL+  GA VD  ALNGATPL RAIES R + VE+L+K GAKI   N      LD+A+ +AD RV+++++AK++  P  KD K                 G   +K G   +    + S  K   +       S +++   R N L           DISF PR    N      L+     RRQRF +E+DF D+F+  F+KN+ ++     L D
Sbjct:    6 AKGRLQVLQIYRLLQCIQDGDKTYIEKLISMGVDDLINLTEPRDGNGVLHLAAVTNKPDMLEFLVDQGARPDVQDRSGRTPLMLAAELGYDGIVSLLAKKNADMKLVDIEGKGVLFYCLHPTKRHMRCLQVVLNGNADVNNVSEAGIPVFLLACEQAQDCEGMCLSILERGADPNATNQETGRTALMEAARAGALELVRAILKKGGNVNALDKKRFHAAHFAAEKGFFEIIKVLSAYRADVGGVTTEGDTPLHFAASGGYTDCCRFLAQRGCNPKLKNQEGLLPRQIAKDCGHKATVKELKKAERLHGKSSKGGTNGPWALMLHDWSHENENELRSAFESATDGFIGVEFVPKGTFVSVLKELHAPLDDVQIHILLLALDKRREGFININDFLRGLKYLPKTYVMASYGPKKKKAAKAGKTKKSKFNLPLPICTVPQDLIHRRDDGGPPHFMIESWQHATDTQRYDRDHRPERPIEDDTAWYIDEPEKIYINLNYCVKTGDIESLRLALSQKVPVDVKDRFYKTPLMAACASGNYEMAKFLLDNGADVNACDQFKWTPLHHACHAGQLDIIQLLLEAGASVDRPALNGATPLMRAIESCRPSCVEYLIKAGAKINAVNKTEQNCLDVAHAYADFRVVDLLQAKINTQPRPKDNKKPQPVKIHHKPTPASTPGSIKEKQGPVPTPTASSNSAVKKAMKKDSVIVHS-TQITSGRLNKL-----------DISFVPRTNWQNHLTTRDLMDRMARRRQRFSFEVDF-DDFKMPFNKNIQKKSMEFELTD 779          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Zebrafish
Match: ankef1b (ankyrin repeat and EF-hand domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-060810-68])

HSP 1 Score: 456.833 bits (1174), Expect = 3.213e-149
Identity = 261/661 (39.49%), Postives = 384/661 (58.09%), Query Frame = 3
Query:  147 IAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLG-----KNNEPWALGLYDWTVENMTEIVEELKLLDLENSGI--VNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIP-IEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRG 2105
            +A+S +EILQI K+LQ   EK+  QIKK+V  GV +LIN  EP +G   L  AT + D + ++FLL L AHPD  D +G + +M+AAQ G+      L K  AD+   D  GK VL+YC+SP++ H  CL+ AL    + NNVS  GK +L  ACE  K+ E++C+ +L+ GADP+ + + T  + LM A  +G+  +     K G +PN  D  G+ A H+AA+ G  + L  L A+ A F V     N P+H+AAA            GCNPK++N  G+    +AK  G K  +KE+ K E+   K         NEPWA+ L+DW+ E+   +    +     N  +  V+ + F+ LL   +AP++ E  ++I+ Q DKN     +  +F  G KY+ K +++S++  K  KK+KG K K R      + IC+MP   I +  D G P   I   Q  T    F+ + P  + IE+D +WYI +P++ + N+N   + GDL+S++LA  +   VD +D+FYKT L++A   GN  +   LI+ GADVNA D F WTPLHHA H+G +DI+ +L+ +GAVVDA A+NGATPL RAIES RF+ VE L+  GA +  EN +G   LD+A  + ++R++ +I +KV  LP  K+  G+G
Sbjct:   16 MAKSNVEILQIYKLLQHVREKNKPQIKKIVCTGVFNLINLTEPKHGLGALYQATVDKDEELVQFLLSLRAHPDTQDKKGCTPLMLAAQLGYYNIVHILIKGYADVNCTDKEGKGVLFYCISPSKEHALCLQMALASKANFNNVSNSGKPLLVFACEKAKDCEDLCINILEKGADPDAVDQVTRCSALMEASKAGALKLVRAISKKGGNPNLVDVEGRCAAHFAAEGGFLEVLQVLSAYSADFCVSTTNGNTPLHFAAA------------GCNPKLRNLEGQLPSQVAKSNGHKAALKELKKAEKRHVKFSAPDAINPNEPWAITLHDWSCEHEAALRRSFESAVELNKPVQTVSLETFMSLLSTNQAPVSNENLQRIIKQHDKNHKNVINLNEFFKGLKYLQKPFVISSYAPKPAKKEKGPKEKKRNKCTSLLPICMMPPELICKREDSGLPYYMIEICQLYTHTKPFNRDQPSIHHIENDSAWYI-EPEKIYSNINYCVRSGDLESLRLAFAQQVPVDIKDQFYKTPLLTACSCGNYQVAEFLISLGADVNAVDQFSWTPLHHACHAGHVDIINMLVQSGAVVDAVAMNGATPLMRAIESCRFSSVECLITAGANVMAENKQGQNCLDIAMIYGNARIVQLITSKVKNLPKNKN-NGKG 662          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Zebrafish
Match: ankef1b (ankyrin repeat and EF-hand domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-060810-68])

HSP 1 Score: 456.833 bits (1174), Expect = 3.213e-149
Identity = 261/661 (39.49%), Postives = 384/661 (58.09%), Query Frame = 3
Query:  147 IAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLG-----KNNEPWALGLYDWTVENMTEIVEELKLLDLENSGI--VNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIP-IEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRG 2105
            +A+S +EILQI K+LQ   EK+  QIKK+V  GV +LIN  EP +G   L  AT + D + ++FLL L AHPD  D +G + +M+AAQ G+      L K  AD+   D  GK VL+YC+SP++ H  CL+ AL    + NNVS  GK +L  ACE  K+ E++C+ +L+ GADP+ + + T  + LM A  +G+  +     K G +PN  D  G+ A H+AA+ G  + L  L A+ A F V     N P+H+AAA            GCNPK++N  G+    +AK  G K  +KE+ K E+   K         NEPWA+ L+DW+ E+   +    +     N  +  V+ + F+ LL   +AP++ E  ++I+ Q DKN     +  +F  G KY+ K +++S++  K  KK+KG K K R      + IC+MP   I +  D G P   I   Q  T    F+ + P  + IE+D +WYI +P++ + N+N   + GDL+S++LA  +   VD +D+FYKT L++A   GN  +   LI+ GADVNA D F WTPLHHA H+G +DI+ +L+ +GAVVDA A+NGATPL RAIES RF+ VE L+  GA +  EN +G   LD+A  + ++R++ +I +KV  LP  K+  G+G
Sbjct:   16 MAKSNVEILQIYKLLQHVREKNKPQIKKIVCTGVFNLINLTEPKHGLGALYQATVDKDEELVQFLLSLRAHPDTQDKKGCTPLMLAAQLGYYNIVHILIKGYADVNCTDKEGKGVLFYCISPSKEHALCLQMALASKANFNNVSNSGKPLLVFACEKAKDCEDLCINILEKGADPDAVDQVTRCSALMEASKAGALKLVRAISKKGGNPNLVDVEGRCAAHFAAEGGFLEVLQVLSAYSADFCVSTTNGNTPLHFAAA------------GCNPKLRNLEGQLPSQVAKSNGHKAALKELKKAEKRHVKFSAPDAINPNEPWAITLHDWSCEHEAALRRSFESAVELNKPVQTVSLETFMSLLSTNQAPVSNENLQRIIKQHDKNHKNVINLNEFFKGLKYLQKPFVISSYAPKPAKKEKGPKEKKRNKCTSLLPICMMPPELICKREDSGLPYYMIEICQLYTHTKPFNRDQPSIHHIENDSAWYI-EPEKIYSNINYCVRSGDLESLRLAFAQQVPVDIKDQFYKTPLLTACSCGNYQVAEFLISLGADVNAVDQFSWTPLHHACHAGHVDIINMLVQSGAVVDAVAMNGATPLMRAIESCRFSSVECLITAGANVMAENKQGQNCLDIAMIYGNARIVQLITSKVKNLPKNKN-NGKG 662          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 115.161 bits (287), Expect = 2.108e-25
Identity = 137/611 (22.42%), Postives = 244/611 (39.93%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFL---------TGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKE----QYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVD 2069
            N  T L +A+   + + +K LLD G+  +    +G + +   A+ GH    E L   GA +     NG + L+        H  C++  L++N  +++V+ D  T L  A   G  + ++  +++   A+PN  +   G TPL  AC      +    LK G         G T +H AA  G+   +  L   GA  +  +      +H AA AG     ++L Q G    +K  + + A  IA   G  + ++++++         K   P A     +T               L  S     +E   LL+   + L+   +K   P     K G  + A+ L          GK  +  L++ + ++ ++               + ++    P S    P   G   ++I  +    +  T L  + +E          C+       +    ++ AA+ G +D + L L K   V+  ++   T L  AA      +   L+N+GA+++A+    +TPLH A H G + +   L+ N A  +AK  NG TPL +A +    +++  LL+ GA        G T L +A       V++ ++   D
Sbjct:  268 NDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGD--HLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCG--HYKVAKVIVDKKANPNA-KALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQ---------KGALPNAATTSGYT--------------PLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVAL------------LLLDQGASPHS----PAKNGYTPLHIAAKKNQLEIGTTLLEYGAE----------CNTVT---RQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVTD 821          

HSP 2 Score: 84.3445 bits (207), Expect = 5.237e-16
Identity = 50/133 (37.59%), Postives = 73/133 (54.89%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            AA+  D  S  L L+  +  D   +   T L  AAHYGN+++   L+N GA V+       TPLH A+  G  ++V+LL++ G+ ++AK  +G TPL     S    VVE LL +GA I  +   GL+PL +A
Sbjct:  210 AARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMA 342          

HSP 3 Score: 80.8777 bits (198), Expect = 5.500e-15
Identity = 45/145 (31.03%), Postives = 82/145 (56.55%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA+ G+L+ +   LK G  ++  ++    AL  A+  G++++   L+  GA+V+A      T LH A+ +G  ++V  L+ NGA V+A++ NG TPL+ A + +  +VV FLL+  +   +    G TPL +A      +V++++
Sbjct:   49 AARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLL 193          

HSP 4 Score: 78.9518 bits (193), Expect = 2.175e-14
Identity = 49/151 (32.45%), Postives = 78/151 (51.66%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            F  ++ AA +G+++   L L +G  VD   R   T L  A+  GN +M   L++ G+ + AK     TPLH  A SG   +VE+L++ GA + +K  NG +PL  A +    N V+ LL+  A +    +  LT L +A +    +V  +I
Sbjct:  237 FTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVI 387          

HSP 5 Score: 78.9518 bits (193), Expect = 2.735e-14
Identity = 64/209 (30.62%), Postives = 99/209 (47.37%), Query Frame = 3
Query: 1485 MYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLI--NYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRG 2105
            +Y+  ++   D+ RF         +E++ S  I   D  F  +  A + G    + L L+     DT+ +    AL  AA   +      L+  ++ ADV +K  F  TPLH AAH G I++  LL+N GA VD  A N  TPL  A +    N+V+ LL +G+KI+ +   GLTPL         +V+ ++   +D   P+  K   G
Sbjct:  145 LYMAAQENHLDVVRFL--------LENNSSQSIATED-GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGF--TPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEML---LDRGAPILSKTKNG 335          

HSP 6 Score: 78.1814 bits (191), Expect = 4.436e-14
Identity = 52/162 (32.10%), Postives = 80/162 (49.38%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII---KAKVDA 2072
            + F  ++ AAK+G L+   L L+K    D   +   T L  AAHY N  + + L++ GA  ++     +TPLH AA    ++I   L+  GA  +     G +PL  A +    ++V  LL K A + M N  GLTPL LA     + V  ++    A++DA
Sbjct:  565 KGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDA 726          

HSP 7 Score: 77.0258 bits (188), Expect = 1.054e-13
Identity = 68/257 (26.46%), Postives = 116/257 (45.14%), Query Frame = 3
Query:  237 DNGVEHLINYNEPDN-----GKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNG 989
            +N V+ L ++    N     G+T L +A     +D +++LL  GA  D+   + ++A+ IA++ G +   + L + GA       +G   L+  +S  E H+E     L     L+  +K G T L  A + G+   E+  +LL+  A P+   K +G TPL  A    +  +    L  G  P++  ++G T +H AAK    +    L  +GA+ +       +P+H AA  G       L  +  N  + N NG
Sbjct:  447 ENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLH--LSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQL--EVANLLLQKKAAPDAAGK-SGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNG 698          

HSP 8 Score: 73.9442 bits (180), Expect = 8.861e-13
Identity = 49/160 (30.63%), Postives = 77/160 (48.12%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKG 2099
            AA  G  + +K     G   +T +   +TAL  AA  G +D+  +L+  GA V+ K     T LH A+  G ++IV+ L+  GA+ +A   +G TPL  +       +   LL++G+ +     KG TPL +A  +    V N++  K  A P    K G
Sbjct:  441 AAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQK-KAAPDAAGKSG 599          

HSP 9 Score: 72.7886 bits (177), Expect = 1.983e-12
Identity = 63/210 (30.00%), Postives = 96/210 (45.71%), Query Frame = 3
Query:  231 LVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAF 860
            L+D G      ++   NG T L IA  +N L+    LL+ GA  + V  +G S + +AAQ G V     L    A++ + + NG   L+  ++  +      E  L +  +++  +K G T L  AC  G  N ++   LL++ A PN   K  G TPL  A   G T I +  L+ G  PN    +G TA+  A + G    +  LR  
Sbjct:  618 LLDQGAS---PHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLH--LAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYG--NMKMANFLLENQAKPNAKTK-NGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGV 819          

HSP 10 Score: 68.5514 bits (166), Expect = 4.022e-11
Identity = 69/288 (23.96%), Postives = 119/288 (41.32%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDG---------------------------KENEEICLILLK--HGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIK 1052
            NG   L +A+ E  ++ +  LL LGA+ D    +G +A+ IA+  G       L   GA++     NG   LY  ++  E H + +   L  N   +  ++DG T L  A + G                           K++ +   +LL+  H AD   ++  +G TPL  A   G+ ++ +  L  G   +   R+  T +H A+K GN   +  L   G++ +        P+H  A +GH    + L  RG     K  NG     +A      +C++ +++
Sbjct:   74 NGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLY--MAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNAD---VESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ 356          

HSP 11 Score: 64.6994 bits (156), Expect = 5.954e-10
Identity = 53/202 (26.24%), Postives = 84/202 (41.58%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAK-----------------------------IQMENSKGLTPLDLAYNWADSRVINII---------KAKVDALP-PVKDKKGRGN 2108
            A+K G ++ +   LK G  VD   +   TAL  A+  G  ++   L+  GA+VNA+    +TPL+ AA    +D+V  L+ N +       +G TPL  A++     VV  LL+   K                               +E+  G TPL +A ++ +  V  ++          A+ D  P  V  K+G GN
Sbjct:   82 ASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGN 283          

HSP 12 Score: 56.225 bits (134), Expect = 1.905e-7
Identity = 37/123 (30.08%), Postives = 61/123 (49.59%), Query Frame = 3
Query: 1662 KKGYKVDTRDRFYKT----ALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            K+  +  +RD+  K+    + + AA  GNL+  +  +  G D+N  +      LH A+  G +++V  L+  GA VDA    G T L  A  + +  VV  L+  GA +  ++  G TPL +A
Sbjct:   26 KRKTRKHSRDQKKKSDSNASYLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMA 148          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Xenopus
Match: ankef1 (ankyrin repeat and EF-hand domain containing 1 [Source:NCBI gene;Acc:779804])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 321/774 (41.47%), Postives = 456/774 (58.91%), Query Frame = 3
Query:  135 NKMPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAGHAS-CCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGK----NNEP-WALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXX-XIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQK-SGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPEDIE----DISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTER 2420
             KM  A+ RLE LQI KVLQC   +D +Q++KL+  G++ LIN  EP NG   L +A + N++D   FLL LGA P++ D  G +  M A ++GH    E LAKAGAD+ + +  GK +L+YC+S T+RH  CL+ AL Y  D+NN + +G  +LF ACE  ++ + +CL LL  GA+PN     TG+T LM A   G+  +    L+ G D N  D     AVH+AAK G F+ L  L A+ A   +     N  +H+AA+G  S CC+FLGQRGCNP  KN      + +AK+ G K  +KE+ KV R F K  K    N  P WAL L+DW   +   + E+ +LLD +  G V K+EF   L+   AP+  E  + IL + +K + GT    +FL G KY+ K +L+S++  KKKK KK GK   +    +P+ IC MP   I R  DGGPP   IP  Q  TDLNRF  ++PP N + DD  WYI +P++ + +++ A K GD++S++ A + G  +D +D FYKT LMSA   GNL++  +L+  GADVNA DNF WTPLHHA H+    I +LL+ +GA +DA A NG+TPL RAIES   N    L+  GAK+Q++N KG T LD+A  +AD R+I++I+AK+D+LP  K+KKG+      G+      +T  P+ P     E  Q   +  + ++ + ++  +S     E    DI+F P+ + +  P     ++ R  RRQ F +++DF D FQ  F KNLTE+
Sbjct:    3 QKMAEAEERLETLQIYKVLQCVLNQDKEQLEKLISLGIKDLINSTEPRNGDGALHLAAAANNVDMCVFLLSLGAQPNIQDLNGCTPAMKATEHGHDLVLEVLAKAGADMSIVNNKGKGILFYCISATKRHLRCLQIALDYGADVNNCTTEGMPILFGACEQAQDCKAMCLKLLDKGANPNSSNPKTGRTALMEAAREGALEVVRSILEKGGDVNAIDNERNHAVHFAAKGGFFEVLKVLSAYKADMGIIAMDGNTALHHAASGGFSECCRFLGQRGCNPLWKNVKTMTPKDLAKEGGFKAAVKEIGKVTRLFKKYSKPTAQNPNPLWALTLHDWASVHEAVLREKFQLLD-KGDGTVGKEEFASALLEAGAPITPEQLQNILGRHEKGRTGTLSVEEFLKGSKYLQKAFLLSSYGLKKKKGKKKGKKGKKGKLSLPMPICTMPSDFISRRDDGGPPKFLIPTFQNVTDLNRFDWDHPPQNPLTDDTGWYIDEPEKVYTHISVATKTGDMESLRKAFEDGVPLDVKDMFYKTPLMSACASGNLNVVQYLLEQGADVNATDNFLWTPLHHACHASQDAIADLLLKHGAKIDALAFNGSTPLMRAIESGSLNCAHLLINSGAKVQIQNKKGQTVLDVAKAYADYRLIDMIQAKLDSLPKPKEKKGKTKGNMEGKAKGPKTQTPGPSDPAHIKQELIQTKLAVPSKEKKSGIIHLNSMITAGETKRVDITFVPKSVWIAEPTTAERMKKREVRRQIFSYDVDF-DNFQMPFTKNLTEK 774          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Xenopus
Match: ankef1 (ankyrin repeat and EF-hand domain containing 1 [Source:NCBI gene;Acc:779804])

HSP 1 Score: 533.102 bits (1372), Expect = 1.727e-177
Identity = 313/769 (40.70%), Postives = 441/769 (57.35%), Query Frame = 3
Query:  135 NKMPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAGHAS-CCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGK----NNEP-WALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXX-XIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTER 2420
             KM  A+ RLE LQI KVLQC   +D +Q++KL+  G++ LIN  EP NG   L +A + N++D   FLL LGA P++ D  G +  M A ++GH    E LAKAGAD+ + +  GK +L+YC+S T+RH  CL+ AL Y  D+NN + +G  +LF ACE  ++ + +CL LL  GA+PN     TG+T LM A   G+  +    L+ G D N  D     AVH+AAK G F+ L  L A+ A   +     N  +H+AA+G  S CC+FLGQRGCNP  KN      + +AK+ G K  +KE+ KV R F K  K    N  P WAL L+DW   +   + E+ +LLD +  G V K+EF   L+   AP+  E  + IL + +K + GT    +FL G KY+ K +L+S++  KKKK KK GK   +    +P+ IC MP   I R  DGGPP   IP  Q  TDLNRF  ++PP N + DD  WYI +P++ + +++ A K GD++S++ A + G  +D +D FYKT LMSA   GNL++  +L+  GADVNA DNF WTPLHHA H+    I +LL+ +GA +DA A NG+TPL RAIES   N    L+  GAK+Q++N KG T LD+A  +AD R+I++I+AK+D+L P   +K    + +    +KG +T +P                              S P  I+      + + +  P     ++ R  RRQ F +++DF D FQ  F KNLTE+
Sbjct:    3 QKMAEAEERLETLQIYKVLQCVLNQDKEQLEKLISLGIKDLINSTEPRNGDGALHLAAAANNVDMCVFLLSLGAQPNIQDLNGCTPAMKATEHGHDLVLEVLAKAGADMSIVNNKGKGILFYCISATKRHLRCLQIALDYGADVNNCTTEGMPILFGACEQAQDCKAMCLKLLDKGANPNSSNPKTGRTALMEAAREGALEVVRSILEKGGDVNAIDNERNHAVHFAAKGGFFEVLKVLSAYKADMGIIAMDGNTALHHAASGGFSECCRFLGQRGCNPLWKNVKTMTPKDLAKEGGFKAAVKEIGKVTRLFKKYSKPTAQNPNPLWALTLHDWASVHEAVLREKFQLLD-KGDGTVGKEEFASALLEAGAPITPEQLQNILGRHEKGRTGTLSVEEFLKGSKYLQKAFLLSSYGLKKKKGKKKGKKGKKGKLSLPMPICTMPSDFISRRDDGGPPKFLIPTFQNVTDLNRFDWDHPPQNPLTDDTGWYIDEPEKVYTHISVATKTGDMESLRKAFEDGVPLDVKDMFYKTPLMSACASGNLNVVQYLLEQGADVNATDNFLWTPLHHACHASQDAIADLLLKHGAKIDALAFNGSTPLMRAIESGSLNCAHLLINSGAKVQIQNKKGQTVLDVAKAYADYRLIDMIQAKLDSL-PKPKEKKGKTKGNMEGKAKGPKTQTPG----------------------------PSDPAHIK------QEVWIAEPTTAERMKKREVRRQIFSYDVDF-DNFQMPFTKNLTEK 734          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 112.464 bits (280), Expect = 1.606e-24
Identity = 135/604 (22.35%), Postives = 244/604 (40.40%), Query Frame = 3
Query:  216 DQIKKLVDNGVEHLINYN-EPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLT-GKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            D +++LV++G     N N +   G T L +A  EN L  +KFLL+ GA+ ++   +G + + +A Q GH                     +NV+ Y +S            ++  V L  +    +           ++     +LL++  + +++ K TG TPL  A    + ++    L  G + N   ++G +A+H A++ GN   +  L   GAQ D     +  P+H A   GH    + L   G   + K  NG     +A      DC++ +++ +                  D T++++T +        +          F++LL++  A ++   EK   P     +    D ADFL   K  VN      A + +         G     ++ +E    P+     P   G   +++      T              + D+ + +     + F  ++ AAK+G +   +L L++    ++  +   T L  A ++ +L++   L+N GA  +      +TPLH A     +D    L+  GA  +A++L G TPL  A +    ++V  LL K A + + N   LTPL LA
Sbjct:   83 DVVRELVNHGA----NVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGH---------------------ENVVAYLIS----------YGMKGKVRLPALHIAAR----------NDDTRTAAVLLQNDPNADVLSK-TGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHID--------------DITLDHLTPL-HVAAHCAIYYYYFFALTSFMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNA----RAKDDQTPLHCAARSGHYEMVRLLLENGAHPDP----PTTAGHTPLHLTTRGGHTQTAEL---------LLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLA 608          

HSP 2 Score: 76.2554 bits (186), Expect = 2.325e-13
Identity = 50/160 (31.25%), Postives = 80/160 (50.00%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKG 2099
            AA+ G  D + L L K   V   ++   T L  A+  G+L++   L+++ A V A+    + PLH A H G I +V+ L+ + A V+A    G TPL +A +    ++V  LLK GA     +  G+TPL +A       V +++    D  P ++  KG
Sbjct:  575 AAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSLVTDG-PHIQVSKG 733          

HSP 3 Score: 72.7886 bits (177), Expect = 2.865e-12
Identity = 46/143 (32.17%), Postives = 76/143 (53.15%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWA 2030
            F  ++ AA + +L+  +L L +G  V+   +   +AL  A+  GN+ M   L++ GA ++A      TPLH A  +G + I E+L+++GA + AK  NG +P+  A +    + V  LL+  A I       LTPL +A + A
Sbjct:  198 FTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCA 340          

HSP 4 Score: 70.4774 bits (171), Expect = 1.232e-11
Identity = 47/158 (29.75%), Postives = 75/158 (47.47%), Query Frame = 3
Query: 1611 MNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII---KAKVDAL 2075
            ++ A  H  L+ ++L L KG       R   T L  A    ++D    L+ +GA  NA+     TPLH AA  G  D+V LL++  A V     +  TPL  A +    N+ E L+   A +  E   G  PL +A ++ + +V+  +   +A V+A+
Sbjct:  506 LHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAV 663          

HSP 5 Score: 70.0922 bits (170), Expect = 1.589e-11
Identity = 44/142 (30.99%), Postives = 74/142 (52.11%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVI 2045
            AA+ G+LD     L+ G  ++T ++    AL  ++  G++ M   L++    +        T LH AA +G  D+V  L+N+GA V++++  G TPL+ A + +   VV+FLL+ GA   +    G TPL +A       V+
Sbjct:   10 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVV 151          

HSP 6 Score: 69.707 bits (169), Expect = 2.212e-11
Identity = 49/151 (32.45%), Postives = 67/151 (44.37%), Query Frame = 3
Query: 1647 IKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKG 2099
            ++L LK G  +D      +T L  AA   + D+   LI   A VNA+     TPLH AA SG  ++V LL+ NGA  D     G TPL            E LL   A       KG TPL +A  +   ++  ++  + +A P    K G
Sbjct:  353 MELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLER-EAHPNSAGKTG 502          

HSP 7 Score: 67.781 bits (164), Expect = 8.961e-11
Identity = 49/172 (28.49%), Postives = 84/172 (48.84%), Query Frame = 3
Query: 1590 PDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRF--------NVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII---KAKVDA 2072
            P      ++ A++ G++  ++L L +G ++D   +   T L  A   G++ +   L+++GA + AK     +P+H A+    +D V LL+   A +D   L+  TPL  A   + +        + +E LLK GA I     K  TPL +A   A + V + +   KAKV+A
Sbjct:  227 PQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCAIYYYYFFALTSFMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNA 398          

HSP 8 Score: 67.3958 bits (163), Expect = 1.117e-10
Identity = 46/176 (26.14%), Postives = 82/176 (46.59%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII--------KAKVDALPPVKDKKGRG 2105
            +  ++ A K   +D+ +  L+ G   + +     T L  AA  G+ DM   L++  A+V+  +    TPLH A+  G ++I E+L+++ A V A+   G  PL  A       VV+FLL+  A +      G TPL  A     + ++ ++        +A ++ + P+   K  G
Sbjct:  536 YTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLG 711          

HSP 9 Score: 67.3958 bits (163), Expect = 1.290e-10
Identity = 54/183 (29.51%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSG 827
            NG T L +A  +  +DT + LL  GA  +    +G + + +AAQ GH      L    A++ L + +    L+  ++  E H    E  + ++  +   ++ G   L  AC  G  N ++   LL+H A+ N + K  G TPL  A   G T I +  LK G  PN A  +G T +  A + G
Sbjct:  534 NGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLH--LASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYG--NIKVVKFLLQHQANVNAVTK-LGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLG 711          

HSP 10 Score: 67.0106 bits (162), Expect = 1.478e-10
Identity = 44/145 (30.34%), Postives = 75/145 (51.72%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            ++K G +  +   L K   ++T  +   TAL  AA  G  D+   L+N+GA+VN++    +TPL+ AA    + +V+ L+ NGA  +    +G TPL  A++    NVV +L+  G K ++     L  L +A    D+R   ++
Sbjct:   43 SSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVR----LPALHIAARNDDTRTAAVL 183          

HSP 11 Score: 66.2402 bits (160), Expect = 2.767e-10
Identity = 39/120 (32.50%), Postives = 60/120 (50.00%), Query Frame = 3
Query: 1704 TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAK 2063
            T L  AA YG + +   L+   A  N+      TPLH A +   ++IV LL+N GA     A NG TPL  A++    +    LL+ GA    ++ +G+TPL LA       ++ ++ +K
Sbjct:  471 TPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSK 590          

HSP 12 Score: 60.077 bits (144), Expect = 2.085e-8
Identity = 68/260 (26.15%), Postives = 102/260 (39.23%), Query Frame = 3
Query:  285 KTCLSIATSENDLDTIKFLLDLGAHPDVVDF-------------EGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKG 1022
            K+  SI      ++T   +    AH DV DF             + ++ +  AA+ GH      L + GA        G   L+  ++    H +  E  L       +++K G T L  A + GK   +I  +LL+  A PN   K TG TPL  A      +I    L  G  P+   R+G T +H A K  +  +  AL  FGA  +        P+H AA  GH      L  +  N  + N +      +A  +G
Sbjct:  358 KSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLH--LTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKI--QIAELLLEREAHPNSAGK-TGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEG 612          

HSP 13 Score: 58.151 bits (139), Expect = 6.825e-8
Identity = 57/201 (28.36%), Postives = 83/201 (41.29%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKG--YKVDTRDRFYKTALMSAAHYGNLDMCMHLINYG-------------------------------ADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRG 2105
            F  +  AA+   L  +K  L+ G    + T D F  T L  A   G+ ++  +LI+YG                               ADV +K  F  TPLH AAH   +++ +LL+N GA V+    NG + L  A       +V  LL +GA+I       LTPL  A      R+  I+   +D   P++ K   G
Sbjct:  103 FTPLYMAAQENHLPVVKFLLENGANQNLATEDGF--TPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGF--TPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEIL---LDHGAPIQAKTKNG 296          

HSP 14 Score: 53.5286 bits (127), Expect = 1.936e-6
Identity = 31/107 (28.97%), Postives = 54/107 (50.47%), Query Frame = 3
Query: 1698 YKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            + T+ + AA  GNLD  +  +  G D+N  +      LH ++  G + +V  L++   V++     G T L  A  + + +VV  L+  GA +  ++ KG TPL +A
Sbjct:    3 FTTSFLRAARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMA 109          

HSP 15 Score: 53.5286 bits (127), Expect = 2.217e-6
Identity = 73/308 (23.70%), Postives = 112/308 (36.36%), Query Frame = 3
Query:  213 YDQIKKLVDNGVEHLINYNEPD----NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYG--------------------------HVASFES-------LAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKG 1022
            Y+ ++ L++NG         PD     G T L + T      T + LLD  A    +  +G + + +AA+YG                          HVA + +       L   GA       NG   L+  V   +R  +     L++    N  S  G T L  A ++G  + ++  +LL   A+ ++  K++  TPL  A   G  +I    +          R G   +H A   GN K +  L    A  +        P+H AA  GH      L + G  P   + NG     IAK  G
Sbjct:  416 YEMVRLLLENGAH-------PDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVK--QRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEG--HGDMVTLLLSKQANVHLGNKSS-LTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLG 711          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 112.464 bits (280), Expect = 1.932e-24
Identity = 134/603 (22.22%), Postives = 245/603 (40.63%), Query Frame = 3
Query:  216 DQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLT-GKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            D +++LV++G    +N ++   G T L +A  EN L  +KFLL+ GA+ ++   +G + + +A Q GH                     +NV+ Y +S            ++  V L  +    +           ++     +LL++  + +++ K TG TPL  A    + ++    L  G + N   ++G +A+H A++ GN   +  L   GAQ D     +  P+H A   GH    + L   G   + K  NG     +A      DC++ +++ +                  D T++++T +        +          F++LL++  A ++   EK   P     +    D ADFL   K  VN      A + +         G     ++ +E    P+     P   G   +++      T              + D+ + +     + F  ++ AAK+G +   +L L++    ++  +   T L  A ++ +L++   L+N GA  +      +TPLH A     +D    L+  GA  +A++L G TPL  A +    ++V  LL K A + + N   LTPL LA
Sbjct:  125 DVVRELVNHGAN--VN-SQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGH---------------------ENVVAYLIS----------YGMKGKVRLPALHIAAR----------NDDTRTAAVLLQNDPNADVLSK-TGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHID--------------DITLDHLTPL-HVAAHCAIYYYYFFALTSFMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNA----RAKDDQTPLHCAARSGHYEMVRLLLENGAHPDP----PTTAGHTPLHLTTRGGHTQTAEL---------LLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLA 650          

HSP 2 Score: 76.2554 bits (186), Expect = 2.198e-13
Identity = 50/160 (31.25%), Postives = 80/160 (50.00%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKG 2099
            AA+ G  D + L L K   V   ++   T L  A+  G+L++   L+++ A V A+    + PLH A H G I +V+ L+ + A V+A    G TPL +A +    ++V  LLK GA     +  G+TPL +A       V +++    D  P ++  KG
Sbjct:  617 AAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSLVTDG-PHIQVSKG 775          

HSP 3 Score: 72.7886 bits (177), Expect = 2.708e-12
Identity = 46/143 (32.17%), Postives = 76/143 (53.15%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWA 2030
            F  ++ AA + +L+  +L L +G  V+   +   +AL  A+  GN+ M   L++ GA ++A      TPLH A  +G + I E+L+++GA + AK  NG +P+  A +    + V  LL+  A I       LTPL +A + A
Sbjct:  240 FTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCA 382          

HSP 4 Score: 70.4774 bits (171), Expect = 1.194e-11
Identity = 47/158 (29.75%), Postives = 75/158 (47.47%), Query Frame = 3
Query: 1611 MNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII---KAKVDAL 2075
            ++ A  H  L+ ++L L KG       R   T L  A    ++D    L+ +GA  NA+     TPLH AA  G  D+V LL++  A V     +  TPL  A +    N+ E L+   A +  E   G  PL +A ++ + +V+  +   +A V+A+
Sbjct:  548 LHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAV 705          

HSP 5 Score: 70.0922 bits (170), Expect = 1.554e-11
Identity = 44/142 (30.99%), Postives = 74/142 (52.11%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVI 2045
            AA+ G+LD     L+ G  ++T ++    AL  ++  G++ M   L++    +        T LH AA +G  D+V  L+N+GA V++++  G TPL+ A + +   VV+FLL+ GA   +    G TPL +A       V+
Sbjct:   52 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVV 193          

HSP 6 Score: 69.707 bits (169), Expect = 2.334e-11
Identity = 49/151 (32.45%), Postives = 67/151 (44.37%), Query Frame = 3
Query: 1647 IKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKG 2099
            ++L LK G  +D      +T L  AA   + D+   LI   A VNA+     TPLH AA SG  ++V LL+ NGA  D     G TPL            E LL   A       KG TPL +A  +   ++  ++  + +A P    K G
Sbjct:  395 MELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLER-EAHPNSAGKTG 544          

HSP 7 Score: 67.781 bits (164), Expect = 8.613e-11
Identity = 49/172 (28.49%), Postives = 84/172 (48.84%), Query Frame = 3
Query: 1590 PDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRF--------NVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII---KAKVDA 2072
            P      ++ A++ G++  ++L L +G ++D   +   T L  A   G++ +   L+++GA + AK     +P+H A+    +D V LL+   A +D   L+  TPL  A   + +        + +E LLK GA I     K  TPL +A   A + V + +   KAKV+A
Sbjct:  269 PQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCAIYYYYFFALTSFMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNA 440          

HSP 8 Score: 67.3958 bits (163), Expect = 1.056e-10
Identity = 46/176 (26.14%), Postives = 82/176 (46.59%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII--------KAKVDALPPVKDKKGRG 2105
            +  ++ A K   +D+ +  L+ G   + +     T L  AA  G+ DM   L++  A+V+  +    TPLH A+  G ++I E+L+++ A V A+   G  PL  A       VV+FLL+  A +      G TPL  A     + ++ ++        +A ++ + P+   K  G
Sbjct:  578 YTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLG 753          

HSP 9 Score: 67.0106 bits (162), Expect = 1.350e-10
Identity = 54/183 (29.51%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSG 827
            NG T L +A  +  +DT + LL  GA  +    +G + + +AAQ GH      L    A++ L + +    L+  ++  E H    E  + ++  +   ++ G   L  AC  G  N ++   LL+H A+ N + K  G TPL  A   G T I +  LK G  PN A  +G T +  A + G
Sbjct:  576 NGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLH--LASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYG--NIKVVKFLLQHQANVNAVTK-LGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLG 753          

HSP 10 Score: 67.0106 bits (162), Expect = 1.457e-10
Identity = 44/145 (30.34%), Postives = 75/145 (51.72%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            ++K G +  +   L K   ++T  +   TAL  AA  G  D+   L+N+GA+VN++    +TPL+ AA    + +V+ L+ NGA  +    +G TPL  A++    NVV +L+  G K ++     L  L +A    D+R   ++
Sbjct:   85 SSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVR----LPALHIAARNDDTRTAAVL 225          

HSP 11 Score: 66.2402 bits (160), Expect = 2.751e-10
Identity = 39/120 (32.50%), Postives = 60/120 (50.00%), Query Frame = 3
Query: 1704 TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAK 2063
            T L  AA YG + +   L+   A  N+      TPLH A +   ++IV LL+N GA     A NG TPL  A++    +    LL+ GA    ++ +G+TPL LA       ++ ++ +K
Sbjct:  513 TPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSK 632          

HSP 12 Score: 59.6918 bits (143), Expect = 2.561e-8
Identity = 68/260 (26.15%), Postives = 102/260 (39.23%), Query Frame = 3
Query:  285 KTCLSIATSENDLDTIKFLLDLGAHPDVVDF-------------EGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKG 1022
            K+  SI      ++T   +    AH DV DF             + ++ +  AA+ GH      L + GA        G   L+  ++    H +  E  L       +++K G T L  A + GK   +I  +LL+  A PN   K TG TPL  A      +I    L  G  P+   R+G T +H A K  +  +  AL  FGA  +        P+H AA  GH      L  +  N  + N +      +A  +G
Sbjct:  400 KSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLH--LTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKI--QIAELLLEREAHPNSAGK-TGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEG 654          

HSP 13 Score: 58.5362 bits (140), Expect = 6.613e-8
Identity = 57/201 (28.36%), Postives = 83/201 (41.29%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKG--YKVDTRDRFYKTALMSAAHYGNLDMCMHLINYG-------------------------------ADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRG 2105
            F  +  AA+   L  +K  L+ G    + T D F  T L  A   G+ ++  +LI+YG                               ADV +K  F  TPLH AAH   +++ +LL+N GA V+    NG + L  A       +V  LL +GA+I       LTPL  A      R+  I+   +D   P++ K   G
Sbjct:  145 FTPLYMAAQENHLPVVKFLLENGANQNLATEDGF--TPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGF--TPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEIL---LDHGAPIQAKTKNG 338          

HSP 14 Score: 53.1434 bits (126), Expect = 2.745e-6
Identity = 73/308 (23.70%), Postives = 112/308 (36.36%), Query Frame = 3
Query:  213 YDQIKKLVDNGVEHLINYNEPD----NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYG--------------------------HVASFES-------LAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKG 1022
            Y+ ++ L++NG         PD     G T L + T      T + LLD  A    +  +G + + +AA+YG                          HVA + +       L   GA       NG   L+  V   +R  +     L++    N  S  G T L  A ++G  + ++  +LL   A+ ++  K++  TPL  A   G  +I    +          R G   +H A   GN K +  L    A  +        P+H AA  GH      L + G  P   + NG     IAK  G
Sbjct:  458 YEMVRLLLENGAH-------PDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVK--QRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEG--HGDMVTLLLSKQANVHLGNKSS-LTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLG 753          

HSP 15 Score: 52.373 bits (124), Expect = 4.965e-6
Identity = 31/105 (29.52%), Postives = 53/105 (50.48%), Query Frame = 3
Query: 1704 TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            T+ + AA  GNLD  +  +  G D+N  +      LH ++  G + +V  L++   V++     G T L  A  + + +VV  L+  GA +  ++ KG TPL +A
Sbjct:   47 TSFLRAARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMA 151          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Xenopus
Match: foxj3 (forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185])

HSP 1 Score: 110.153 bits (274), Expect = 8.956e-24
Identity = 159/680 (23.38%), Postives = 266/680 (39.12%), Query Frame = 3
Query:  177 IRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNG---KTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKE------------------NEEICLILLK------HGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMK------EVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMND-------AAKHGDLDSIKLALKKGYKVDTRD--RFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVK 2087
             R++ +     D  ++++L++ G     N N  D      T L  A      D ++ LL  GA+    D  G   +  A  +GH      L   GAD    D N      +  S   +   C+   L++  D +  + DGK+ L  A    K                   NEE  + LL       H +D          TPL  A       I    L+ G D +  D+ G   +H A   G+F+    L   GA  +  D  Q  P+H AA+      C  L   G +P + N +G+ A  +A     K+ +        +++  R    + K  +  AL + ++      E      +  L       +K+  +LL+R  A +NE+ +  + P     +    D  + L   K+  K   M+A +                         + ++ + R   GG          + +D +  S +     ++ ++    I + + T V  +D       A+K GDLD++K  L     V+ RD    + T L  AA Y  + +  +L+++GADV+AKD     PLH+A   G  ++ ELL+ +GA V+   L   TPL  A    ++ + + LLK GA    +N  G TPLDL  +  D+ + ++++     L   K
Sbjct:  161 FRELFEACRNGDVSRVRRLLEPG-----NVNAKDMAGRKSTPLHFAAGFGRKDVVEHLLQTGANVHARDDGGLIPLHNACSFGHAEVVTLLLCQGADPNARD-NWNYTPLHEASIKGKIDVCI-VLLQHGADPSIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASD------GRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHFEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELKERLSYEFKGHSLLQAARE-ADMAKVKKTLALEIINFKQPQSHETALHCAVASLHP----KRKQITELLLRKGASVNEKNKDFMTPLHVAAERAHNDVVEVL--HKHGAK---MNALD------------------------TLGQTALHRAALGGHLQTCRLLLSFGSDASIVSLQGFTAAQMGNEAVQQILNVESTPVRTSDVDYRLLEASKAGDLDTVK-QLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKD-GDTDIQDLLRGDAALLDAAK 791          

HSP 2 Score: 101.293 bits (251), Expect = 3.915e-21
Identity = 164/670 (24.48%), Postives = 253/670 (37.76%), Query Frame = 3
Query:  294 LSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNII-----------------------------------------------------QKATGKTPLMAACAS---GSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNN----EPWALGLYDWTVENMTEIVEELKLLDLEN--------SGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLT---GKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSI-KLALKKGYKV-DTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPP 2081
            L  A S N+   +  L  L  +    D    + + +AA Y  V   + L + GAD+   D  G   L+   S    H E  E  L++   +N +     T L  A    K   E+C +LL HGADP ++                                                     Q  + +T L  A AS       I    L+ G   N  ++   T +H AA+  +   +  L   GA+ +  D      +H AA  GH   C+ L   G +  + +  G  A  +  +      +++++ VE +  +    +    E    G  D TV+ +    + +   DLE         +   N+   V+ L+   A ++ + +  ++P  +    G ++ A+ L        V  L+  +       K K              EIC +   H   P                T  NR    N P + ++D     I D  R    + DAAK G L  + KL  ++     DT+ R   T L  AA Y NL++  +L+ +GADVNA+D     PLH+AA  G +DI  LLI     V+A      TPL  A +  R  +   LL  GA   M+N +  TPLDLA   AD    +I    +DA+PP
Sbjct:  318 LEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACS--YGHFEVTELLLKHGACVNAMDLWQFTPLHEAAS--KNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELKERLSYEFKGHSLLQAAREADMAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQITELLLRKGASVNEKNKDFMTPLHVAAERAHNDVVEVLHKHGAKMNALDTLGQTALHRAALGGHLQTCRLLLSFGSDASIVSLQGFTAAQMGNE-----AVQQILNVESTPVRTSDVDYRLLEASKAGDLD-TVKQLCS-SQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGK-------------YEICKLLLKHGADP----------------TKKNR--DGNTPLDLVKDG-DTDIQDLLRGDAALLDAAKKGCLARVQKLCTQENINCRDTQGR-NSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQESQTPLDLA--TAD----DIRALLIDAMPP 937          

HSP 3 Score: 51.6026 bits (122), Expect = 6.576e-6
Identity = 71/293 (24.23%), Postives = 112/293 (38.23%), Query Frame = 3
Query:  183 KVLQCTYEKDYDQIKKLVDNGVEHLINYNEPD---NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKEN---------------EEICLI-LLKHGADPNIIQKAT---GKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGE 992
            ++L+ +   D D +K+L  +      N N  D      T L  A   N +  +++LL  GA     D  G   +  A  YGH    E L + GA + + DL     L+   +  +   E  +  L++  D    ++DG T L    +DG  +               ++ CL  + K     NI  + T     TPL  A    +  +    L+ G D N  D+ G   +H AA  G+      L  +    +  D     P+H AA  G    C  L   G +P +KN   +
Sbjct:  632 RLLEASKAGDLDTVKQLCSSQ-----NVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKY--EICKLLLKHGADPTKKNRDGNTPL-DLVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTQENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQESQ 916          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Mouse
Match: Ankef1 (ankyrin repeat and EF-hand domain containing 1 [Source:MGI Symbol;Acc:MGI:2441685])

HSP 1 Score: 537.339 bits (1383), Expect = 8.460e-179
Identity = 308/772 (39.90%), Postives = 439/772 (56.87%), Query Frame = 3
Query:  141 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKN-----NEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDK---KGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKA 2429
            M +A  RLE LQI +VLQC   KD  QI+KL   G   LIN+ EP +G + L +A+  ND D + FLL LGAHPDV D  G +  M AA+ GH  S E LAKA AD+ + D  GK VL+YC+ PT+RH  C   AL +  D+NN++ +GK V   ACE+  + +++CL  L+ GA+PN I  +TG+T LM +   G   I    L+ G + N  D     A H+AAK G F  L  L A+     +     N P+H+AA  G A CCK++ QRGC+ K KN   +  R +AKD G K   KE+ + ER+  KL K      N  WAL L+DW++E+ T +    K +D    G+V+K +FV  L   +     E    +    +K++ G  +  +F  G KY++K Y++ +F  KKKK+  G K +  K  +P+ IC +PE+   R  DGGPP   I   Q  +D +RF+ ++PP + I+DD  WYI DP R F N++   K GDL S+K A++ G  VD +D  YKT LM A   GN+D+   LI  GA+VNA DNF WTPLH A H+G  DIVELL+  GA +DA ++N +TPL RAIES R + V++LL  GAK Q+EN KG   +D+A  +AD R+I++IK K+D LP   D    KG+  +     +   +   + +     P    ++     ++   N+L++     +   DI+F P+ +         L++ R  RR+RF +E+DF D F   F KN+TE+ +A
Sbjct:    1 MALADKRLENLQIYRVLQCVRNKDKKQIEKLTRLGYPELINFTEPIDGLSALHLASISNDTDMVSFLLKLGAHPDVQDHMGCTPTMRAAELGHELSMEILAKAKADMTIVDNEGKGVLFYCILPTKRHYRCSLIALEHGADVNNITYEGKPVFLRACEEAHDVKDMCLTFLEKGANPNAINTSTGRTALMESSREGVLEIVRGILERGGEVNAYDNDRHHAAHFAAKGGFFDILKLLFAYNGDMGLIGMDGNTPLHFAAMGGFADCCKYIAQRGCDLKWKNLEHKTPRVVAKDGGFKAASKEIRRAERTAAKLAKTGAKNPNPLWALRLHDWSIEHETSLRNAFKFVD-RGDGVVSKDDFVVALEERQEYATSEQLLSVAQMHEKSRGGGVNINEFFKGTKYLSKSYVLGSFGPKKKKRGLGKKPRKGKFVLPLPICTIPENAFPRRPDGGPPYYMIETYQNVSDSHRFNRDHPPEHPIQDDSEWYIDDPSRVFANISFITKAGDLASLKKAIETGIPVDMKDNTYKTPLMIACASGNIDVVKFLIEKGANVNATDNFLWTPLHFACHAGQQDIVELLVKAGASIDATSINNSTPLSRAIESCRLDTVKYLLDMGAKFQIENRKGHAAMDIAKAYADYRIIDMIKEKLDNLPKQADNQKMKGKLPKLKTEGTDVKKEEETLSSIYTVPAITEEKKVHRDSVVYLNSLITSGFTKK--VDITFIPKRIWSPEATTAELIRKRELRRERFTYEVDFED-FMMPFQKNITEKAQA 768          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Mouse
Match: Ankef1 (ankyrin repeat and EF-hand domain containing 1 [Source:MGI Symbol;Acc:MGI:2441685])

HSP 1 Score: 537.339 bits (1383), Expect = 8.460e-179
Identity = 308/772 (39.90%), Postives = 439/772 (56.87%), Query Frame = 3
Query:  141 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKN-----NEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDK---KGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKA 2429
            M +A  RLE LQI +VLQC   KD  QI+KL   G   LIN+ EP +G + L +A+  ND D + FLL LGAHPDV D  G +  M AA+ GH  S E LAKA AD+ + D  GK VL+YC+ PT+RH  C   AL +  D+NN++ +GK V   ACE+  + +++CL  L+ GA+PN I  +TG+T LM +   G   I    L+ G + N  D     A H+AAK G F  L  L A+     +     N P+H+AA  G A CCK++ QRGC+ K KN   +  R +AKD G K   KE+ + ER+  KL K      N  WAL L+DW++E+ T +    K +D    G+V+K +FV  L   +     E    +    +K++ G  +  +F  G KY++K Y++ +F  KKKK+  G K +  K  +P+ IC +PE+   R  DGGPP   I   Q  +D +RF+ ++PP + I+DD  WYI DP R F N++   K GDL S+K A++ G  VD +D  YKT LM A   GN+D+   LI  GA+VNA DNF WTPLH A H+G  DIVELL+  GA +DA ++N +TPL RAIES R + V++LL  GAK Q+EN KG   +D+A  +AD R+I++IK K+D LP   D    KG+  +     +   +   + +     P    ++     ++   N+L++     +   DI+F P+ +         L++ R  RR+RF +E+DF D F   F KN+TE+ +A
Sbjct:    1 MALADKRLENLQIYRVLQCVRNKDKKQIEKLTRLGYPELINFTEPIDGLSALHLASISNDTDMVSFLLKLGAHPDVQDHMGCTPTMRAAELGHELSMEILAKAKADMTIVDNEGKGVLFYCILPTKRHYRCSLIALEHGADVNNITYEGKPVFLRACEEAHDVKDMCLTFLEKGANPNAINTSTGRTALMESSREGVLEIVRGILERGGEVNAYDNDRHHAAHFAAKGGFFDILKLLFAYNGDMGLIGMDGNTPLHFAAMGGFADCCKYIAQRGCDLKWKNLEHKTPRVVAKDGGFKAASKEIRRAERTAAKLAKTGAKNPNPLWALRLHDWSIEHETSLRNAFKFVD-RGDGVVSKDDFVVALEERQEYATSEQLLSVAQMHEKSRGGGVNINEFFKGTKYLSKSYVLGSFGPKKKKRGLGKKPRKGKFVLPLPICTIPENAFPRRPDGGPPYYMIETYQNVSDSHRFNRDHPPEHPIQDDSEWYIDDPSRVFANISFITKAGDLASLKKAIETGIPVDMKDNTYKTPLMIACASGNIDVVKFLIEKGANVNATDNFLWTPLHFACHAGQQDIVELLVKAGASIDATSINNSTPLSRAIESCRLDTVKYLLDMGAKFQIENRKGHAAMDIAKAYADYRIIDMIKEKLDNLPKQADNQKMKGKLPKLKTEGTDVKKEEETLSSIYTVPAITEEKKVHRDSVVYLNSLITSGFTKK--VDITFIPKRIWSPEATTAELIRKRELRRERFTYEVDFED-FMMPFQKNITEKAQA 768          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Mouse
Match: Ankef1 (ankyrin repeat and EF-hand domain containing 1 [Source:MGI Symbol;Acc:MGI:2441685])

HSP 1 Score: 537.339 bits (1383), Expect = 8.460e-179
Identity = 308/772 (39.90%), Postives = 439/772 (56.87%), Query Frame = 3
Query:  141 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKN-----NEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDK---KGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKA 2429
            M +A  RLE LQI +VLQC   KD  QI+KL   G   LIN+ EP +G + L +A+  ND D + FLL LGAHPDV D  G +  M AA+ GH  S E LAKA AD+ + D  GK VL+YC+ PT+RH  C   AL +  D+NN++ +GK V   ACE+  + +++CL  L+ GA+PN I  +TG+T LM +   G   I    L+ G + N  D     A H+AAK G F  L  L A+     +     N P+H+AA  G A CCK++ QRGC+ K KN   +  R +AKD G K   KE+ + ER+  KL K      N  WAL L+DW++E+ T +    K +D    G+V+K +FV  L   +     E    +    +K++ G  +  +F  G KY++K Y++ +F  KKKK+  G K +  K  +P+ IC +PE+   R  DGGPP   I   Q  +D +RF+ ++PP + I+DD  WYI DP R F N++   K GDL S+K A++ G  VD +D  YKT LM A   GN+D+   LI  GA+VNA DNF WTPLH A H+G  DIVELL+  GA +DA ++N +TPL RAIES R + V++LL  GAK Q+EN KG   +D+A  +AD R+I++IK K+D LP   D    KG+  +     +   +   + +     P    ++     ++   N+L++     +   DI+F P+ +         L++ R  RR+RF +E+DF D F   F KN+TE+ +A
Sbjct:    1 MALADKRLENLQIYRVLQCVRNKDKKQIEKLTRLGYPELINFTEPIDGLSALHLASISNDTDMVSFLLKLGAHPDVQDHMGCTPTMRAAELGHELSMEILAKAKADMTIVDNEGKGVLFYCILPTKRHYRCSLIALEHGADVNNITYEGKPVFLRACEEAHDVKDMCLTFLEKGANPNAINTSTGRTALMESSREGVLEIVRGILERGGEVNAYDNDRHHAAHFAAKGGFFDILKLLFAYNGDMGLIGMDGNTPLHFAAMGGFADCCKYIAQRGCDLKWKNLEHKTPRVVAKDGGFKAASKEIRRAERTAAKLAKTGAKNPNPLWALRLHDWSIEHETSLRNAFKFVD-RGDGVVSKDDFVVALEERQEYATSEQLLSVAQMHEKSRGGGVNINEFFKGTKYLSKSYVLGSFGPKKKKRGLGKKPRKGKFVLPLPICTIPENAFPRRPDGGPPYYMIETYQNVSDSHRFNRDHPPEHPIQDDSEWYIDDPSRVFANISFITKAGDLASLKKAIETGIPVDMKDNTYKTPLMIACASGNIDVVKFLIEKGANVNATDNFLWTPLHFACHAGQQDIVELLVKAGASIDATSINNSTPLSRAIESCRLDTVKYLLDMGAKFQIENRKGHAAMDIAKAYADYRIIDMIKEKLDNLPKQADNQKMKGKLPKLKTEGTDVKKEEETLSSIYTVPAITEEKKVHRDSVVYLNSLITSGFTKK--VDITFIPKRIWSPEATTAELIRKRELRRERFTYEVDFED-FMMPFQKNITEKAQA 768          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Mouse
Match: Ankef1 (ankyrin repeat and EF-hand domain containing 1 [Source:MGI Symbol;Acc:MGI:2441685])

HSP 1 Score: 298.516 bits (763), Expect = 5.530e-92
Identity = 164/412 (39.81%), Postives = 231/412 (56.07%), Query Frame = 3
Query:  141 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKN-----NEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAF 1358
            M +A  RLE LQI +VLQC   KD  QI+KL   G   LIN+ EP +G + L +A+  ND D + FLL LGAHPDV D  G +  M AA+ GH  S E LAKA AD+ + D  GK VL+YC+ PT+RH  C   AL +  D+NN++ +GK V   ACE+  + +++CL  L+ GA+PN I  +TG+T LM +   G   I    L+ G + N  D     A H+AAK G F  L  L A+     +     N P+H+AA  G A CCK++ QRGC+ K KN   +  R +AKD G K   KE+ + ER+  KL K      N  WAL L+DW++E+ T +    K +D    G+V+K +FV  L   +     E    +    +K++ G  +  +F  G KY++K Y++ +F
Sbjct:    1 MALADKRLENLQIYRVLQCVRNKDKKQIEKLTRLGYPELINFTEPIDGLSALHLASISNDTDMVSFLLKLGAHPDVQDHMGCTPTMRAAELGHELSMEILAKAKADMTIVDNEGKGVLFYCILPTKRHYRCSLIALEHGADVNNITYEGKPVFLRACEEAHDVKDMCLTFLEKGANPNAINTSTGRTALMESSREGVLEIVRGILERGGEVNAYDNDRHHAAHFAAKGGFFDILKLLFAYNGDMGLIGMDGNTPLHFAAMGGFADCCKYIAQRGCDLKWKNLEHKTPRVVAKDGGFKAASKEIRRAERTAAKLAKTGAKNPNPLWALRLHDWSIEHETSLRNAFKFVD-RGDGVVSKDDFVVALEERQEYATSEQLLSVAQMHEKSRGGGVNINEFFKGTKYLSKSYVLGSF 411          

HSP 2 Score: 50.8322 bits (120), Expect = 5.528e-6
Identity = 29/102 (28.43%), Postives = 52/102 (50.98%), Query Frame = 3
Query: 1701 KTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTP 2006
            +TALM ++  G L++   ++  G +VNA DN      H AA  G  DI++LL      +    ++G TPL  A      +  +++ ++G  ++ +N +  TP
Sbjct:  186 RTALMESSREGVLEIVRGILERGGEVNAYDNDRHHAAHFAAKGGFFDILKLLFAYNGDMGLIGMDGNTPLHFAAMGGFADCCKYIAQRGCDLKWKNLEHKTP 287          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Mouse
Match: Ankef1 (ankyrin repeat and EF-hand domain containing 1 [Source:MGI Symbol;Acc:MGI:2441685])

HSP 1 Score: 171.014 bits (432), Expect = 2.329e-48
Identity = 86/180 (47.78%), Postives = 114/180 (63.33%), Query Frame = 3
Query:  141 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNII 680
            M +A  RLE LQI +VLQC   KD  QI+KL   G   LIN+ EP +G + L +A+  ND D + FLL LGAHPDV D  G +  M AA+ GH  S E LAKA AD+ + D  GK VL+YC+ PT+RH  C   AL +  D+NN++ +GK V   ACE+  + +++CL  L+ GA+PN I
Sbjct:    1 MALADKRLENLQIYRVLQCVRNKDKKQIEKLTRLGYPELINFTEPIDGLSALHLASISNDTDMVSFLLKLGAHPDVQDHMGCTPTMRAAELGHELSMEILAKAKADMTIVDNEGKGVLFYCILPTKRHYRCSLIALEHGADVNNITYEGKPVFLRACEEAHDVKDMCLTFLEKGANPNAI 180          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9NU02|ANKE1_HUMAN (Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKEF1 PE=2 SV=2)

HSP 1 Score: 541.576 bits (1394), Expect = 1.584e-179
Identity = 320/776 (41.24%), Postives = 450/776 (57.99%), Query Frame = 3
Query:  141 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLG----KNNEP-WALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALP-PVKDKKGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALK----RANNLLS--YSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKA 2429
            M +A  RLE LQI KVLQC   KD  QI+KL   G   LINY EP NG + L +A+  ND+D + FLLDLGAHPDV D  G +  M AA+ GH  S E LAKA AD+ + D  GK VL+YC+ PT+RH  C   AL +  D+NN + +GK +   ACED  + +++CL  L+ GA+PN I  +TG+T LM A   G   I    L+ G + N  D     A H+AAK G F  L  L A+     +     N P+HYAA  G A CCK++ QRGC+ K KN + +  R +AK+ G K   KE+ + ER   KL     KN  P WAL L+DW+VE    + E   +LD    G ++K +FV +L   +   + E    I    +K + G  +  +F  G +Y+NK +++ ++  KKK+K  G KGK  K  +P+ ICV+PE    R  DGGPP   I   +  TD +RF+ ++PP + I+DD  WYI D ++ F N+N   K GDL S+K A + G  VD +D +YKT LM+A   GN+D+   L+  GA+VNA DNF WTPLH A H+G  DIVELL+ +GA++DA ++N +TPL RAIES R + V++LL  GAK Q+EN KG + +D+A  +AD R+I++IK K+D LP P +++K +G +      ++G       + +      P  S  +   K      N+L++  Y+ K     DI+F PR +         L++ R  RR+RF  E+DF D+F   F KN+TE+ +A
Sbjct:    1 MALADKRLENLQIYKVLQCVRNKDKKQIEKLTKLGYPELINYTEPINGLSALHLASVSNDIDMVSFLLDLGAHPDVQDRMGCTPTMRAAELGHELSMEILAKAKADMTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRACEDAHDVKDVCLTFLEKGANPNAINSSTGRTALMEASREGVVEIVRGILERGGEVNAFDNDRHHAAHFAAKGGFFDILKLLFAYNGDVGLISINGNTPLHYAAMGGFADCCKYIAQRGCDLKWKNLDHKTPRAVAKEGGFKAASKEIRRAERIANKLARPGAKNPNPLWALRLHDWSVEREAFLREAFAVLD-RGDGSISKNDFVMVLEERQDYASSEQLAAIAHLHEKTRGGGVNINEFFKGTRYLNKSFVLGSYGPKKKEKGMGKKGKKGKFVLPLPICVIPEYAFPRRQDGGPPYYMIETYKNVTDSSRFNRDHPPEHPIQDDSVWYIDDSEKVFSNINIITKAGDLASLKKAFESGIPVDMKDNYYKTPLMTACASGNIDVVKFLLEKGANVNATDNFLWTPLHFACHAGQQDIVELLVESGALIDAASINNSTPLNRAIESCRLDTVKYLLDIGAKFQLENRKGHSAMDVAKAYADYRIIDLIKEKLDNLPKPAENQKLKG-KTPPILKTEGPEIKKEEELLSSIYGVPTTSEGKKVQKGNVVHLNSLITSGYTKKV----DITFIPRRIWSPEATTAELIRKRELRRERFTHEVDF-DDFMMPFQKNITEKARA 769          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9D2J7|ANKE1_MOUSE (Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ankef1 PE=2 SV=1)

HSP 1 Score: 537.339 bits (1383), Expect = 5.918e-178
Identity = 308/772 (39.90%), Postives = 439/772 (56.87%), Query Frame = 3
Query:  141 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKN-----NEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDK---KGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKA 2429
            M +A  RLE LQI +VLQC   KD  QI+KL   G   LIN+ EP +G + L +A+  ND D + FLL LGAHPDV D  G +  M AA+ GH  S E LAKA AD+ + D  GK VL+YC+ PT+RH  C   AL +  D+NN++ +GK V   ACE+  + +++CL  L+ GA+PN I  +TG+T LM +   G   I    L+ G + N  D     A H+AAK G F  L  L A+     +     N P+H+AA  G A CCK++ QRGC+ K KN   +  R +AKD G K   KE+ + ER+  KL K      N  WAL L+DW++E+ T +    K +D    G+V+K +FV  L   +     E    +    +K++ G  +  +F  G KY++K Y++ +F  KKKK+  G K +  K  +P+ IC +PE+   R  DGGPP   I   Q  +D +RF+ ++PP + I+DD  WYI DP R F N++   K GDL S+K A++ G  VD +D  YKT LM A   GN+D+   LI  GA+VNA DNF WTPLH A H+G  DIVELL+  GA +DA ++N +TPL RAIES R + V++LL  GAK Q+EN KG   +D+A  +AD R+I++IK K+D LP   D    KG+  +     +   +   + +     P    ++     ++   N+L++     +   DI+F P+ +         L++ R  RR+RF +E+DF D F   F KN+TE+ +A
Sbjct:    1 MALADKRLENLQIYRVLQCVRNKDKKQIEKLTRLGYPELINFTEPIDGLSALHLASISNDTDMVSFLLKLGAHPDVQDHMGCTPTMRAAELGHELSMEILAKAKADMTIVDNEGKGVLFYCILPTKRHYRCSLIALEHGADVNNITYEGKPVFLRACEEAHDVKDMCLTFLEKGANPNAINTSTGRTALMESSREGVLEIVRGILERGGEVNAYDNDRHHAAHFAAKGGFFDILKLLFAYNGDMGLIGMDGNTPLHFAAMGGFADCCKYIAQRGCDLKWKNLEHKTPRVVAKDGGFKAASKEIRRAERTAAKLAKTGAKNPNPLWALRLHDWSIEHETSLRNAFKFVD-RGDGVVSKDDFVVALEERQEYATSEQLLSVAQMHEKSRGGGVNINEFFKGTKYLSKSYVLGSFGPKKKKRGLGKKPRKGKFVLPLPICTIPENAFPRRPDGGPPYYMIETYQNVSDSHRFNRDHPPEHPIQDDSEWYIDDPSRVFANISFITKAGDLASLKKAIETGIPVDMKDNTYKTPLMIACASGNIDVVKFLIEKGANVNATDNFLWTPLHFACHAGQQDIVELLVKAGASIDATSINNSTPLSRAIESCRLDTVKYLLDMGAKFQIENRKGHAAMDIAKAYADYRIIDMIKEKLDNLPKQADNQKMKGKLPKLKTEGTDVKKEEETLSSIYTVPAITEEKKVHRDSVVYLNSLITSGFTKK--VDITFIPKRIWSPEATTAELIRKRELRRERFTYEVDFED-FMMPFQKNITEKAQA 768          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q6PFX9|TNKS1_MOUSE (Poly [ADP-ribose] polymerase tankyrase-1 OS=Mus musculus OX=10090 GN=Tnks PE=1 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.547e-22
Identity = 154/653 (23.58%), Postives = 256/653 (39.20%), Query Frame = 3
Query:  177 IRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNG---KTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKE------------------NEEICLILLK------HGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMK------EVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRP----IDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRD--RFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDL 2015
            +R++L+     D  ++K+LVD       N N  D      + L  A      D ++ LL +GA+    D  G   +  A  +GH      L   GAD    D N      +  +   +   C+   L++  D N  + DGK+ L  A    K                   NEE  + LL       H +D          TPL  A       I    L+ G D +  D+ G   +H A   G+++    L   GA  +  D  Q  P+H AA+      C  L   G +P + N +G+ A  +A     ++ +        +++  R    L K  +  AL + ++      E      +  L       +K+  +LL+R  A +NE+ +  + P     +    D  + L   K+  K+  + +       +              ++ C +  S+   P    + G     +   +  +  + +  SE+ P             D D   +   +A+K GDL+++K  L     V+ RD    + T L  AA Y  + +  +L+++GADV+AKD     PLH+A   G  ++ ELL+ +GA V+   L   TPL  A    ++ + + LLK GA    +N  G TPLDL
Sbjct:  176 LRELLEACRNGDVSRVKRLVDAA-----NVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARD-NWNYTPLHEAAIKGKIDVCI-VLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASD------GRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAARE-ADLAKVKKTLALEIINFKQPQSHETALHCAVASLHP----KRKQVAELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVL--HKHGAKMNALDSLGQTALHRAALAGH--------LQTCRLLLSYGSDPSIISLQG-----FTAAQMGNEAVQQILSESTP---------MRTSDVDYRLL---EASKAGDLETVK-QLCSPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDL 782          

HSP 2 Score: 85.8853 bits (211), Expect = 1.137e-15
Identity = 65/169 (38.46%), Postives = 87/169 (51.48%), Query Frame = 3
Query: 1581 IGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYK--TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPP 2081
            I D  R    + DAAK G L  ++  L     ++ RD   +  T L  AA Y NL++  +L+ +GADVNA+D     PLH+AA  G +DI  LLI     V+A      TPL  A +  R  +   LL  GA   M+N +G TPLDLA   AD    +I    +DA+PP
Sbjct:  790 IQDLLRGDAALLDAAKKGCLARVQ-KLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLA--TAD----DIRALLIDAMPP 951          

HSP 3 Score: 68.1662 bits (165), Expect = 3.427e-10
Identity = 40/105 (38.10%), Postives = 56/105 (53.33%), Query Frame = 3
Query: 1704 TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            T L  AA Y  + +   L+ +GADV+AKD     PLH+A   G  ++ ELL+ +GA V+A  L   TPL  A   +R  V   LL  GA   + N  G + +D+A
Sbjct:  364 TPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMA 468          

HSP 4 Score: 65.855 bits (159), Expect = 1.607e-9
Identity = 45/136 (33.09%), Postives = 73/136 (53.68%), Query Frame = 3
Query: 1617 DAAKHGDLDSIKLALKKGYKVDTRDRFYK--TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            +A ++GD+  +K  L     V+ +D   +  + L  AA +G  D+  HL+  GA+V+A+D+    PLH+A   G  ++V LL+  GA  +A+     TPL  A    + +V   LL+ GA   + N+ G + LDLA
Sbjct:  181 EACRNGDVSRVK-RLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLA 315          

HSP 5 Score: 62.3882 bits (150), Expect = 2.177e-8
Identity = 47/146 (32.19%), Postives = 76/146 (52.05%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGA-----VVDAK-ALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSR 2039
            AA  G  D ++  L+ G  V  RD      L +A  +G+ ++   L+  GAD NA+DN+++TPLH AA  G ID+  +L+ +GA       D K AL+ A P  +A+ +  +   E L    +  + +    LTPL++  + +D R
Sbjct:  216 AAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGR 361          

HSP 6 Score: 57.7658 bits (138), Expect = 5.519e-7
Identity = 75/311 (24.12%), Postives = 121/311 (38.91%), Query Frame = 3
Query:  186 VLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSE---NDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLIL--------------------------LKHGADPNIIQ----KATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKD 1016
            +LQ   E D  ++KK +      +IN+ +P + +T L  A +          + LL  GA+ +  + +  + + +AA+  H    E L K GA +   D  G+  L+   +    H +     L Y  D + +S  G    F A + G  NE +  IL                          +K    P  +     +    TPL  A      S+    L  G D +  D+ G   +H A   G+++    L   GA  +V D  +  P+H AAA G    CK L + G +P  KN +G     + K+
Sbjct:  486 LLQAAREADLAKVKKTL---ALEIINFKQPQSHETALHCAVASLHPKRKQVAELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDSLGQTALHR--AALAGHLQTCRLLLSYGSDPSIISLQG----FTAAQMG--NEAVQQILSESTPMRTSDVDYRLLEASKAGDLETVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKE 785          

HSP 7 Score: 56.225 bits (134), Expect = 1.403e-6
Identity = 61/254 (24.02%), Postives = 96/254 (37.80%), Query Frame = 3
Query:  288 TCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEI--------------CLILLKHGADPNIIQ----KATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGE 992
            T L  A   N +  +++LL  GA     D  G   +  A  YGH    E L + GA + + DL     L+   +  +   E  +  L++  D    ++DG T L    E   + +++              CL  ++    P  I     +    TPL  A    +  +    L+ G D N  D+ G   +H AA  G+      L  +    +  D     P+H AA  G    C  L   G +P +KN  G+
Sbjct:  679 TPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKY--EICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQ 930          

HSP 8 Score: 54.299 bits (129), Expect = 5.358e-6
Identity = 44/173 (25.43%), Postives = 75/173 (43.35%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALN----------------------GATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
             V +++A  +G  +  +L ++ G  V+  D +  T L  AA  G  ++C  L+ +GAD   K+    TPL      G  DI +LL  + A++DA                           +TPL  A   +   V E+LL+ GA +  ++  GL PL  A ++    +  ++
Sbjct:  711 LVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPL-DLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALL 882          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|O95271|TNKS1_HUMAN (Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 3.162e-22
Identity = 155/652 (23.77%), Postives = 255/652 (39.11%), Query Frame = 3
Query:  177 IRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNG---KTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKE------------------NEEICLILLK------HGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMK------EVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTF---VNMNDAAKHGDLDSIKLALKKGYKVDTRD--RFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDL 2015
            +R++L+     D  ++K+LVD       N N  D      + L  A      D ++ LL +GA+    D  G   +  A  +GH      L   GAD    D N      +  +   +   C+   L++  D N  + DGK+ L  A    K                   NEE  + LL       H +D          TPL  A       I    L+ G D +  D+ G   +H A   G+++    L   GA  +  D  Q  P+H AA+      C  L   G +P + N +G+ A  +A     ++ +        +++  R    L K  +  AL + ++      E      +  L       +K+  +LL+R  A +NE+ +  + P     +    D  + L   K+  K+  +         +              ++ C +  S+      G  P +          L  F++    +  ++   S     P RT      + +A+K GDL+++K  L     V+ RD    + T L  AA Y  + +  +L+++GADV+AKD     PLH+A   G  ++ ELL+ +GA V+   L   TPL  A    ++ + + LLK GA    +N  G TPLDL
Sbjct:  183 LRELLEACRNGDVSRVKRLVDAA-----NVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARD-NWNYTPLHEAAIKGKIDVCI-VLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASD------GRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAARE-ADLAKVKKTLALEIINFKQPQSHETALHCAVASLHP----KRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVL--HKHGAKMNALDTLGQTALHRAALAGH--------LQTCRLLLSY------GSDPSI--------ISLQGFTAAQMGNEAVQQILSE--STPIRTSDVDYRLLEASKAGDLETVK-QLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDL 789          

HSP 2 Score: 86.2705 bits (212), Expect = 9.778e-16
Identity = 67/169 (39.64%), Postives = 87/169 (51.48%), Query Frame = 3
Query: 1581 IGDPDRTFVNMNDAAKHGDLDSI-KLALKKGYKV-DTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPP 2081
            I D  R    + DAAK G L  + KL   +     DT+ R   T L  AA Y NL++  +L+ +GADVNA+D     PLH+AA  G +DI  LLI     V+A      TPL  A +  R  +   LL  GA   M+N +G TPLDLA   AD    +I    +DA+PP
Sbjct:  797 IQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGR-NSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLA--TAD----DIRALLIDAMPP 958          

HSP 3 Score: 68.1662 bits (165), Expect = 3.317e-10
Identity = 40/105 (38.10%), Postives = 56/105 (53.33%), Query Frame = 3
Query: 1704 TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            T L  AA Y  + +   L+ +GADV+AKD     PLH+A   G  ++ ELL+ +GA V+A  L   TPL  A   +R  V   LL  GA   + N  G + +D+A
Sbjct:  371 TPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMA 475          

HSP 4 Score: 65.855 bits (159), Expect = 1.569e-9
Identity = 45/136 (33.09%), Postives = 73/136 (53.68%), Query Frame = 3
Query: 1617 DAAKHGDLDSIKLALKKGYKVDTRDRFYK--TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            +A ++GD+  +K  L     V+ +D   +  + L  AA +G  D+  HL+  GA+V+A+D+    PLH+A   G  ++V LL+  GA  +A+     TPL  A    + +V   LL+ GA   + N+ G + LDLA
Sbjct:  188 EACRNGDVSRVK-RLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLA 322          

HSP 5 Score: 62.3882 bits (150), Expect = 2.125e-8
Identity = 47/146 (32.19%), Postives = 76/146 (52.05%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGA-----VVDAK-ALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSR 2039
            AA  G  D ++  L+ G  V  RD      L +A  +G+ ++   L+  GAD NA+DN+++TPLH AA  G ID+  +L+ +GA       D K AL+ A P  +A+ +  +   E L    +  + +    LTPL++  + +D R
Sbjct:  223 AAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGR 368          

HSP 6 Score: 57.3806 bits (137), Expect = 6.658e-7
Identity = 76/311 (24.44%), Postives = 122/311 (39.23%), Query Frame = 3
Query:  186 VLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSE---NDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILL------------------KHGADPNIIQKATGK------------TPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKD 1016
            +LQ   E D  ++KK +      +IN+ +P + +T L  A +          + LL  GA+ +  + +  + + +AA+  H    E L K GA +   D  G+  L+   +    H +     L Y  D + +S  G    F A + G  NE +  IL                   K G    + Q  + +            TPL  A      S+    L  G D +  D+ G   +H A   G+++    L   GA  +V D  +  P+H AAA G    CK L + G +P  KN +G     + K+
Sbjct:  493 LLQAAREADLAKVKKTL---ALEIINFKQPQSHETALHCAVASLHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHR--AALAGHLQTCRLLLSYGSDPSIISLQG----FTAAQMG--NEAVQQILSESTPIRTSDVDYRLLEASKAGDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKE 792          

HSP 7 Score: 56.225 bits (134), Expect = 1.529e-6
Identity = 68/292 (23.29%), Postives = 111/292 (38.01%), Query Frame = 3
Query:  183 KVLQCTYEKDYDQIKKLVDNGVEHLINYNEPD---NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEI--------------CLILLKHGADPNIIQ----KATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGE 992
            ++L+ +   D + +K+L  +      N N  D      T L  A   N +  +++LL  GA     D  G   +  A  YGH    E L + GA + + DL     L+   +  +   E  +  L++  D    ++DG T L    E   + +++              CL  ++    P  I     +    TPL  A    +  +    L+ G D N  D+ G   +H AA  G+      L  +    +  D     P+H AA  G    C  L   G +P +KN  G+
Sbjct:  653 RLLEASKAGDLETVKQLCSSQ-----NVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKY--EICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQ 937          

HSP 8 Score: 54.299 bits (129), Expect = 5.596e-6
Identity = 44/173 (25.43%), Postives = 75/173 (43.35%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALN----------------------GATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
             V +++A  +G  +  +L ++ G  V+  D +  T L  AA  G  ++C  L+ +GAD   K+    TPL      G  DI +LL  + A++DA                           +TPL  A   +   V E+LL+ GA +  ++  GL PL  A ++    +  ++
Sbjct:  718 LVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPL-DLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALL 889          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 7.120e-22
Identity = 141/616 (22.89%), Postives = 238/616 (38.64%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELK--LLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFL---------TGKKYVNKLYLMSAF-----EXXXXXXXXXXXXXXXXXXIPIEICVMPESH--IMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPD----RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIK 2057
            N  T L +A+   + + +K LLD GA  D    +G + +   A+ GH    E L    A +     NG + L+        H  C++  L++NV +++V+ D  T L  A   G  + ++  +LL   A PN                       +K L           +G T +H A K    + +  L   GA      ++   PIH AA  GH +    L   G +P   N  GE A  +A    A+    EV++                     + V++  ++  + K     L  S  + K + V  L++  A  N        P     ++G  D A FL         T KK    L++ + +          +K        +    P+ +    ++    +  +D G       K  Y T L+  + +N    +I      Y  D +    +   +++ AA+ G +D + L L +   V+  ++   T L  AA    +++   L+N GA V+A+    +TPLH   H G I IV  L+ + A V+AK  NG T L +A +    +++  LL+  A        G T L +A       V++ +K
Sbjct:  250 NDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQ--GDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCG--HYKVAKVLLDKKASPN-----------------------AKAL-----------NGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMA----ARSGQAEVVR---------------------YLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGY-TPLHIAAKKN--QMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 2 Score: 81.6481 bits (200), Expect = 2.426e-14
Identity = 49/133 (36.84%), Postives = 70/133 (52.63%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            AA+  D  +  L L+     D   +   T L  AAHYGN+++   L+N  A V+       TPLH A+  G  ++V+LL++ GA +DAK  +G TPL     S    VVE LL + A I  +   GL+PL +A
Sbjct:  192 AARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMA 324          

HSP 3 Score: 80.1073 bits (196), Expect = 8.808e-14
Identity = 53/160 (33.12%), Postives = 77/160 (48.12%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKG 2099
            AA  G ++ +   +  G   +T +   +TAL  AA  G  ++  +L+  GA V AK     TPLH +A  G  DIV+ L+  GA  +A   +G TPL  A      +V  FLL  GA + +   KG TPL +A  +    V +++  K  A P    K G
Sbjct:  423 AAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQK-SASPDAAGKSG 581          

HSP 4 Score: 79.337 bits (194), Expect = 1.358e-13
Identity = 46/145 (31.72%), Postives = 80/145 (55.17%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA+ G L+     +K G  V+  ++    AL  A+  G++++   L+   A+V+A      T LH A+ +G  ++V++L+ NGA V+A++ NG TPL+ A + +   VV FLL  GA   +    G TPL +A      +V++++
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLL 175          

HSP 5 Score: 78.1814 bits (191), Expect = 3.039e-13
Identity = 52/162 (32.10%), Postives = 77/162 (47.53%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII---KAKVDA 2072
            + F  ++ AAK+G L+   L L+K    D   +   T L  AAHY N  + + L++ GA  +A     +TPLH AA    +DI   L+  GA  +A    G   +  A +    ++V  LL + A + + N  GLTPL LA       V  ++    A VDA
Sbjct:  547 KGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDA 708          

HSP 6 Score: 74.7146 bits (182), Expect = 3.770e-12
Identity = 46/151 (30.46%), Postives = 76/151 (50.33%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            F  ++ AA +G+++   L L +   VD   R   T L  A+  GN +M   L++ GA ++AK     TPLH  A SG   +VE+L++  A + +K  NG +PL  A +    N V+ LL+    +    +  LT L +A +    +V  ++
Sbjct:  219 FTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVL 369          

HSP 7 Score: 74.3294 bits (181), Expect = 4.354e-12
Identity = 66/234 (28.21%), Postives = 106/234 (45.30%), Query Frame = 3
Query:  222 IKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGH--VASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA 917
            ++ LV +G +  +     D+ +T L I+      D ++ LL  GA P+     G + + +AA+ GH  VA+F  L   GA L +    G   L+  V+      E     L+ +   +   K G T L  A     +N+++ L+LL  GA P+   K  G TPL  A       I +  L+ G D N   R G  +VH AA+ G+   +  L +  A  ++ + +   P+H AA
Sbjct:  465 VRYLVQDGAQ--VEAKAKDD-QTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAF--LLDHGASLSITTKKGFTPLH--VAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAH--YDNQKVALLLLDQGASPHAAAK-NGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAA 688          

HSP 8 Score: 73.1738 bits (178), Expect = 1.125e-11
Identity = 56/170 (32.94%), Postives = 80/170 (47.06%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLI--NYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRG 2105
            F  +  A + G    + L L+     DT+ +    AL  AA   +      L+  +  ADV +K  F  TPLH AAH G I++  LL+N  A VD  A N  TPL  A +    N+V+ LL +GAKI  +   GLTPL         +V+ ++   +D   P+  K   G
Sbjct:  157 FTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGF--TPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEML---LDRSAPILSKTKNG 317          

HSP 9 Score: 71.2478 bits (173), Expect = 4.150e-11
Identity = 53/162 (32.72%), Postives = 76/162 (46.91%), Query Frame = 3
Query: 1623 AKHGD-LDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII---------KAKVDALP 2078
            A  GD L+ ++L L+    VD     Y TAL  AAH G+  +   L++  A  NAK    +TPLH A     I ++ELL+ +GA + A   +G TP+  A      N+V  L+  GA     N +G T L +A     + V+  +         KAK D  P
Sbjct:  324 ATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTP 485          

HSP 10 Score: 63.1586 bits (152), Expect = 1.241e-8
Identity = 74/250 (29.60%), Postives = 107/250 (42.80%), Query Frame = 3
Query:  222 IKKLVDNGVEHLINYN-EPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNN--VSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQN--NPIHYAAAG-HASCCKFLGQ 953
            +K LV NG     N N +  NG T L +A  EN L+ ++FLLD GA   +   +G + + +A Q GH      L +       ND  GK V    +    R  +    AL    D N    SK G T L  A   G  N  +  +LL   A  +   +    TPL  A   G+ ++    L  G   +   R G T +H  A+SG+ + +  L    A   +   T+N  +P+H A  G H +C + L Q
Sbjct:  106 VKVLVTNGA----NVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGK-VRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNIN--VATLLLNRAAAVDFTAR-NDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSA--PILSKTKNGLSPLHMATQGDHLNCVQLLLQ 338          

HSP 11 Score: 63.1586 bits (152), Expect = 1.398e-8
Identity = 65/265 (24.53%), Postives = 104/265 (39.25%), Query Frame = 3
Query:  231 LVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKG 1022
            L+D+G    I   +   G T L +A     L+    LL   A PD     G + + +AA Y +      L   GA       NG   L+  ++  +   +   + L Y  D N V++ G   +  A ++G  + ++  +LL   A+ N+  K +G TPL  A      ++    +  G   +   + G T +H     GN K +  L    A+ +         +H AA  GH      L Q   +P     NG  A  IA+  G
Sbjct:  534 LLDHGASLSITTKK---GFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLH--IAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEG--HVDMVSLLLSRNANVNLSNK-SGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLG 790          

HSP 12 Score: 62.3882 bits (150), Expect = 1.961e-8
Identity = 46/181 (25.41%), Postives = 81/181 (44.75%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLK---------------------KGAKIQMEN--------SKGLTPLDLAYNWADSRVINIIKAKVDAL 2075
            A+K G ++ +   L++   VD   +   TAL  A+  G  ++   L+  GA+VNA+    +TPL+ AA    +++V  L++NGA       +G TPL  A++     VV  LL+                     K A + ++N          G TPL +A ++ +  V  ++  +  A+
Sbjct:   64 ASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAV 244          

HSP 13 Score: 56.225 bits (134), Expect = 1.508e-6
Identity = 37/119 (31.09%), Postives = 57/119 (47.90%), Query Frame = 3
Query: 1662 KKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            +KG K D    + +     AA  G+L+  +  I  G DVN  +      LH A+  G +++V  L+   A VDA    G T L  A  + +  VV+ L+  GA +  ++  G TPL +A
Sbjct:   17 RKGKKSDANASYLR-----AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMA 130          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. TrEMBL
Match: A0A1S3J7J3 (ankyrin repeat and EF-hand domain-containing protein 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106170893 PE=4 SV=1)

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 401/784 (51.15%), Postives = 527/784 (67.22%), Query Frame = 3
Query:  141 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVS-PTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIE-KKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFE-XXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALP-PVKDKKGRGNQKSGRTSSKGRRTAS------------PTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKASGLED 2444
            MPIAQ+RLE+LQ+ K+LQC  E D  QI+KL  NG+ HL+NYN+P  G T L+IA   N+ + IKFLL+LGAHPDV+DF+G+SA+M AA+YGHV   E+LAK GAD+KL DL GK +L+Y +S PT+RH  CLE AL Y  D+NN+SKDGK V   ACE   ENE++CL LL+ GADPN +Q+  GKT LMAAC SGS  + S  L  G D N  DRH  TA+H AAK G F+ L  L A+ ++FDV DD  N P+H+AA GHA CC+FL QRG NPK+KN+ G   + IAKD G KDC KE+ K E+SFGK GKNN+PWA+ LYDW+     EIVE ++  D + SG V K +F++ L    APL +E E KK+    DKNKD T DY DFLTGKKY+NKLYLMSAFE GKKKKKK G KGK  K+KIP+ ICV PE    R   GGPP ++IPK  + TD  RF  + PP + ++DD +WY+  PD+T+VN+N+AAK+GDLD+++ A  KG  VDTRD+++KT LM+A  +GN+++ + L++ GAD+NA+DNF WTPLHHA H+G +D+VE L++ GA +DA  +NG TPL RAIESS+  +V+FL+ +GAKIQ EN KG  PLDLA  WAD RV++ ++ K D+LP P   K      K G+ S   +R AS            P +     P      + + ++ RA + L+      + EDI++ P      +   E L+  +  RRQR+GWE+DF D F+  F KN++ +    G ED
Sbjct:    1 MPIAQNRLEVLQVCKLLQCVREGDKVQIEKLTLNGIPHLVNYNDPSEGDTALAIAACANNDEMIKFLLELGAHPDVMDFKGRSAVMRAAEYGHVQCMENLAKEGADMKLKDLEGKGILFYVISAPTQRHSRCLEIALEYGADVNNMSKDGKPVFLVACETAAENEDMCLKLLEKGADPNAVQEKEGKTALMAACGSGSVKVVSAILAKGGDVNARDRHRSTALHQAAKGGFFEVLQVLSAYASEFDVVDDKGNTPVHFAADGHAMCCRFLIQRGSNPKLKNNEGVLPKAIAKDNGHKDCGKELRKGEKSFGKTGKNNDPWAIQLYDWSFSRQKEIVEMMQKFDPDISGFVQKDDFIECLQNSGAPLPDEAELKKLTLAHDKNKDNTVDYNDFLTGKKYINKLYLMSAFEGGKKKKKKGGKKGKKGKTKIPMPICVQPEGP--RTAGGGPPEVFIPKNIHFTDNTRFDRDKPPEHPLQDDSAWYLHLPDKTYVNVNEAAKYGDLDTLRNAFSKGSPVDTRDKYFKTPLMTACSHGNMEVAIFLLDQGADINARDNFKWTPLHHACHAGQLDLVEYLLSRGAELDATTMNGGTPLTRAIESSKVELVKFLIDRGAKIQTENKKGQNPLDLAMAWADLRVLDTVQTKWDSLPAPSDKKGKGKGGKGGKKSPPPKRAASAPADKEGDIKFPPVQQRATTPSDEPIRHRKGSILRAASALAGGII--ETEDITYVPLKTWTPQKKTEELIHEKEVRRQRYGWEVDFED-FEMPFLKNISHKCAIFGDED 779          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. TrEMBL
Match: A0A1S3J7U6 (ankyrin repeat and EF-hand domain-containing protein 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106170893 PE=4 SV=1)

HSP 1 Score: 723.391 bits (1866), Expect = 0.000e+0
Identity = 366/653 (56.05%), Postives = 471/653 (72.13%), Query Frame = 3
Query:  141 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVS-PTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIE-KKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFE-XXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKD 2090
            MPIAQ+RLE+LQ+ K+LQC  E D  QI+KL  NG+ HL+NYN+P  G T L+IA   N+ + IKFLL+LGAHPDV+DF+G+SA+M AA+YGHV   E+LAK GAD+KL DL GK +L+Y +S PT+RH  CLE AL Y  D+NN+SKDGK V   ACE   ENE++CL LL+ GADPN +Q+  GKT LMAAC SGS  + S  L  G D N  DRH  TA+H AAK G F+ L  L A+ ++FDV DD  N P+H+AA GHA CC+FL QRG NPK+KN+ G   + IAKD G KDC KE+ K E+SFGK GKNN+PWA+ LYDW+     EIVE ++  D + SG V K +F++ L    APL +E E KK+    DKNKD T DY DFLTGKKY+NKLYLMSAFE GKKKKKK G KGK  K+KIP+ ICV PE    R   GGPP ++IPK  + TD  RF  + PP + ++DD +WY+  PD+T+VN+N+AAK+GDLD+++ A  KG  VDTRD+++KT LM+A  +GN+++ + L++ GAD+NA+DNF WTPLHHA H+G +D+VE L++ GA +DA  +NG TPL RAIESS+  +V+FL+ +GAKIQ EN KG  PLDLA  WAD RV++ ++ K D+LP   D
Sbjct:    1 MPIAQNRLEVLQVCKLLQCVREGDKVQIEKLTLNGIPHLVNYNDPSEGDTALAIAACANNDEMIKFLLELGAHPDVMDFKGRSAVMRAAEYGHVQCMENLAKEGADMKLKDLEGKGILFYVISAPTQRHSRCLEIALEYGADVNNMSKDGKPVFLVACETAAENEDMCLKLLEKGADPNAVQEKEGKTALMAACGSGSVKVVSAILAKGGDVNARDRHRSTALHQAAKGGFFEVLQVLSAYASEFDVVDDKGNTPVHFAADGHAMCCRFLIQRGSNPKLKNNEGVLPKAIAKDNGHKDCGKELRKGEKSFGKTGKNNDPWAIQLYDWSFSRQKEIVEMMQKFDPDISGFVQKDDFIECLQNSGAPLPDEAELKKLTLAHDKNKDNTVDYNDFLTGKKYINKLYLMSAFEGGKKKKKKGGKKGKKGKTKIPMPICVQPEGP--RTAGGGPPEVFIPKNIHFTDNTRFDRDKPPEHPLQDDSAWYLHLPDKTYVNVNEAAKYGDLDTLRNAFSKGSPVDTRDKYFKTPLMTACSHGNMEVAIFLLDQGADINARDNFKWTPLHHACHAGQLDLVEYLLSRGAELDATTMNGGTPLTRAIESSKVELVKFLIDRGAKIQTENKKGQNPLDLAMAWADLRVLDTVQTKWDSLPAPSD 651          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. TrEMBL
Match: A0A1I8JDQ0 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 371/799 (46.43%), Postives = 509/799 (63.70%), Query Frame = 3
Query:  141 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLL-DLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG-HASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKL-LDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFE--XXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTSSK-------------------------GRRTASPTKXXXXXXXXXXRSYSELALKRANNLL----SYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKASG 2435
            MPIA+ R++ LQI K++QC  +++ DQI+KLV +G+  L+NY EP +G+T L +A  END D ++FL+ ++GA PD  D  G +  M AA+ G V + E+LAKAGAD+K  D +GKNVL+YC+ PTERH +C++ AL++  D+N+ + DG+T  F ACE   +N   C  LL HGA+P+++Q+A+ +TPLMAACASGS  +    L  G DPN  D+   TA HYAAK G+   LVAL  +GA FD YD  Q NP+H AAA   A C KFLGQRGCNPK KN++GE  R IAKDKG K+C+KE+ KVE+S+G+ G+N E WAL LYDWTV    ++   L+   D   SG V  ++    ++ L AP  E+  KK+ P +DK K+G+FDY DFL  KKY+NKLYLMSA+E   KK K KKG  G+ +K+K P EICVMP+  ++R  +GGPP+M++P+    TD  RF  + PP + ++DD +WY+  P  TFVN+NDAAKHGDLDSIKLAL+KGY  +TRDR +KT LM AAHYGN+++   L+  GADVNA+DNF WTPLHHA H+G+ID+VELL+ NGA ++A ALNGATPL RAIE+S  N+VEFLLK+GAK  +E   G    ++   W  + VI+ I+ K     P++  K    + S                               G R  + +      P P      E  ++R   +L    +     E+ ED++  P+   + +P   SLL  +   RQRFGWE DFPD +++ F +N+  +++  G
Sbjct:    1 MPIARERIDSLQICKLIQCVRDRNRDQIRKLVASGIPQLVNYGEPQDGETPLIVAAKENDEDMVEFLIKEMGALPDFGDRGGVTPAMRAAEQGFVQALEALAKAGADMKARDSSGKNVLFYCIQPTERHAQCMQVALKHEADVNSAANDGRTAFFVACETADKNPACCRALLAHGANPDVVQRASNRTPLMAACASGSAEVALAALMGGADPNRVDKQSWTAAHYAAKGGHLSCLVALSGYGANFDAYDLRQCNPVHEAAAADRALCIKFLGQRGCNPKPKNADGETPRVIAKDKGFKECLKELRKVEKSYGRAGRNCERWALALYDWTVVRGADLQARLQAEFDTSGSGQVTLEDAAQTMLALGAPWTEDCAKKLGPLYDKAKNGSFDYRDFLLAKKYINKLYLMSAYEPKQKKGKGKKGKGGRKKKAKYPFEICVMPDEQMLRTAEGGPPIMFVPQVSNVTDAERFDRDRPPAHPLQDDSAWYVAAPAHTFVNINDAAKHGDLDSIKLALQKGYSTETRDRLFKTPLMVAAHYGNMEVAKFLLEAGADVNARDNFKWTPLHHACHAGLIDMVELLLKNGANIEAVALNGATPLLRAIETSNLNLVEFLLKQGAKASIETKTGEMIHEVVQIWGSAEVIDFIRTKF----PIEAAKDGKGKGSKGGGKGGGKKGAAGGGKKSAKGKGSAKGSEGGARRLADSIVQAPAPAPRIEDEEEAHIRRKARILHDANALDGGYEEAEDVTAHPKGHWLEQPDTGSLLASKSRYRQRFGWESDFPD-YRNPFQRNIWNKLEVEG 794          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. TrEMBL
Match: A0A267GTK0 (ANK_REP_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028661g2 PE=4 SV=1)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 371/799 (46.43%), Postives = 509/799 (63.70%), Query Frame = 3
Query:  141 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLL-DLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG-HASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKL-LDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFE--XXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTSSK-------------------------GRRTASPTKXXXXXXXXXXRSYSELALKRANNLL----SYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKASG 2435
            MPIA+ R++ LQI K++QC  +++ DQI+KLV +G+  L+NY EP +G+T L +A  END D ++FL+ ++GA PD  D  G +  M AA+ G V + E+LAKAGAD+K  D +GKNVL+YC+ PTERH +C++ AL++  D+N+ + DG+T  F ACE   +N   C  LL HGA+P+++Q+A+ +TPLMAACASGS  +    L  G DPN  D+   TA HYAAK G+   LVAL  +GA FD YD  Q NP+H AAA   A C KFLGQRGCNPK KN++GE  R IAKDKG K+C+KE+ KVE+S+G+ G+N E WAL LYDWTV    ++   L+   D   SG V  ++    ++ L AP  E+  KK+ P +DK K+G+FDY DFL  KKY+NKLYLMSA+E   KK K KKG  G+ +K+K P EICVMP+  ++R  +GGPP+M++P+    TD  RF  + PP + ++DD +WY+  P  TFVN+NDAAKHGDLDSIKLAL+KGY  +TRDR +KT LM AAHYGN+++   L+  GADVNA+DNF WTPLHHA H+G+ID+VELL+ NGA ++A ALNGATPL RAIE+S  N+VEFLLK+GAK  +E   G    ++   W  + VI+ I+ K     P++  K    + S                               G R  + +      P P      E  ++R   +L    +     E+ ED++  P+   + +P   SLL  +   RQRFGWE DFPD +++ F +N+  +++  G
Sbjct:    2 MPIARERIDSLQICKLIQCVRDRNRDQIRKLVASGIPQLVNYGEPQDGETPLIVAAKENDEDMVEFLIKEMGALPDFGDRGGVTPAMRAAEQGFVQALEALAKAGADMKARDSSGKNVLFYCIQPTERHAQCMQVALKHEADVNSAANDGRTAFFVACETADKNPACCRALLAHGANPDVVQRASNRTPLMAACASGSAEVALAALMGGADPNRVDKQSWTAAHYAAKGGHLSCLVALSGYGANFDAYDLRQCNPVHEAAAADRALCIKFLGQRGCNPKPKNADGETPRVIAKDKGFKECLKELRKVEKSYGRAGRNCERWALALYDWTVVRGADLQARLQAEFDTSGSGQVTLEDAAQTMLALGAPWTEDCAKKLGPLYDKAKNGSFDYRDFLLAKKYINKLYLMSAYEPKEKKGKGKKGKGGRKKKAKYPFEICVMPDEQMLRTAEGGPPIMFVPQVSNVTDAERFDRDRPPAHPLQDDSAWYVAAPAHTFVNINDAAKHGDLDSIKLALQKGYSTETRDRLFKTPLMVAAHYGNMEVAKFLLEAGADVNARDNFKWTPLHHACHAGLIDMVELLLKNGANIEAVALNGATPLLRAIETSNLNLVEFLLKQGAKASIETKTGEMIHEVVQIWGSAEVIDFIRTKF----PIEAAKDGKGKGSKGGGKGGGKKGAAGGGKKSAKGKGSAKGSEGGARRLADSIVQAPAPAPRIEDEEEAHIRRKARILHDANALDGGYEEAEDVTAHPKGHWLEQPDTGSLLASKSRYRQRFGWESDFPD-YRNPFQRNIWNKLEVEG 795          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. TrEMBL
Match: A0A210QF97 (Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10323 PE=4 SV=1)

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 373/776 (48.07%), Postives = 507/776 (65.34%), Query Frame = 3
Query:  141 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELAL---KRANNLL----SYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKASGLED 2444
            MP+AQ+RLE LQ+ K+LQC   K+ +QI+K+  NG+ HLINYN+   G T L +A + ND + I+FLL+LGAHPDV DF+G++A M AA++GHV   E L KAGAD+K  DL GK +L+YC+SPTERH +CLE A+    + NN+S+DG  V   ACE   ENE+ CL+LL+ G+DPN  Q+ TGKT LMAA  SGS  +    L+ G D N  D     A HYAA +G F+ L  + A+GA FD  ++  N PIH AA  GHA CCKFL QRGCNPK KN++GE A+++AK+K  K+  KE+ K E++FGK+GKNNEPWA+ LYDW +E   +I+   K  D +  G V K EF D L+ + AP  E    K++   DK +DG  DY DFLTGKK++NK YLMSAFEGKKKKKKKGGKGK +K K  + + +       R   G PP M+I +  + TD  RF  + PP + ++DD +WY+  P++ ++N+NDA K+GD DS+K A +KG  VDTRD++YKT LM A   GN+DM   L+  GA +NA+DNF WTPLHHA HSG +D+V  L++NGA ++A  +NG TPL RAIESSR  +V +L+ +GAK+Q EN KG +PLDLA +WAD RV+N ++A+ D LP    K     +  G   S  R T+ P    ++   P   S S   L   +R  ++L    + +S  ++ EDI++ P      +P  + L+Q +  RR R+GWE+DFPD F+  F KN+T++  A G +D
Sbjct:    1 MPVAQTRLETLQVCKLLQCVRMKEKNQIEKMTVNGIPHLINYNDASEGLTALGVAAAANDDEMIEFLLELGAHPDVPDFKGRTAAMRAAEFGHVQCLEKLTKAGADMKSIDLEGKGILFYCISPTERHAKCLELAVVNGAESNNMSRDGIPVFMFACETAAENEDACLLLLEKGSDPNGKQEKTGKTCLMAASLSGSVKVVRAILEAGGDVNVLDIQHTHAAHYAALTGGFEVLACMSAYGAVFDQCNNKGNTPIHNAALNGHAMCCKFLWQRGCNPKPKNNDGETAKSLAKEKDQKEAGKELRKAEKAFGKVGKNNEPWAIVLYDWVMEQSQKILNAYKRFDPDEKGTVQKDEFSDTLVGMSAPAEEADIAKVMTLHDKARDGNIDYNDFLTGKKWMNKNYLMSAFEGKKKKKKKGGKGKGKKGKFKLAMPICTSEEGPRTYGGAPPEMFIERHIHFTDTGRFDRDRPPKHPLQDDSAWYLQHPEKMYININDATKNGDFDSLKGAFQKGTPVDTRDKYYKTPLMVACSIGNIDMVKFLLENGAYINARDNFKWTPLHHACHSGQLDVVSFLLDNGAELEAHTMNGGTPLTRAIESSREGLVTYLVDRGAKLQTENKKGHSPLDLANSWADPRVLNFMQARCDGLPAGDKKGKGKGKGKGGQKS-ARPTSVPPPADKENTGPIPFSASGEDLPSRQRKGSILRAASALASGVDEEEDITYIPLKAWTKQPTSQELIQEKRVRRDRYGWEVDFPD-FEMPFMKNVTKKNVAMGDDD 774          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Cavefish
Match: ankef1a (ankyrin repeat and EF-hand domain-containing protein 1-like [Source:NCBI gene;Acc:103043611])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 323/776 (41.62%), Postives = 460/776 (59.28%), Query Frame = 3
Query:  147 IAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKL----GKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIV-----NKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFE-XXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGR------TSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERV 2423
            +A  RLE LQI ++LQ   E +  QI++LV+ GV+ LIN  EP  GK  L +A+  ND D ++FL+  GA PDV D  G++ +M+AA+ GH      LAK  AD+KL D+ GK VL+YCV PT+RH  CL+ AL    D+NNVS+ G  +L  ACE+  E E +CL LL+ GADPN   + TG T LM A  +G+  +    LK G + N +D     AVH+AA+ G F+ +  L A+ A         N  +HYAA  G A+CC+FL QRGCN K+KN  G   R IAKD G K  +KE+ + ER  GK     G  NEPWAL L+DW+ E+  ++    K  D  + GIV     +++ FV +L  LKAP+ +E  ++IL   D+ ++G  +  DFL G +Y+ K ++M+++E  KKK+  KGGK K  K  +P+ IC +P   + R  DGGPP   I      TD NRF  ++PP + +EDD +WY+ DP + +VN++   K GD+ S+KLA  +   VD +D++YKT LM+A   GN ++   L++ GADVNA+D F WTPLHHA H+G +DI+ELL+  GA VDA AL+GATPL RAIES R   V++LLK GA + +EN      LD+A  +AD R++ +I+AK+++L   +DKK +  +   R       SSK ++ AS T       +      +++     N +           DISF PR +   +     L++ + ERRQRF  E+DF D F+  F+KNL ++ 
Sbjct:    5 VADGRLEELQIYRLLQYVQESNKGQIERLVNMGVDDLINLTEPLEGKGVLYLASVANDTDMVEFLIGQGARPDVQDKRGRTPVMLAAELGHDGVVSLLAKKNADMKLVDVEGKGVLFYCVFPTKRHMRCLQAALNSMADVNNVSQAGVPLLMQACENALECEGMCLSLLERGADPNATNQVTGCTALMEAVKAGAVGLVRAILKRGANVNASDTKNFQAVHFAAELGYFEIIRVLSAYAADMGGITAEGNTALHYAAHGGFANCCRFLAQRGCNLKLKNLEGLLPRQIAKDLGHKASLKELKRAERLHGKFSKGSGGTNEPWALTLHDWSHEHEADL---RKAFDSASDGIVGIEVVSRQTFVSVLRGLKAPVEDEHIQRILIAHDRRREGLINIIDFLKGFRYLPKSFVMASYEPRKKKRAAKGGKTKKIKLNLPLPICTVPPELLYRRDDGGPPHFMIENYHLITDPNRFDRDHPPGHPVEDDSAWYVDDPGKVYVNISYCVKTGDIASLKLAFSQKVPVDVKDQYYKTPLMTACGSGNYEVAKFLLDLGADVNARDQFSWTPLHHACHAGQLDIIELLVEAGAAVDAPALSGATPLMRAIESCRPCCVDYLLKAGATVTVENKTEQNCLDIARAYADQRIVELIQAKMNSLYKARDKKDKAAKPQTRPRPLTSMSSKEKQGASSTAKTTVKADSVILHSTQITSGTLNKV-----------DISFQPRTVWGKQLTTRQLMEKKEERRQRFTSEVDFED-FRMPFNKNLRKKT 765          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Cavefish
Match: ankef1a (ankyrin repeat and EF-hand domain-containing protein 1-like [Source:NCBI gene;Acc:103043611])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 323/776 (41.62%), Postives = 460/776 (59.28%), Query Frame = 3
Query:  147 IAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKL----GKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIV-----NKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFE-XXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGR------TSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERV 2423
            +A  RLE LQI ++LQ   E +  QI++LV+ GV+ LIN  EP  GK  L +A+  ND D ++FL+  GA PDV D  G++ +M+AA+ GH      LAK  AD+KL D+ GK VL+YCV PT+RH  CL+ AL    D+NNVS+ G  +L  ACE+  E E +CL LL+ GADPN   + TG T LM A  +G+  +    LK G + N +D     AVH+AA+ G F+ +  L A+ A         N  +HYAA  G A+CC+FL QRGCN K+KN  G   R IAKD G K  +KE+ + ER  GK     G  NEPWAL L+DW+ E+  ++    K  D  + GIV     +++ FV +L  LKAP+ +E  ++IL   D+ ++G  +  DFL G +Y+ K ++M+++E  KKK+  KGGK K  K  +P+ IC +P   + R  DGGPP   I      TD NRF  ++PP + +EDD +WY+ DP + +VN++   K GD+ S+KLA  +   VD +D++YKT LM+A   GN ++   L++ GADVNA+D F WTPLHHA H+G +DI+ELL+  GA VDA AL+GATPL RAIES R   V++LLK GA + +EN      LD+A  +AD R++ +I+AK+++L   +DKK +  +   R       SSK ++ AS T       +      +++     N +           DISF PR +   +     L++ + ERRQRF  E+DF D F+  F+KNL ++ 
Sbjct:    5 VADGRLEELQIYRLLQYVQESNKGQIERLVNMGVDDLINLTEPLEGKGVLYLASVANDTDMVEFLIGQGARPDVQDKRGRTPVMLAAELGHDGVVSLLAKKNADMKLVDVEGKGVLFYCVFPTKRHMRCLQAALNSMADVNNVSQAGVPLLMQACENALECEGMCLSLLERGADPNATNQVTGCTALMEAVKAGAVGLVRAILKRGANVNASDTKNFQAVHFAAELGYFEIIRVLSAYAADMGGITAEGNTALHYAAHGGFANCCRFLAQRGCNLKLKNLEGLLPRQIAKDLGHKASLKELKRAERLHGKFSKGSGGTNEPWALTLHDWSHEHEADL---RKAFDSASDGIVGIEVVSRQTFVSVLRGLKAPVEDEHIQRILIAHDRRREGLINIIDFLKGFRYLPKSFVMASYEPRKKKRAAKGGKTKKIKLNLPLPICTVPPELLYRRDDGGPPHFMIENYHLITDPNRFDRDHPPGHPVEDDSAWYVDDPGKVYVNISYCVKTGDIASLKLAFSQKVPVDVKDQYYKTPLMTACGSGNYEVAKFLLDLGADVNARDQFSWTPLHHACHAGQLDIIELLVEAGAAVDAPALSGATPLMRAIESCRPCCVDYLLKAGATVTVENKTEQNCLDIARAYADQRIVELIQAKMNSLYKARDKKDKAAKPQTRPRPLTSMSSKEKQGASSTAKTTVKADSVILHSTQITSGTLNKV-----------DISFQPRTVWGKQLTTRQLMEKKEERRQRFTSEVDFED-FRMPFNKNLRKKT 765          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Cavefish
Match: ankef1a (ankyrin repeat and EF-hand domain-containing protein 1-like [Source:NCBI gene;Acc:103043611])

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 320/770 (41.56%), Postives = 448/770 (58.18%), Query Frame = 3
Query:  147 IAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKL----GKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIV-----NKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFE-XXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERV 2423
            +A  RLE LQI ++LQ   E +  QI++LV+ GV+ LIN  EP  GK  L +A+  ND D ++FL+  GA PDV D  G++ +M+AA+ GH      LAK  AD+KL D+ GK VL+YCV PT+RH  CL+ AL    D+NNVS+ G  +L  ACE+  E E +CL LL+ GADPN   + TG T LM A  +G+  +    LK G + N +D     AVH+AA+ G F+ +  L A+ A         N  +HYAA  G A+CC+FL QRGCN K+KN  G   R IAKD G K  +KE+ + ER  GK     G  NEPWAL L+DW+ E+  ++    K  D  + GIV     +++ FV +L  LKAP+ +E  ++IL   D+ ++G  +  DFL G +Y+ K ++M+++E  KKK+  KGGK K  K  +P+ IC +P   + R  DGGPP   I      TD NRF  ++PP + +EDD +WY+ DP + +VN++   K GD+ S+KLA  +   VD +D++YKT LM+A   GN ++   L++ GADVNA+D F WTPLHHA H+G +DI+ELL+  GA VDA AL+GATPL RAIES R   V++LLK GA + +EN      LD+A  +AD R++ +I+AK+++L   +DKK +               A P                     R   L S SSK E +     T R           L++ + ERRQRF  E+DF D F+  F+KNL ++ 
Sbjct:    5 VADGRLEELQIYRLLQYVQESNKGQIERLVNMGVDDLINLTEPLEGKGVLYLASVANDTDMVEFLIGQGARPDVQDKRGRTPVMLAAELGHDGVVSLLAKKNADMKLVDVEGKGVLFYCVFPTKRHMRCLQAALNSMADVNNVSQAGVPLLMQACENALECEGMCLSLLERGADPNATNQVTGCTALMEAVKAGAVGLVRAILKRGANVNASDTKNFQAVHFAAELGYFEIIRVLSAYAADMGGITAEGNTALHYAAHGGFANCCRFLAQRGCNLKLKNLEGLLPRQIAKDLGHKASLKELKRAERLHGKFSKGSGGTNEPWALTLHDWSHEHEADL---RKAFDSASDGIVGIEVVSRQTFVSVLRGLKAPVEDEHIQRILIAHDRRREGLINIIDFLKGFRYLPKSFVMASYEPRKKKRAAKGGKTKKIKLNLPLPICTVPPELLYRRDDGGPPHFMIENYHLITDPNRFDRDHPPGHPVEDDSAWYVDDPGKVYVNISYCVKTGDIASLKLAFSQKVPVDVKDQYYKTPLMTACGSGNYEVAKFLLDLGADVNARDQFSWTPLHHACHAGQLDIIELLVEAGAAVDAPALSGATPLMRAIESCRPCCVDYLLKAGATVTVENKTEQNCLDIARAYADQRIVELIQAKMNSLYKARDKKDKA--------------AKPQ-------------------TRPRPLTSMSSK-EKVWGKQLTTR----------QLMEKKEERRQRFTSEVDFED-FRMPFNKNLRKKT 726          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Cavefish
Match: ankef1b (ankyrin repeat and EF-hand domain-containing protein 1 [Source:NCBI gene;Acc:103034645])

HSP 1 Score: 529.25 bits (1362), Expect = 1.418e-175
Identity = 301/784 (38.39%), Postives = 444/784 (56.63%), Query Frame = 3
Query:  147 IAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG-HASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKN-----NEPWALGLYDWTVENMTEIVEELKLLDLENSGI--VNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXX-------XIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPE-----DIEDISFTPRYLLVNR-----PHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERV 2423
            +A+ RLE+LQ+ K+LQ   E+D  Q++KL+  GV  LIN  EP  GK  + +    NDLD  ++LL+  A+PD+ D  GK+ ++++A+ GH      LA+  A++ + D  GK VL+YC+SPT+RH +CL+ AL    D+N+VS+ G+ V   ACE   E E + L LL+ GADPN   + TG+T LM A   G+  +    L+ G +PN+ D + + A H AA+ G F+ +  L A+ A F+  D     P+H AAAG H+ CC+FL QRGCNPK+KN +G   R IAKD G +  +KE+ + E+   K  K      N PWA+ L+DW+ E+   +          +  +  ++   FV +L   +AP++ +  + IL   D   DGT +  DF  G KY+ K +++S++  K KKK+    GK  K         +P+ IC +P   + R  DGGPP   I   Q  TD  RFS + PP++ +EDD +WY+ +P+R + N+N   K GD +S+ LA  +   VD RD FYKT LM+A  YG+  M   L+  GADVNA D F+WTPLHHA H+G +DI++LL+  GA VD  ALNGATPL RAIES R + V++L+  GA +Q +N K  + LD+A  + D R+I ++K K+D++    D K R   +S +T SK    A PT     P         E  +    N+++ + +       +  DI FTPR +   R      H+E     + +RR+R   E+DF D F   F KN+ ++ 
Sbjct:    6 VAEGRLEVLQVYKLLQFVRERDKTQLEKLIRLGVPDLINRTEPAEGKGAMHLVALTNDLDMAQYLLNHRANPDIQDKRGKTPVILSAELGHEGMVALLAQYHANMNVEDNEGKGVLFYCISPTKRHAQCLQVALSSRADVNSVSRAGQPVFLLACEHAGECEGMALSLLEMGADPNATHQVTGRTALMEASRLGAVGLVRAILQKGGNPNSIDTNRQYAAHLAAQGGYFEVIQVLSAYCADFNAVDLKGETPLHLAAAGGHSDCCRFLSQRGCNPKLKNLDGLLPRQIAKDNGHRAALKELKRAEKLHAKFSKPGAKNPNAPWAVTLHDWSCEHQNLLRNAFGTAAGADGPVDSISGDVFVSVLQEHRAPVDPDNLQNILQNHDSKGDGTVNLNDFFKGLKYLQKTFVLSSYATKTKKKQNKKGGKGGKKGKKKGKLVVPLPICTVPPERMPRREDGGPPGYMIESYQQFTDARRFSRDCPPNHPLEDDSAWYLEEPERIYTNINRCVKTGDFESLCLAFSQQIPVDVRDPFYKTPLMTACSYGSYQMTKFLLMVGADVNACDQFNWTPLHHACHAGQVDIIDLLVRTGANVDTAALNGATPLMRAIESCRISCVDYLINAGAAVQAQNKKEQSCLDVARAFGDERIIEMVKMKLDSVSKPADGKERS--RSSKTRSK---PAPPTAVKVAPALSVP---VEKKVNLMENIITVNPRSSITPSINRPDIRFTPRTVWGQRLANSAQHMER----KVDRRKRLTHEVDFTD-FLMPFSKNILQKT 776          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 122.479 bits (306), Expect = 8.538e-28
Identity = 147/626 (23.48%), Postives = 247/626 (39.46%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFL---------TGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRP----IDGGPPVMYIPKE---QYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVD----ALPPVKDK 2093
            N  T L +A    + + +K LLD GA  D    +G + +   A+ GH    E L   GA +     NG + L+        H  C++  L+++V +++V+ D  T L  A   G  + ++  +++   A+PN  +   G TPL  AC      +    LK G         G T +H AA  G+   +  L   GA  +  +      +H AA AG A   ++L Q G    +K  + + A  IA   G      E++++    G               W     T     L L   E       +E   LL+   A L+   +K   P     K G  + A  L          GK  +  L++ + ++ +                    + ++   H   P     +G  P+    K+   +  T L  F +E    N +            +    ++ AA+ G +D + L L K   V+  ++   T L  AA    + +   L+N+GA+V+A     +TPLH A H G + +V  L+ N A +++K  +G TPL +A +    +++  LL+  A        G T L +A       V++ ++   D    A PPV +K
Sbjct:  241 NDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGD--HLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCG--HYKVAKVIVDKKANPNA-KALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKA----EIVQLLLQKGA--------------WASAATTSGYTPLHLAVREG-----HQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQ-------------------RVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAET---NAVTR----------QGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGLTDENLTATPPVSEK 806          

HSP 2 Score: 85.5001 bits (210), Expect = 1.890e-16
Identity = 50/158 (31.65%), Postives = 86/158 (54.43%), Query Frame = 3
Query: 1581 IGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            +G+  R+  +   AA+ G+L+     LK G  ++  ++    AL  A+  G++++   L+  GA V+A      T LH A+ +G  D+V  L+ NGA V+A++ NG TPL+ A + +   VV FLL+ GA   +    G TPL +A      +V++++
Sbjct:    1 MGNSSRSNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLL 158          

HSP 3 Score: 84.7297 bits (208), Expect = 3.921e-16
Identity = 53/141 (37.59%), Postives = 74/141 (52.48%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYK--------TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            AA+  D  S  L L+  +  D   + +         T L  AAHYGN+++   L+N GA V+       TPLH AA  G  ++V+LL++ GA +DAK  +G TPL     S    VVE LL +GA I  +   GL+PL +A
Sbjct:  175 AARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMA 315          

HSP 4 Score: 80.4925 bits (197), Expect = 7.777e-15
Identity = 71/257 (27.63%), Postives = 113/257 (43.97%), Query Frame = 3
Query:  237 DNGVEHLINYNEPDN-----GKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNG 989
            +N V+ L ++    N     G+T L +A      D +++LL  GA  D+   + ++A+ IA++ G     + L + GA       +G   L+  V   E H+E     L +   L+  +K G T L  A + G+   E   +LL+  A P+   K TG TPL  A    +  +    L  G  P+ A ++G T +H AAK    +    L  FGA+ +       +P+H AA  G       L  +  N  + N NG
Sbjct:  420 ENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVR--EGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQI--EAAKLLLQKRAAPDTAGK-TGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNG 671          

HSP 5 Score: 80.1073 bits (196), Expect = 8.908e-15
Identity = 50/151 (33.11%), Postives = 78/151 (51.66%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            F  ++ AA +G+++   L L +G  VD   R   T L  AA  GN +M   L++ GA ++AK     TPLH  A SG   +VE+L++ GA + +K  NG +PL  A +    N V+ LL+    +    +  LT L +A +    +V  +I
Sbjct:  210 FTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVI 360          

HSP 6 Score: 70.8626 bits (172), Expect = 6.368e-12
Identity = 50/160 (31.25%), Postives = 71/160 (44.38%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKG 2099
            AA  G  + +K     G   +T +   +TAL  AA  G  D+  +L+  GA V+ K     T LH A+  G  +IV+LL+  GA   A   +G TPL  A+          LL+ GA +     KG TPL +A  +       ++  K  A P    K G
Sbjct:  414 AAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQK-RAAPDTAGKTG 572          

HSP 7 Score: 70.0922 bits (170), Expect = 1.050e-11
Identity = 81/334 (24.25%), Postives = 131/334 (39.22%), Query Frame = 3
Query:  156 SRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDG---------------------------KENEEICLILLKHGADPNIIQKA-------TGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIK 1052
            SR     +R       EK  D +K  VD      IN     NG   L +A+ E  ++ +  LL LGA  D    +G +A+ IA+  G       L   GA++     NG   LY  ++  E H E +   L +    +  ++DG T L  A + G                           K++ +   +LL++  + ++  K        +G TPL  A   G+ ++ +  L  G   +   R+  T +H AAK GN   +  L   GA+ D        P+H  A +GH    + L  RG     K  NG     +A      +C++ +++
Sbjct:    5 SRSNASYLRAARAGNLEKALDYLKTGVD------INICN-QNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLY--MAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ 329          

HSP 8 Score: 64.6994 bits (156), Expect = 4.117e-10
Identity = 39/118 (33.05%), Postives = 60/118 (50.85%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAK 1973
            A+K G ++ +   LK G  VD   +   TAL  A+  G  D+   L+  GA+VNA+    +TPL+ AA    +++V  L+ +GA       +G TPL  A++     VV  LL+   K
Sbjct:   47 ASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTK 164          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ankef1b (ankyrin repeat and EF-hand domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-060810-68])

HSP 1 Score: 344.739 bits (883), Expect = 1.810e-108
Identity = 210/559 (37.57%), Postives = 303/559 (54.20%), Query Frame = 3
Query:  834 KSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSF---------GKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQ-FDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXX-XIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSW-YIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSY---------SSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKASGLED 2444
            K L  L A GA   +     +  +H AA  GH  CC+FL QRGCNPK+KN+  + AR +AK+ G K  +K + K ER F         GK G  ++PWA+ LYDWT E   ++  EL  +     G +  ++ +D L R +AP     E ++L Q  D NK GT    +FL G KY+ K YLMSAFE K +K KKG +    K   +P+ ICV+PE    R  DGGPP+  I +   +TD  RF  ++ P + IEDD +W Y+  P+RTFV +  A + GD +S+  A  +   VD RD FYKT LM+AA +GN+++  HL+  GADV A+D + WT LHHA H+G  DI  LL++ GA  +A  L G+T L RA ES R + V  LL++GA++   N +  T L++A  + + R+  +++A+ DALP  K+ +G GN+K G   +   R +S                  LA K    + +          + +  +  +++FTPR    ++    +LL  +   RQRF  +IDFP  FQ  F K +T+R    G  D
Sbjct:    1 KVLQVLAAMGADLGLVALDGSTALHLAALKGHTVCCRFLAQRGCNPKLKNAERQTARMLAKESGHKATVKALRKEERLFSRSQRPPADGKKGVCSQPWAVRLYDWTQEYKEDLRAELGAV-CGPDGSLASEQLLDALRRQRAPPLGPPETQLLLQAHDLNKSGTVVLEEFLKGNKYLAKSYLMSAFEPKGRKGKKGRRKGKAKKFTVPLPICVVPEGVTPRRADGGPPLHAIEQLSLTTDCGRFDRDHRPAHPIEDDSAWSYMAAPERTFVGVTAAVRGGDCESLLRAFSQDVPVDVRDPFYKTPLMAAAAHGNMELAAHLLQLGADVQARDAYRWTALHHACHAGQADIAALLLDAGAEANAMTLGGSTALMRAAESGRLDCVTLLLERGARLAQRNKQDNTALEVAQAFGEPRITAVLQARFDALPRAKESRG-GNRKKGDLQAASARASSRPHTSPTEASSQPARDQRLADKLQPKMKATPPPRASPFATDRRANQINVTFTPRTDWRSQASTPALLHQKESLRQRFSEDIDFPG-FQMPFQKGVTQRAALFGALD 556          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ankef1b (ankyrin repeat and EF-hand domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-060810-68])

HSP 1 Score: 261.536 bits (667), Expect = 4.798e-79
Identity = 158/414 (38.16%), Postives = 228/414 (55.07%), Query Frame = 3
Query: 1212 LIRLKAPLNEEIEKKILPQ-FDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXX-XIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSW-YIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKASGLED 2444
            L R +AP     E ++L Q  D NK GT    +FL G KY+ K YLMSAFE K +K KKG +    K   +P+ ICV+PE    R  DGGPP+  I +   +TD  RF  ++ P + IEDD +W Y+  P+RTFV +  A + GD +S+  A  +   VD RD FYKT LM+AA +GN+++  HL+  GADV A+D + WT LHHA H+G  DI  LL++ GA  +A  L G+T L RA ES R + V  LL++GA++   N +  T L++A  + + R+  +++A+ DALP  K+ +G GN+K G   +   R +S                  LA K    +++++     I    F  +Y   ++    +LL  +   RQRF  +IDFP  FQ  F K +T+R    G  D
Sbjct:    2 LRRQRAPPLGPPETQLLLQAHDLNKSGTVVLEEFLKGNKYLAKSYLMSAFEPKGRKGKKGRRKGKAKKFTVPLPICVVPEGVTPRRADGGPPLHAIEQLSLTTDCGRFDRDHRPAHPIEDDSAWSYMAAPERTFVGVTAAVRGGDCESLLRAFSQDVPVDVRDPFYKTPLMAAAAHGNMELAAHLLQLGADVQARDAYRWTALHHACHAGQADIAALLLDAGAEANAMTLGGSTALMRAAESGRLDCVTLLLERGARLAQRNKQDNTALEVAQAFGEPRITAVLQARFDALPRAKESRG-GNRKKGDLQAASARASSRPHTSPTEASSQPARDQRLADKITALVIAFAENRTQI--TIFLGKYDWRSQASTPALLHQKESLRQRFSEDIDFPG-FQMPFQKGVTQRAALFGALD 411          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 1.624e-26
Identity = 167/648 (25.77%), Postives = 259/648 (39.97%), Query Frame = 3
Query:  258 INYNEPDNGK-TCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDL---------NGKN-------VLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLF----HACEDGKENEEICLILLKHGADP-NIIQKATGKTPLMAACAS---GSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLEN--------SGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPI----DGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYK--TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPP 2081
            +N +  D  K T L +A   N +  ++ LL  GA     D  G   +  A  YGH    E L K GA +   DL           KN       +L Y   PT      L    +  +DL   S+  + +++    H+        ++  +    G D  N     T +T L  A AS       +    L+ G + N   +   T +H A+   +   +  L   GA+ +V D      +H AA AGH + C+ L   GC+P + +  G F      ++  +  + E     R+     +  E    G  D TV+ +    + +   D+E         +   N+   V+ L++  A ++ + +  ++P  +    G ++ A+ L  +  V  +  +  F    +   KG            EIC +   H   P     DG  P+  +  ++  TD                     I D  R    + DAAK G L  ++  L  G  V+ RD   +  T L  AA Y NL++  +L+ +GADVNA+D     PLH+AA  G +DI  LLI   A V+A      TPL  A +  R  +   LL  GA   M+N +G TPLDLA    D R + I     DA+PP
Sbjct:  325 VNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPT-----LLNCHSKSAIDLAPTSELKERLVYEFRGHSLLQAAREADVTRVKKHLGLDIINFKHPQTHETALHCAVASPYPKRKQVSELLLRKGANVNEKTKDLLTPLHVASDKAHNDVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCDPNLPSLQG-FTAAQLGNESVQQILHESSLPVRNSDVEHQLLEAAKAGDLD-TVKQLC-TTQTVNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGK----------YEICKLLLKHGADPTKKNRDGNTPLDLV--KEGDTD---------------------IQDLLRGDAALLDAAKKGCLARVQ-KLCSGENVNCRDSQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYSACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPSMKNQEGQTPLDLA-TADDVRALLI-----DAMPP 924          

HSP 2 Score: 105.531 bits (262), Expect = 2.664e-23
Identity = 152/610 (24.92%), Postives = 240/610 (39.34%), Query Frame = 3
Query:  246 VEHLIN-----YNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLK------HGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCM------KEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDR--FYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDL 2015
            VEHL+      +   D G   L  A S    + +  LL  GA P+  D    + +  AA  G +     L + GAD  + + +GK  L     PT +            V      KD    L  A   G  NEE  + LL       H +D          TPL  A       I    L+ G D +  D+ G   +H A   G+++    L   GA  +  D  Q  P+H AA+      C  L   G +P + N + + A  +A     K+ +        +++  R    + +  +   L + ++      E      +     S    +K+  +LL+R  A +NE+ +  + P    +     D  D L   K+  K+ +  +       +              +  C +  SH   P         +P  Q  T   +  +E+    +I  + S  + + D     + +AAK GDLD++K  L     V+ RD    + T L  AA Y  + +  +L+ +GADV+AKD     PLH+A   G  ++ ELL+  GAVV+   L   TPL  A    ++ + + LLK GA    +N  G TPLDL
Sbjct:  197 VEHLLQNGANVHARDDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPGIRNTDGKTALDL-AEPTAK-----------AVLTGEYKKD---ELLEAARSG--NEEKLMALLTPLNVNCHASD------GRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHSKSAIDLAPTSELKERLVYEFRGHSLLQAARE-ADVTRVKKHLGLDIINFKHPQTHETALHCAVA----SPYPKRKQVSELLLRKGANVNEKTKDLLTPLHVASDKAHNDVIDVLL--KHGAKINVTDSLGQTSLHRAAHAGH--------LTTCRLLLSHGCDP--------NLPSLQGFT-AAQLGNESV--QQILHESSLPVRNSDVEH-QLLEAAKAGDLDTVK-QLCTTQTVNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDL 755          

HSP 3 Score: 69.707 bits (169), Expect = 2.957e-12
Identity = 48/136 (35.29%), Postives = 73/136 (53.68%), Query Frame = 3
Query: 1617 DAAKHGDLDSIKLALKKGYKVDTRDRFYK--TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            +A ++GD+  +K  L     V+ RD   +  T L  AA +G  D+  HL+  GA+V+A+D+    PLH+A   G  ++V LL+  GA  +A+     TPL  A    + +V   LL+ GA   + N+ G T LDLA
Sbjct:  153 EACRNGDVGRVK-RLVSPLNVNARDTTGRKSTPLHFAAGFGRKDVVEHLLQNGANVHARDDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPGIRNTDGKTALDLA 287          

HSP 4 Score: 64.6994 bits (156), Expect = 7.842e-11
Identity = 93/411 (22.63%), Postives = 157/411 (38.20%), Query Frame = 3
Query:  186 VLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGK-TCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKEN--EEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAK-----------------DKGAKDCMKEVIKV-----ERSFGKLGKNNEPWALG-------LYDWTVENMTEIVEELK--LLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFL 1313
             L C     Y + K++ +  +    N NE      T L +A+ +   D I  LL  GA  +V D  G++++  AA  GH+ +   L   G D  L  L G        +  +   E ++  L +   L   + D +  L  A + G  +  +++C     +  D     +    TPL  A      S+    L+ G D +  D+ G   +H A   G+++    L   GA  +V D  +  P+H AAA G    CK L + G +P  KN +G     + K                 D   K C+  V K+            G+N+ P  L        + ++ +E+  ++  + K  L+ L N+      +   LLI+  A +N   +    P  +  + G       L
Sbjct:  490 ALHCAVASPYPKRKQVSELLLRKGANVNEKTKDLLTPLHVASDKAHNDVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCDPNLPSLQG-------FTAAQLGNESVQQIL-HESSLPVRNSDVEHQLLEAAKAGDLDTVKQLCTTQTVNCRD----MEGRHSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSGENVNCRDSQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYSACVNATDKWAFTPLHEAAQKGRTQLCALL 888          

HSP 5 Score: 60.077 bits (144), Expect = 2.358e-9
Identity = 72/306 (23.53%), Postives = 119/306 (38.89%), Query Frame = 3
Query:  135 NKMPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDN-GKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEIC------LILLKHGADPNIIQKATGK------------TPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGE 992
            + +P+  S +E     ++L+     D D +K+L        +N  + +    T L  A   N +  +++LL  GA     D  G   +  A  YGH    E L K GA + + DL     L+   +  +   E  +  L++  D    ++DG T L    E   + +++       L   K G    + +  +G+            TPL  A    +  +    L+ G D N  D+ G   +H AA  G+      L  + A  +  D     P+H AA  G    C  L   G +P +KN  G+
Sbjct:  607 SSLPVRNSDVE----HQLLEAAKAGDLDTVKQLC---TTQTVNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKY--EICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSGENVNCRDSQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYSACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPSMKNQEGQ 903          

HSP 6 Score: 54.299 bits (129), Expect = 1.282e-7
Identity = 48/186 (25.81%), Postives = 84/186 (45.16%), Query Frame = 3
Query: 1593 DRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLH--------------------HAAHSGMIDIVELLINNGAVVDAKALNG--ATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII---KAKVDAL 2075
            D   + +++A   G  + + L L++G   + RD +  T L  AA  G +D+C+ L+ +GAD   ++    T L                      AA SG  + +  L+     V+  A +G  +TPL  A   +R  +V+ LL+ GA +  ++  GL PL  A ++    V  ++    A V+A+
Sbjct:  212 DGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPGIRNTDGKTALDLAEPTAKAVLTGEYKKDELLEAARSGNEEKLMALLTP-LNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAM 396          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 3.072e-26
Identity = 164/657 (24.96%), Postives = 264/657 (40.18%), Query Frame = 3
Query:  282 GKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKE---NEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKL----GVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGK-NNE-----------PWALGLYDWTVENMTEIVEELKLLDLENSGIVNKK-----------------EFVDLLIRLKAPLNEEIEKKILP-QFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVM----YIPKEQYSTDLNRFSSE---NPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNF-HWTPLHHAAHSGMIDIVELLINNG---AVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVIN-IIKAKVDALPPVKDKKGR 2102
            G+T L  A      + + FL+  GA+ +  D + + AI  AA  GH    + L   GAD++  D  G + L+   S  +     ++  L   VD+++ +  G T L  AC +G++   NE     L+  GA+ N   +  G TPL  A AS   ++   CL+L    G D N   + GK+ +H  A  G F     L   G + D  D   N P+H AA  GH      L   G +   +  +G F   +A   G  DC ++++   + +  +   +NE           P   G            VE L LL L     +NKK                 + V  L+   A LNE+ E++  P  +    DG      F       N + + S  +      +              +IC+    H++R  D  P +     Y P    +   +R   E     P     D  S +   P      ++ AA HG   ++++ ++    +D R+    T L  AA  G+ D    LI +GA V  K+     T LH AA +G ++ + LL+ N      VDA   N  TP+  A+ +   +    LL KGA I  +++KG T L           ++ +++  VD    +++++GR
Sbjct:  138 GRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQ--IGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNE-----LIDCGANVNQANE-RGFTPLHFAAASTHGAL---CLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLL-LSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSF----SVYNTISVQSYIDVHSTCSEA-------------QICL---EHLLRK-DADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISP------LHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDV--SLRERRGR 753          

HSP 2 Score: 71.2478 bits (173), Expect = 8.726e-13
Identity = 75/320 (23.44%), Postives = 130/320 (40.62%), Query Frame = 3
Query:  222 IKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG-----------------------HASCC------KFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEP 1094
            ++ LV+NG +  +N    D GK+ L +          + L+  G   D  D +G + + IAA+YGH     +L   GAD     ++G   L+  ++      +C    L      + VS      +  A  +    +E                   G+T L AA + G+    +  L  G D N  DR  +TA+HYAA + N + +V L A GA+ +  D+ +  P+HYAAA                        H++C       + L ++  +P +++  G      A   G + C++ +++   +F   GK+  P
Sbjct:  287 LELLVNNGAD--VNVQSKD-GKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLH--LAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEF------------------GRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHP 583          

HSP 3 Score: 65.855 bits (159), Expect = 3.303e-11
Identity = 47/126 (37.30%), Postives = 67/126 (53.17%), Query Frame = 3
Query: 1680 DTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA-YNWADSRVINII 2054
            +  DR  +TAL  AA  G+ +M   L+  GA++NA D      +H AA+ G  ++V++L+ +GA V  K   G +PL  A  S +  VV+ LL  G  I   NS G T L +A YN  D  V  +I
Sbjct:  132 NVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELI 257          

HSP 4 Score: 65.0846 bits (157), Expect = 6.412e-11
Identity = 80/329 (24.32%), Postives = 136/329 (41.34%), Query Frame = 3
Query:  186 VLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKE-------------------------------NEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAGH--ASCCKFLGQRGCNPKVKNSNGE-----------FAR--TIAKDKGAKDC 1034
            ++Q  +  D D+++ L+    E  +N  + D  +T L  A    + + I+ L+  GA  +  D +  + +  A      A+ ++L K  AD+   D N +  L+  V+   R  +C E  +      N   + G+T L HA  +G                                 + E+  +L+ HGAD     K  G +PL AA +SG   +    L LGVD +  +  G TA+H A  +G    +  L   GA  +  ++    P+H+AAA    A C + L   G +  V++ +G+           F R  T+ ++ G  DC
Sbjct:   10 LIQAIFNGDPDEVRSLIYKKEE--VNAVD-DEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLH--VAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDK-KGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDC 332          

HSP 5 Score: 63.929 bits (154), Expect = 1.648e-10
Identity = 49/159 (30.82%), Postives = 75/159 (47.17%), Query Frame = 3
Query: 1590 PDRTFVNMNDAAKHGDLDSIKLALKKG---YKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLK----KGAKIQMENSKGLTPLDLA-YNWADSRV 2042
            PDR    ++ AA +G ++ ++L ++       VD  D   +T +M A   G+ D    L++ GA +NAKDN   T LH  A +G  + V+LL+     V  +   G  PL  A       ++  L++     GA I + +  G TPL  A YN  D  V
Sbjct:  648 PDRRTA-LHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCV 805          

HSP 6 Score: 61.6178 bits (148), Expect = 7.813e-10
Identity = 48/133 (36.09%), Postives = 68/133 (51.13%), Query Frame = 3
Query: 1710 LMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPP--VKDKKGR 2102
            L+ A   G+ D    LI    +VNA D+   TPLH AA+ G  +I+ELL+ +GA V++K     TPL RA  S     V+ LLK  A +   +    TPL +A   A +R +   +A +  L    V D+ GR
Sbjct:   10 LIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVA---AANRAVKCAEAIIPMLSSSNVSDRAGR 139          

HSP 7 Score: 57.7658 bits (138), Expect = 1.248e-8
Identity = 44/144 (30.56%), Postives = 70/144 (48.61%), Query Frame = 3
Query: 1632 GDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAK 2063
            GD D ++  + K  +V+  D   +T L +AA+ G  ++   L+  GA VN+KDN   TPLH A  S     V+ L+ + A V+A+  N  TPL  A  +      E ++   +   + +  G T L  A     S ++N + AK
Sbjct:   17 GDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAK 160          

HSP 8 Score: 57.7658 bits (138), Expect = 1.269e-8
Identity = 58/209 (27.75%), Postives = 91/209 (43.54%), Query Frame = 3
Query:  330 IKFLLDLGAHPDVVDFEGKSA-----IMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVD-LNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATG---KTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GH 926
            ++ LL+    P     +GKS      + +AA +GH  + E L ++  DL + + NG   L   ++    H +C+   +++    L     D +T L  A  +G      CL LL   AD N    A+    +TP+M A  +G T   S  L  G   N  D  G TA+H  A +G+ + +  L        + +     P+H AAA GH
Sbjct:  564 LELLLE---QPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLG--LAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVE---CLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGH 764          

HSP 9 Score: 55.0694 bits (131), Expect = 7.124e-8
Identity = 47/163 (28.83%), Postives = 76/163 (46.63%), Query Frame = 3
Query: 1611 MNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKG 2099
            ++ AA  G+ + I+L +  G +V+++D  + T L  A    +      L+ + ADVNA+D    TPLH AA +  +   E +I   +  +     G T L  A  +    +V FL+ KGA I   + K    +  A     + V+ ++ A   A    KDKKG
Sbjct:   43 LHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAH-GADVRCKDKKG 204          

HSP 10 Score: 48.1358 bits (113), Expect = 9.489e-6
Identity = 63/244 (25.82%), Postives = 100/244 (40.98%), Query Frame = 3
Query:  222 IKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEG---KSAIMIAAQYGHVASFESL---AKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNT----ADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNN---PIHYA 914
            I+ LVD  V          NG T L +A      D ++ L+  GA   V+  EG   ++A+  AA  GHV     L   A +   +  +D N +  +   V     H +C    L     +N     G T L      G  +EE   +LL+   D ++ ++  G+ PL  A A G   I S  ++  +         DR+G T +H+A  +G+   +  L     + DV+   + N   P+H A
Sbjct:  603 IRSLVDLDVRE-------GNGYTPLGLAALRGHTDCVRVLIQHGA--SVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVG--NGHTDCASLLLSKGASINAKDNKGCTALHRGAATG--HEECVDLLLQRSVDVSLRER-RGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLL----ELDVFQKQEGNAFSPLHCA 828          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 3.225e-23
Identity = 139/613 (22.68%), Postives = 240/613 (39.15%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFL---------TGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPH-----NEIE-DDCSWYIGDPDRTFVN-----MNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            +G T L IA    +++    LL+LGA  D     G + + +AA+ G+    + L   GA +     +G   L+ C + +  H++ +E  L  +  +   +K+G + L H    G+    + L+L +     ++       TPL  A   G   +    L  G +PN    +G T +H A K    K +  L   GA      ++   PIH A+  GH +  + L Q G +    N  GE    +A   G  + +K +++     G   + ++                         L  +  + K E V LL++  +  N        P +  +++G  D A  L           KK    L++ S +   +       K  S   K+  +  + P  H+    D     + +  +  S      +   P H     N++E       +G             ++ AA+ G  D + L L +   +    +   TA+  AA    +++   L  + ADVN      +TPLH A+H G I +V  L+ N A+V+AK  NG TPL +A +    +VV  LL+  A      + G T L +A       V++ +
Sbjct:  204 SGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLH-CAARSG-HEKVIEMLLERDAPILAKTKNGLSPL-HMATQGEHLACVQLLLGRQAPVDDVTLDYL--TPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQT-----------------------PLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTP-LHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 787          

HSP 2 Score: 95.9005 bits (237), Expect = 1.814e-20
Identity = 164/661 (24.81%), Postives = 253/661 (38.28%), Query Frame = 3
Query:  216 DQIKKLVDNGVEHLINYN-EPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGK---NVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRA-------------------------------FGAQFDVYDDTQN--NPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFL--TGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTR--DRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII-KAKVD 2069
            D ++ LV+ G     N N +  NG T L +A  EN L+ +KFLLD GA+  V   +G + + +A Q GH      L ++       D  GK     L+      + +   L     +N D+   SK G T L  A   G  N  +  +LL  GA  +   +  G TPL  A   G+ ++    L  G   +T  R G T +H AA+SG+ K +  L                                  G Q  V D T +   P+H AA  GH    K L  RG  P  +  NG     IA       C K  IKV     K G +       ++  T   +T I           +  +     V LL++  A  N    +   P    ++ G  +    L  +G +   K     A E +         GK+   ++ ++    P +    P   G   +Y    +   D+     EN        D S       + F  ++ A+K+G L+   L L+K    D +   +   T L  A HY +  + + L++ GA  ++     +TPLH AA    +++ ++L+  GA  +     G  PL  A +    ++V  LL + A I +    GLT + LA       V  I+ K K D
Sbjct:   91 DIVRVLVEFGA----NINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLES-------DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADV--TSKSGFTPLHIAAHYGNMN--VATLLLNLGAAVDFTAR-NGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIA-------CKKNRIKVMELLLKHGAS-------IHTTTESGLTPI---------HVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVK-----AREDQTPLHIASRLGKAEIVQLLLQRGSDPNA----PTASGSTPLYFASREGHGDVASLLLENGA------DISPVT---KKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKAD 694          

HSP 3 Score: 81.2629 bits (199), Expect = 6.247e-16
Identity = 46/145 (31.72%), Postives = 81/145 (55.86%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA++G+L+ +   LK G  ++T ++    AL  A+  G++D+   L+   A+++       T LH AA +G  DIV +L+  GA ++A++ NG TPL+ A + +   +V+FLL  GA   +    G TPL +A      +V+ ++
Sbjct:   18 AARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLL 162          

HSP 4 Score: 78.1814 bits (191), Expect = 4.669e-15
Identity = 58/161 (36.02%), Postives = 84/161 (52.17%), Query Frame = 3
Query: 1647 IKLALKKGYK--------VDTRDRFYKTALMSAAHYGNLDMCMHLINY--GADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKG 2099
            + +AL++G++         DT+ +    AL  AA   + +    L+ +   ADV +K  F  TPLH AAH G +++  LL+N GA VD  A NG TPL  A +    N+V+ LL +GAKI  +   GLTPL  A      +VI ++  + DA    K K G
Sbjct:  147 LAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGF--TPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLER-DAPILAKTKNG 304          

HSP 5 Score: 74.3294 bits (181), Expect = 8.340e-14
Identity = 50/157 (31.85%), Postives = 77/157 (49.04%), Query Frame = 3
Query: 1632 GDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAK-VDALPPVKDKKG 2099
            G L+ ++L L+ G   +  +   +T L  A+  G L++   L+  GA V  K     TPLH A+  G  +IV+LL+  G+  +A   +G+TPL+ A      +V   LL+ GA I     KG TPL +A  +    V  ++  K   A P V  + G
Sbjct:  414 GHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNG 570          

HSP 6 Score: 70.4774 bits (171), Expect = 1.200e-12
Identity = 56/200 (28.00%), Postives = 91/200 (45.50%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAK-----------------------IQMENS------KGLTPLDLAYNWADSRVINI---IKAKVD-----ALPPVKDKKGRGN 2108
            A+K G +D +   LK+  ++DT  +   TAL  AA  G  D+   L+ +GA++NA+    +TPL+ AA    ++IV+ L++NGA       +G TPL  A++     VV  LL+   K                       +Q E++       G TPL +A ++ +  V  +   + A VD      + P+     RGN
Sbjct:   51 ASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGN 250          

HSP 7 Score: 69.707 bits (169), Expect = 2.039e-12
Identity = 47/164 (28.66%), Postives = 79/164 (48.17%), Query Frame = 3
Query: 1602 FVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDK 2093
            F  ++ A K   +  ++L LK G  + T      T +  A+  G+L++   L+  GA  NA +    TPLH A+ +G +++V+ L+ +GA V  KA    TPL  A    +  +V+ LL++G+      + G TPL  A       V +++      + PV  K
Sbjct:  371 FTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKK 534          

HSP 8 Score: 57.3806 bits (137), Expect = 1.434e-8
Identity = 53/188 (28.19%), Postives = 85/188 (45.21%), Query Frame = 3
Query:  264 YNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSG 827
            ++   NG T L IA  +N L+  K LL+LGA  +++  +G + + +AAQ GH      L    A + L    G   ++  ++  E      E   ++  D+N  +K   T L  A   G  N ++   LL++ A  N   +  G TPL  A   G T + +  L+    PN    +G TA+  A + G
Sbjct:  597 HSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMH--LAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYG--NIKMVNFLLRNRALVNAKTR-NGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLG 779          

HSP 9 Score: 49.2914 bits (116), Expect = 4.395e-6
Identity = 43/148 (29.05%), Postives = 61/148 (41.22%), Query Frame = 3
Query:  582 DGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKG 1022
            D  T    A  +G  N E  +  LK G D N   +  G   L  A   G   + ++ LK   + +TA + G TA+H AA +G    +  L  FGA  +        P++ AA   H    KFL   G N  V   +G     +A  +G
Sbjct:   10 DAATSFLRAARNG--NLERLMDHLKGGMDINTCNQ-NGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQG 154          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 78.5666 bits (192), Expect = 2.613e-15
Identity = 48/112 (42.86%), Postives = 64/112 (57.14%), Query Frame = 3
Query: 1686 RDRFYKTALMSAAHYGNLDMCMHLINYGA-DVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALN--GATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLD 2012
            RD   +T L  A   G  D+   +I  G  D+N +DN   T LH AA  G I+IVELLI NGA V+ K++   G TPL  A  +   +VV++LLK GA   + N+KGLT  +
Sbjct:  326 RDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAFE 437          

HSP 2 Score: 52.373 bits (124), Expect = 2.829e-7
Identity = 36/99 (36.36%), Postives = 56/99 (56.57%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKG-YKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAK--DNFHWTPLHHAAHSGMIDIVELLINNGA---VVDAKALNG 1898
            A   G  D +K  +++G Y ++ +D    TAL  AA  G++++   LI  GADVN K  + F  TPL  A+ +G +D+V+ L+ NGA   + +AK L  
Sbjct:  337 ACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTA 435          

HSP 3 Score: 50.8322 bits (120), Expect = 1.037e-6
Identity = 35/112 (31.25%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  675 IIQKATGKTPLMAACASGSTSIPSKCLKLG-VDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDV-----YDDTQNNP-IHYAAAGHASCCKFLGQRGCNPKVKNSNG 989
            I + + G+T L  AC  G   +  K ++ G  D N  D  G TA+H AA  G+ + +  L   GA  ++     + DT   P I  +A GH    K+L + G +P ++N+ G
Sbjct:  324 IYRDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDT---PLIDASANGHLDVVKYLLKNGADPTIRNAKG 432          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 53.1434 bits (126), Expect = 3.544e-8
Identity = 37/109 (33.94%), Postives = 55/109 (50.46%), Query Frame = 3
Query: 1704 TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNG-AVVDAKALNGATPLFRAIESSRFNVVEFLLKK-GAKIQMENSKGLTPLDLAYN 2024
            T L  A      ++   LI  GA V  KD F+  PLH AA  G + ++ELL   G + V+ +   G TPLF A+     +    L++K GA+  + ++KG    D+A N
Sbjct:  109 TCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALN 217          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 54.6842 bits (130), Expect = 5.893e-8
Identity = 29/79 (36.71%), Postives = 47/79 (59.49%), Query Frame = 3
Query: 1731 GNLDMCMHLINYGADVNAKDNFH-WTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKK 1964
            G+  +   LI YGAD N  D F+ WTP+ +A  SG  +++  L+ + A +D +  NG +PLF A+  S  +V+  LL++
Sbjct:  569 GDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQR 647          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 52.7582 bits (125), Expect = 1.981e-7
Identity = 40/120 (33.33%), Postives = 58/120 (48.33%), Query Frame = 3
Query: 1704 TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLI------NNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVI 2045
            TAL  AA YGN+ +   L+ +GAD   KD      +H + +S  I +V  ++      N+   +D+K  N  TPL  A     F  VE LLK G+ +   +++G   L  A    D RVI
Sbjct:  120 TALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVI 239          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 48.521 bits (114), Expect = 4.926e-6
Identity = 40/148 (27.03%), Postives = 67/148 (45.27%), Query Frame = 3
Query: 1584 GDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTR-DRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAV-----VDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPL 2009
            GD       ++ A+ +  L  +   + +G  V+ R    + T L  AA YG + +   L+ +GAD    D+  +  LH + +S  I +V  ++ N        +D +   G T L  A        V  LLK GA I++ +++G TPL
Sbjct:  104 GDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPL 251          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO28023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7M5])

HSP 1 Score: 67.0106 bits (162), Expect = 1.335e-13
Identity = 36/96 (37.50%), Postives = 55/96 (57.29%), Query Frame = 3
Query: 1773 DVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAV-----VDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVI 2045
            DV+ KD+  WTPLHHAA +G +  VE L+    +     ++A+   G TPL  A    R  VV+ L++  A +   N+KG+T LD+A   A++ V+
Sbjct:    1 DVSTKDSSRWTPLHHAAGAGHVRTVETLMRATNIGFSYSLEAEDWRGNTPLMTAAGRGRDRVVQVLIQHKADVTARNAKGMTALDIAIENANATVV 96          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO49269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH05])

HSP 1 Score: 74.7146 bits (182), Expect = 1.560e-13
Identity = 51/184 (27.72%), Postives = 90/184 (48.91%), Query Frame = 3
Query: 1581 IGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAI-ESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTS 2129
            + + ++ F    DA   GD+  +++ L +G  +D  D   ++ +  A  +G  D+   L+  GA+VN +     TPLH AA  G   I ++L+  GA V AK     TPL  ++ +     V   L++ GA+I   N +G+ P+DL     + + + ++++  +A       K R N  SG +S
Sbjct:  415 LSEEEKAFQIAVDAIASGDIAGLEMILDEGLFIDASDHMQRSLIYHAVTFGQADIVQFLLKRGAEVNWEGPEDRTPLHVAAAEGNRTITQMLLAFGANVRAKDSAFCTPLHLSVGKLQNLEVSHLLVEHGARILENNIQGVRPVDLEMQLKEMQRL-LVQSACEAFYSTDLSKSRSN--SGTSS 595          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO41101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D3])

HSP 1 Score: 66.6254 bits (161), Expect = 2.173e-13
Identity = 38/103 (36.89%), Postives = 60/103 (58.25%), Query Frame = 3
Query: 1773 DVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAV-----VDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVI-NIIKAK 2063
            DV+ KD+  WTPLHHAA +G +  VE L+    +     ++A+   G TPL  A    R  VV+ L++  A +   N+KG+T LD+A   A++ V+  I+K++
Sbjct:    1 DVSTKDSSRWTPLHHAAGAGHVRTVETLMRATNIGFSYSLEAEDWRGNTPLMTAAGRGRDRVVQVLIQHKADVTARNAKGMTALDIAIENANATVVMEILKSE 103          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO41104 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D3])

HSP 1 Score: 66.6254 bits (161), Expect = 2.173e-13
Identity = 38/103 (36.89%), Postives = 60/103 (58.25%), Query Frame = 3
Query: 1773 DVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAV-----VDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVI-NIIKAK 2063
            DV+ KD+  WTPLHHAA +G +  VE L+    +     ++A+   G TPL  A    R  VV+ L++  A +   N+KG+T LD+A   A++ V+  I+K++
Sbjct:    1 DVSTKDSSRWTPLHHAAGAGHVRTVETLMRATNIGFSYSLEAEDWRGNTPLMTAAGRGRDRVVQVLIQHKADVTARNAKGMTALDIAIENANATVVMEILKSE 103          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO36611 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI88])

HSP 1 Score: 63.1586 bits (152), Expect = 2.183e-12
Identity = 38/90 (42.22%), Postives = 49/90 (54.44%), Query Frame = 3
Query: 1674 KVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNV 1943
            +V  R+   +TAL  A+  G++D    LI  GA+VN KD   WTPLH A + G I IVE LI  GA V+       TPL  AI ++   V
Sbjct:    1 RVSKRNERGETALHLASIKGDVDELRSLIKAGANVNIKDYAGWTPLHEACNFGHISIVEELIKAGACVNTPGYESITPLHDAIINNHVQV 90          

HSP 2 Score: 45.0542 bits (105), Expect = 5.268e-6
Identity = 20/60 (33.33%), Postives = 38/60 (63.33%), Query Frame = 3
Query:  276 DNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGA 455
            + G+T L +A+ + D+D ++ L+  GA+ ++ D+ G + +  A  +GH++  E L KAGA
Sbjct:    7 ERGETALHLASIKGDVDELRSLIKAGANVNIKDYAGWTPLHEACNFGHISIVEELIKAGA 66          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Medaka
Match: ankef1a (ankyrin repeat and EF-hand domain containing 1 [Source:NCBI gene;Acc:101165612])

HSP 1 Score: 475.322 bits (1222), Expect = 7.241e-155
Identity = 285/786 (36.26%), Postives = 434/786 (55.22%), Query Frame = 3
Query:  159 RLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNN-------EPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXI--PIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALKRAN------NLLSYSSKPEDIE-------DISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSY---FHKNLTERVKASGL 2438
            RL+ LQI ++LQ    ++ ++I+K++  GV +LIN  +P+NG   L +A S ++LD + FLL  GAHPDV D  G + +M+AA+ G V     L+ + A++++ D  GK VL+YC+SP + H  CL+ AL    D+NNVS +G  V    CE       ICL+++  GADPN     TG T LM A  +GS  +    LK G  P   D+   TA+HYAA  G F+ +  L A+ A  +V D    +P+HYAAA G+A CC+FL QRGCNPK+KN  G     IAK++G K  ++E+   ER  G  GK +       E WAL LYDW+ E+  E+ +            VN   F+ +L +LKAP++ +    ++   DK K+G  + ADF+ G  YV K  L+ +   KK K++KGGKG  +K K   P  I ++P   + R  +GGPP+  I K     D  RF S++PP + I +D  WY+ +PD  +V++N   ++GDL+++ LA  +G  VD +D F++T +++A   G+L++  +L++ GADVN  D F WTP+HHAAH+G ++IVELL+  GA V+A++L+G TPL RAIE  +   V FL+K GA + +EN KG   L +A ++ +S +I+I+KA++ +LP          + SG     G ++  P    ++       ++++     +       +L S S +   I        DI+F  + +    P    LL     RR     ++D  D    Y    H+ + E  K   L
Sbjct:    9 RLQTLQIYRLLQHVRNRNKEEIEKMLKFGVANLINLRDPENGLVALHLAASADNLDLVDFLLSRGAHPDVQDKGGHTPVMLAAELGSVDIVTRLSHSQANMRIVDSAGKGVLFYCISPKKSHACCLQVALENQADVNNVSSEGVHVFQLMCEKALVCTPICLMMVDAGADPNAKDTKTGVTALMEAAKAGSLQLVRAILKRGGTPEALDKRRCTAMHYAAMGGFFEVIQVLSAYSAPMNVIDLDVCSPLHYAAASGNADCCRFLAQRGCNPKLKNLKGSTPSQIAKERGHKAAVQELKTAERKQGN-GKASKGGQAPTELWALTLYDWSHEHEAELRQAF------GDETVNLHTFMSVLTKLKAPVSPDSLHAVISAHDKKKEGLINTADFIKGVNYVKKDVLLPSRVPKKGKEEKGGKGGKKKGKCTPPFPIFILPLEKMPRRPNGGPPLFMIEKYHSRWDSRRFDSKHPPEHPIMNDSMWYMDNPDTEYVDINVCVENGDLETMDLAFSQGVPVDVQDTFFRTPMITACDSGSLEVVQYLLSKGADVNRGDQFFWTPIHHAAHAGHVEIVELLVKAGADVNAQSLDGGTPLVRAIECGQSLCVHFLVKAGANVYLENKKGQNSLRVAQDFGNSTIIDIVKARMRSLP----------KSSGSMEDPGVKSQRPKPVKKKAVAAEHAAHTDTVTTMSGSKIVQLDLRSVSLQNARIRSMEANPVDITFQAKTVWGEPPTTSQLLSNIQRRRTPVTVDVDLEDLLMPYGQSIHRKIVELSKMKDL 777          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Medaka
Match: ENSORLT00000038944.1 (tankyrase-1 [Source:NCBI gene;Acc:101158122])

HSP 1 Score: 102.449 bits (254), Expect = 1.220e-21
Identity = 165/666 (24.77%), Postives = 252/666 (37.84%), Query Frame = 3
Query:  294 LSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADP------------------------------NIIQKA-----------------------TGKTPLMAACAS---GSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERS--------FGKLGKNNEPWALGLYDWTVENMT-EIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLT---GKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYK--TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALP 2078
            L  A S N+   +  L  L  +    D    + + +AA Y  V   + L + GAD+   D  G   L+   S    H E  E  L++   +N +     T L  A    K   E+C +LL HGADP                              +++Q A                       T +T L  A AS       +    L+ G + N  ++   T +H AA+  +   +  L+  GA+ +  D      +H AA AGH   C+ L   G +  + +  G F      ++  +  + E + V  S          K G  +   +L     T +N+    +E      L  +   N+   V+ L+   A ++ + +  ++P  +    G ++ A+ L        V  L+  +       K K              EIC +   H   P                T  NR    N P + ++D     I D  R    + DAAK G L  ++  L     ++ RD   +  T L  AA Y NL++  +L+ +GADVNA+D     PLH+AA  G +DI  LLI     V+A      TPL  A +  R  +   LL  GA   M+N +G TPLDLA    D R + I     DALP
Sbjct:  287 LEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACS--YGHYEVTELLLKHGACVNAMDLWQFTPLHEAAS--KNRVEVCSLLLSHGADPTLLNCHSKSSVDMAPTPELKERLTYEFKGHSLLQAAREADMAKAKKTLALEIINFKHPHTHETALHCAVASPHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDIMEVLQKHGAKVNALDTLGQTALHRAALAGHLQTCRLLLGYGADASLVSLQG-FTAAQMGNEAVQQILNESVPVRNSDVDYRLLEAAKAGDLDTIKSL----CTPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGK-------------YEICKLLLKHGADP----------------TKKNR--DGNTPLDLVKDG-DTDIQDLLRGDAALLDAAKKGCLARVQ-KLCSPDNINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLA-TADDIRALLIDAMPPDALP 909          

HSP 2 Score: 85.1149 bits (209), Expect = 2.202e-16
Identity = 57/159 (35.85%), Postives = 87/159 (54.72%), Query Frame = 3
Query: 1617 DAAKHGDLDSIKLALKKGYKVDTRD--RFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVK 2087
            +AAK GDLD+IK +L     V+ RD    + T L  AA Y  + +  +L+++GADV+AKD     PLH+A   G  ++ ELL+ +GA V+   L   TPL  A    ++ + + LLK GA    +N  G TPLDL  +  D+ + ++++     L   K
Sbjct:  603 EAAKAGDLDTIK-SLCTPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKD-GDTDIQDLLRGDAALLDAAK 759          

HSP 3 Score: 68.1662 bits (165), Expect = 3.606e-11
Identity = 47/142 (33.10%), Postives = 75/142 (52.82%), Query Frame = 3
Query: 1599 TFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYK--TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
             F  + +A ++GD+  +K  L     V+ +D   +  T L  AA +G  D+  HL+  GA+V+A+D+    PLH+A   G  ++V LL+  GA  +A+     TPL  A    + +V   LL+ GA   + N+ G + LDLA
Sbjct:  129 AFRELFEACRNGDVSRVK-KLVDAMNVNAKDMAGRKSTPLHFAAGFGRKDVVDHLLQMGANVHARDDGGLIPLHNACSFGHSEVVSLLLCQGAEPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLA 269          

HSP 4 Score: 63.5438 bits (153), Expect = 1.095e-9
Identity = 75/297 (25.25%), Postives = 120/297 (40.40%), Query Frame = 3
Query:  162 LEILQIR------KVLQCTYEKDYDQIKKLVDNGVEHLINYNEPD-NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQ----KATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKD 1016
            LEI+  +        L C     + + K++ +  +    N NE + +  T L +A      D ++ L   GA  + +D  G++A+  AA  GH+ +   L   GAD  L  L G        +  +   E ++  L  +V + N   D +  L  A + G       L  +K    P  +     +    TPL  A      S+    L  G D +  D+ G   +H A   G+++    L   GA  +V D  +  P+H AAA G    CK L + G +P  KN +G     + KD
Sbjct:  458 LEIINFKHPHTHETALHCAVASPHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDIMEVLQKHGAKVNALDTLGQTALHRAALAGHLQTCRLLLGYGADASLVSLQG-------FTAAQMGNEAVQQILNESVPVRNSDVDYR--LLEAAKAGD------LDTIKSLCTPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKD 739          

HSP 5 Score: 59.3066 bits (142), Expect = 1.714e-8
Identity = 47/154 (30.52%), Postives = 78/154 (50.65%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGA-----VVDAK-ALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSR 2039
            R    ++ AA  G  D +   L+ G  V  RD      L +A  +G+ ++   L+  GA+ NA+DN+++TPLH AA  G ID+  +L+ +GA       D K AL+ A P  +A+ +  +   E L    +  + +    LTPL++  + +D R
Sbjct:  162 RKSTPLHFAAGFGRKDVVDHLLQMGANVHARDDGGLIPLHNACSFGHSEVVSLLLCQGAEPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLAEPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGR 315          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Medaka
Match: tnksb (tankyrase-1-like [Source:NCBI gene;Acc:105353570])

HSP 1 Score: 97.8265 bits (242), Expect = 2.769e-20
Identity = 165/666 (24.77%), Postives = 253/666 (37.99%), Query Frame = 3
Query:  294 LSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADP------------------------------NIIQKA-----------------------TGKTPLMAACAS---GSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLEN--------SGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLT---GKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIEICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYK--TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPP 2081
            L  A S N+   +  L  L  +    D    + + +AA Y  V   + L + GAD+   D  G   L+   S    H E  E  L++   +N +     T L  A    K   E+C +LL HGADP                              +++Q A                       T +T L  A AS       +    L+ G + N  ++   T +H +A+  +   L  L+  GA+ +  D      +H AA AGH   CK L   G +  + +  G F      ++  +  + E +    S     +  E    G  D TV+ +    + +   DLE         +   N+   V+ L+   A ++ + +  ++P  +    G ++ A+ L        V  L+  +       K K              EIC +   H   P                T  NR    N P + ++D     I D  R    + DAAK G L  ++  L     ++ RD   +  T L  AA Y NL++  +L+ +GADVNA+D     PLH+AA  G +DI  LLI     V+A      TPL  A +  R  +   LL  GA   M+N +G T LDLA   AD    +I    +DA+PP
Sbjct:  270 LEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACS--YGHYEVTELLLKHGACVNAMDLWQFTPLHEAAS--KNRMEVCSLLLSHGADPTLLNCHSKSAVDMAPTPELKERLTYEFKGHSLLQAAREADIAKVKKTLALEVIGFKHPQTNETALHCAVASPHPKRKQVTELLLRKGANINEKNKDFMTPLHISAERAHNDVLEVLQKHGAKVNAVDTLGQTALHRAALAGHIQTCKLLLSFGADAAIVSLQG-FTAAQMGNEAVQQILNENVPTRNSDVDY-RFLEAAKAGDLD-TVQQLC-TPQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGK-------------YEICKLLLKHGADP----------------TKKNR--DGNIPLDMVKDG-DTDIQDLLRGDAALLDAAKKGCLARVQ-KLCSQENINCRDAQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTALDLA--TAD----DIRALLMDAMPP 888          

HSP 2 Score: 79.7221 bits (195), Expect = 1.214e-14
Identity = 56/169 (33.14%), Postives = 89/169 (52.66%), Query Frame = 3
Query: 1587 DPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRD--RFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVK 2087
            D D  F+   +AAK GDLD+++  L     V+ RD    + T L  AA Y  + +  +L+++GADV+AKD     PLH+A   G  ++ ELL+ +GA V+   L   TPL  A    ++ + + LLK GA    +N  G  PLD+  +  D+ + ++++     L   K
Sbjct:  579 DVDYRFL---EAAKAGDLDTVQ-QLCTPQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNIPLDMVKD-GDTDIQDLLRGDAALLDAAK 742          

HSP 3 Score: 65.4698 bits (158), Expect = 2.755e-10
Identity = 45/136 (33.09%), Postives = 73/136 (53.68%), Query Frame = 3
Query: 1617 DAAKHGDLDSIKLALKKGYKVDTRDRFYK--TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            +A ++GD+  +K  L     V+ +D   +  T L  AA +G  D+  HL+  GA+V+A+D+    PLH+A   G  ++V LL+  GA  +A+     TPL  +    + +V   LL+ GA   + N+ G + LDLA
Sbjct:  118 EACRNGDVSRVK-RLVDTVNVNAKDMAGRKSTPLHFAAGFGRKDVVEHLLQTGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHESAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLA 252          

HSP 4 Score: 64.6994 bits (156), Expect = 4.358e-10
Identity = 69/283 (24.38%), Postives = 114/283 (40.28%), Query Frame = 3
Query:  186 VLQCTYEKDYDQIKKLVDNGVEHLINYNEPD-NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQ----KATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKD 1016
             L C     + + K++ +  +    N NE + +  T L I+      D ++ L   GA  + VD  G++A+  AA  GH+ + + L   GAD  +  L G        +  +   E ++  L  NV   N   D + +      D    +++C         P  +     +    TPL  A      ++    L  G D +  D+ G   +H A   G+++    L   GA  +V D  +  P+H AAA G    CK L + G +P  KN +G     + KD
Sbjct:  455 ALHCAVASPHPKRKQVTELLLRKGANINEKNKDFMTPLHISAERAHNDVLEVLQKHGAKVNAVDTLGQTALHRAALAGHIQTCKLLLSFGADAAIVSLQG-------FTAAQMGNEAVQQILNENVPTRNSDVDYRFLEAAKAGDLDTVQQLC--------TPQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNIPLDMVKD 722          

HSP 5 Score: 64.3142 bits (155), Expect = 6.440e-10
Identity = 86/323 (26.63%), Postives = 118/323 (36.53%), Query Frame = 3
Query:  228 KLVDNGVEHLINYNEPDNGKTC---LSIATSENDLDTIKFLLDLGAHPDVV---DFEGK--SAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADP-------NI---------------------------------IQK-----------ATGK--TPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIA 1010
            ++ +  V+ ++N N P            A    DLDT++ L      P  V   D EG+  + +  AA Y  VA  E L   GAD+   D  G   L+   S    H E  E  +R+   +N       T L  A   GK   EIC +LLKHGADP       NI                                 +QK           A G+  TPL  A    +  +    L+ G D N  D+ G   +H AA  G+      L  +    +  D     P+H AA  G    C  L   G +P +KN  G+ A  +A
Sbjct:  559 QMGNEAVQQILNENVPTRNSDVDYRFLEAAKAGDLDTVQQLCT----PQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPLHNACS--YGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKY--EICKLLLKHGADPTKKNRDGNIPLDMVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSQENINCRDAQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTALDLA 873          

HSP 6 Score: 58.9214 bits (141), Expect = 2.220e-8
Identity = 47/155 (30.32%), Postives = 79/155 (50.97%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKG-------LTPLDLAYNWADSR 2039
            R    ++ AA  G  D ++  L+ G  V  RD      L +A  +G+ ++   L+  GAD NA+DN+++TPLH +A  G ID+  +L+ +GA  + +  +G + L  A +SS   V+    KK   ++   S         LTPL++  + +D R
Sbjct:  145 RKSTPLHFAAGFGRKDVVEHLLQTGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHESAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLA-DSSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGR 298          

HSP 7 Score: 56.9954 bits (136), Expect = 1.058e-7
Identity = 49/193 (25.39%), Postives = 74/193 (38.34%), Query Frame = 3
Query: 1593 DRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKD------------------------------------------------NFHWT------PLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPL 2009
            D   + +++A   G  + + L L +G   + RD +  T L  +A  G +D+C+ L+ +GAD N ++                                                N H +      PLH AA    + IV+LL+ +GA V AK   G  PL  A     + V E LLK GA +   +    TPL
Sbjct:  177 DGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHESAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADSSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPL 369          

HSP 8 Score: 51.2174 bits (121), Expect = 5.466e-6
Identity = 74/306 (24.18%), Postives = 111/306 (36.27%), Query Frame = 3
Query:  177 IRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNG---KTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKE------------------NEEICLILLK------HGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIA 1010
            +R++ +     D  ++K+LVD      +N N  D      T L  A      D ++ LL  GA+    D  G   +  A  +GH      L   GAD    D      L+   S  +   +     L++  D N  + DGK+ L  A    K                   NEE  + LL       H +D          TPL  A       I    L+ G D +  D+ G   +H A   G+++    L   GA  +  D  Q  P+H AA+      C  L   G +P + N + + A  +A
Sbjct:  113 LRELFEACRNGDVSRVKRLVDT-----VNVNAKDMAGRKSTPLHFAAGFGRKDVVEHLLQTGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHE--SAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADSSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASD------GRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRMEVCSLLLSHGADPTLLNCHSKSAVDMA 405          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Medaka
Match: ankrd44 (ankyrin repeat domain 44 [Source:NCBI gene;Acc:101173198])

HSP 1 Score: 95.9005 bits (237), Expect = 1.077e-19
Identity = 156/653 (23.89%), Postives = 263/653 (40.28%), Query Frame = 3
Query:  216 DQIKKLVDNGVEHLINYNEPDN-GKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCV-SPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADR------HGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFART---IAKDKGAKDCMK---------EVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIE-----KKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIE-ICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEI---EDDCSWYIGDPDRTFVN----------MNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLI---NNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVI 2045
            D  +KL+ +G +     + PD+ G+TCL  A +  ++D ++ LL  G   +  D  G++ +  AA   H    E+L   G D+   D  G++ L+Y   S  +R         R  V L   S+  +       E  KE  +    LL+ GA   +  K  G +P+  A A G       CL+L +D +   +      + ++ +H AA  G+ ++L  L   G + D  D     P+  AA  GHA C   L  +G +P   +++  + RT   +A   G   C++         EV+ V    G+      P  L +    V+ ++ ++E        N    +KK  + L + L    +E ++        L Q D         A       ++++L  ++  E       K G G       P+   C   +       DG   V+   +     D N F+   P H  +    + C+  + D   + +           ++ AA  G  + I+L L     VD  D   +T LM+AA  G +     L++ GA ++  D    TPLH A  +G  D V +++   ++  +++A      TPL  A +      V+ LL +GA  Q  +  GLTP   A   A SR +
Sbjct:  336 DCCRKLLSSGFQ----IDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDR---------RRRVALEPDSEGVQA------EKEKEAAQCLEFLLQSGAAAALKDK-QGYSPVHYAAAFGH----RHCLELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPL--STDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGR-----TPLMLAVVGGHVDAVSLLLEREA-----NVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGY-----TPLHWACFYGQ-------DGCVEVLLEQRGCRCIDGNPFT---PLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNGTEDGVLMILQRLSDATLINATNAAMQTPLHMAAQRGLKKAVQELLSRGASTQTVDEDGLTP---ALACAPSRQV 934          

HSP 2 Score: 77.411 bits (189), Expect = 4.874e-14
Identity = 54/152 (35.53%), Postives = 80/152 (52.63%), Query Frame = 3
Query: 1590 PDRTFVNMND---------AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            P  T VN++D         AA +G  + + L L KG  ++  D+    AL  AA  G+LD+   L+++GA+V+ KD   +TPLH AA SG I +V+ L++    +D     G T L  A  + +  VV  L+  GA +   N+KG TPL  A
Sbjct:   78 PLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFA 229          

HSP 3 Score: 76.2554 bits (186), Expect = 1.077e-13
Identity = 49/155 (31.61%), Postives = 81/155 (52.26%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHS--GMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            R +  ++ AA  G +  +K  L    ++D  + F  TAL  A   G   +   LI+YGA+V+  +N  +TPLH AA S  G +  +E L+NNGA ++ ++ +G +PL       RF   + L++ G +I   +  G TPL +A  +    +IN +
Sbjct:  155 RGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGAL-CLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTL 308          

HSP 4 Score: 71.633 bits (174), Expect = 2.752e-12
Identity = 53/165 (32.12%), Postives = 82/165 (49.70%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHW-TPLHHAAHSGMIDIVELLIN--NGA-VVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGR 2102
            AA HG   ++++ L+ G +VD RD+  +T L  AA  G+ D    L++ GA   + D  +  TP+H A  +G    V LL++  +GA V+D     G TPL  A+     + V  LL++ A +   + KGL  L LA   A    +  +  + DA     D +GR
Sbjct:  519 AAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQ-DACLLQGDSQGR 682          

HSP 5 Score: 70.8626 bits (172), Expect = 4.789e-12
Identity = 49/128 (38.28%), Postives = 69/128 (53.91%), Query Frame = 3
Query: 1674 KVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA-YNWADSRVINII 2054
             V+  DR  +TAL  AA  G+ +M   L+  GA++NA D      LH AA  G +D+V +L+++GA V  K   G TPL  A  S +  VV+ LL    +I   N+ G T L LA +N  D+ V  +I
Sbjct:   82 SVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELI 209          

HSP 6 Score: 67.781 bits (164), Expect = 4.987e-11
Identity = 79/326 (24.23%), Postives = 132/326 (40.49%), Query Frame = 3
Query:  222 IKKLVDNGVEHLINYNEPDN-GKTCLSIAT-SENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG------------------------HASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVE---RSFGKLGKNNEPWALGLY 1112
            + +L+D G     N ++P+N G T L  A  S +    ++FL++ GA  ++   +GKS + + A +G     ++L + G ++   D +G   L+  V+    H+  + T +    D       G   L  A  +   + + C  LL  G   +    + G+T L AA A G+       LK G + N  D+ G+T +HYAA S ++  L  L   G   +  D    + +HYAAA                          A C +FL Q G    +K+  G      A   G + C++ ++      +     G    P  L  Y
Sbjct:  205 VSELIDYGA----NVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLH--VAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNA--HSDCCRKLLSSGFQIDT-PDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGRQEEADCGNAQSPLHLAAY 521          

HSP 7 Score: 62.3882 bits (150), Expect = 1.893e-9
Identity = 46/160 (28.75%), Postives = 77/160 (48.12%), Query Frame = 3
Query: 1578 YIGDPDRTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIK 2057
            + GDP+   + +  +     LD++++ ++    V+ RD+ ++T L  AA    L     +I     VN  D    T LHHAA +G  ++V LL+  GA ++A        L  A      +VV  L+  GA++  ++ +G TPL  A   A S  I ++K
Sbjct:   17 FSGDPEEIRMLIYKSEDINVLDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAA---ASSGQIAVVK 173          

HSP 8 Score: 62.3882 bits (150), Expect = 2.302e-9
Identity = 74/300 (24.67%), Postives = 120/300 (40.00%), Query Frame = 3
Query:  255 LINYNEPD-NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKE-------------------------------NEEICL-ILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIK 1052
            L + N  D  G+T L  A      + +  LL  GA+ +  D +   A+  AA  GH+     L   GA++   D  G   L+   S  +     ++  L  +V+++  +  G T L  AC +G++                               +  +CL  L+ +GAD NI Q   GK+PL      G  +     ++ G + N+ D+ G T +H AA+ G+   +  L   GA           P+H AA   H+ CC+ L   G      +S G      A   G  DC++ ++K
Sbjct:   80 LTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQ--IAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINI-QSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNAHSDCCRKLLSSGFQIDTPDSLGRTCLHAAAAGGNVDCVQLLLK 376          

HSP 9 Score: 58.5362 bits (140), Expect = 2.834e-8
Identity = 56/228 (24.56%), Postives = 104/228 (45.61%), Query Frame = 3
Query:  315 NDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAGH--ASCCKFLGQRGCNPKVKNSNGE 992
            N LD ++ L+   A  +  D   ++ + +AA    +   E +      + ++D  G+  L++  +    H E +   L    ++N   K     L  A   G  + ++  +L+ HGA+ +   K  G TPL AA +SG  ++    L L V+ +  +  G TA+H A  +G    +  L  +GA     ++    P+H+AAA    A C +FL   G +  +++ +G+
Sbjct:   35 NVLDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHH--AALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMG--HLDVVSVLVSHGAEVSCKDK-RGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQSRDGK 257          

HSP 10 Score: 57.7658 bits (138), Expect = 5.792e-8
Identity = 43/168 (25.60%), Postives = 71/168 (42.26%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAI-----------------------ESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA +   D  +  L  G+++DT D   +T L +AA  GN+D    L+  G + N  D    TPLH+AA S     +E L+  G  ++A    G + L  A                        E      +EFLL+ GA   +++ +G +P+  A  +     + ++
Sbjct:  329 AALNAHSDCCRKLLSSGFQIDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELL 496          

HSP 11 Score: 55.8398 bits (133), Expect = 2.005e-7
Identity = 36/104 (34.62%), Postives = 56/104 (53.85%), Query Frame = 3
Query: 1767 GADVNA-KDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAY-NWADSRVINIIKAKVDA 2072
            G+D+   +D    TPLH AA +G  + ++LL+++ A VD    +G TPL  A    R   +E LL  GA + + +  G TPL +A  N  +  V+ I++   DA
Sbjct:  775 GSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNGTEDGVLMILQRLSDA 878          

HSP 12 Score: 53.5286 bits (127), Expect = 1.071e-6
Identity = 47/174 (27.01%), Postives = 74/174 (42.53%), Query Frame = 3
Query:  645 ILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALG---LYDWTVENMTEIVEEL 1154
            +L++H AD N   K   +TPL  A A+ +       + L    N +DR G+TA+H+AA +G+ + +  L A GA  + +D      +H+AA  GH      L   G     K+  G      A   G    +K ++ +          +EP A G   L+         +V EL
Sbjct:   42 VLIRHSADVNARDK-NWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEI------DEPNAFGNTALHLACFNGQDAVVSEL 208          

HSP 13 Score: 51.9878 bits (123), Expect = 3.347e-6
Identity = 39/132 (29.55%), Postives = 59/132 (44.70%), Query Frame = 3
Query: 1623 AKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            A HG     +  ++ G ++++ D+   T L  AA YG+  +   LI  GAD   +      PLH AA +   D    L+++G  +D     G T L  A      + V+ LLK G +    +  G TPL  A
Sbjct:  264 AVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNAHSDCCRKLLSSGFQIDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYA 395          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Medaka
Match: ankrd44 (ankyrin repeat domain 44 [Source:NCBI gene;Acc:101173198])

HSP 1 Score: 95.5153 bits (236), Expect = 1.173e-19
Identity = 155/654 (23.70%), Postives = 262/654 (40.06%), Query Frame = 3
Query:  216 DQIKKLVDNGVEHLINYNEPDN-GKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPT--ERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADR------HGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFART---IAKDKGAKDCMK---------EVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIE-----KKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFEXXXXXXXXXXXXXXXXXXIPIE-ICVMPESHIMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEI---EDDCSWYIGDPDRTFVN----------MNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLI---NNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVI 2045
            D  +KL+ +G +     + PD+ G+TCL  A +  ++D ++ LL  G   +  D  G++ +  AA   H    E+L   G D+   D  G++ L+Y  +     R +  LE              D + V     E  KE  +    LL+ GA   +  K  G +P+  A A G       CL+L +D +   +      + ++ +H AA  G+ ++L  L   G + D  D     P+  AA  GHA C   L  +G +P   +++  + RT   +A   G   C++         EV+ V    G+      P  L +    V+ ++ ++E        N    +KK  + L + L    +E ++        L Q D         A       ++++L  ++  E       K G G       P+   C   +       DG   V+   +     D N F+   P H  +    + C+  + D   + +           ++ AA  G  + I+L L     VD  D   +T LM+AA  G +     L++ GA ++  D    TPLH A  +G  D V +++   ++  +++A      TPL  A +      V+ LL +GA  Q  +  GLTP   A   A SR +
Sbjct:  386 DCCRKLLSSGFQ----IDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRRVALE-------------PDSEGV---QAEKEKEAAQCLEFLLQSGAAAALKDK-QGYSPVHYAAAFGH----RHCLELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPL--STDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGR-----TPLMLAVVGGHVDAVSLLLEREA-----NVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGY-----TPLHWACFYGQ-------DGCVEVLLEQRGCRCIDGNPFT---PLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNGTEDGVLMILQRLSDATLINATNAAMQTPLHMAAQRGLKKAVQELLSRGASTQTVDEDGLTP---ALACAPSRQV 984          

HSP 2 Score: 77.411 bits (189), Expect = 5.436e-14
Identity = 54/152 (35.53%), Postives = 80/152 (52.63%), Query Frame = 3
Query: 1590 PDRTFVNMND---------AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            P  T VN++D         AA +G  + + L L KG  ++  D+    AL  AA  G+LD+   L+++GA+V+ KD   +TPLH AA SG I +V+ L++    +D     G T L  A  + +  VV  L+  GA +   N+KG TPL  A
Sbjct:  128 PLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFA 279          

HSP 3 Score: 76.2554 bits (186), Expect = 1.211e-13
Identity = 49/155 (31.61%), Postives = 81/155 (52.26%), Query Frame = 3
Query: 1596 RTFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHS--GMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            R +  ++ AA  G +  +K  L    ++D  + F  TAL  A   G   +   LI+YGA+V+  +N  +TPLH AA S  G +  +E L+NNGA ++ ++ +G +PL       RF   + L++ G +I   +  G TPL +A  +    +IN +
Sbjct:  205 RGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGAL-CLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTL 358          

HSP 4 Score: 71.2478 bits (173), Expect = 3.567e-12
Identity = 53/165 (32.12%), Postives = 82/165 (49.70%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHW-TPLHHAAHSGMIDIVELLIN--NGA-VVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGR 2102
            AA HG   ++++ L+ G +VD RD+  +T L  AA  G+ D    L++ GA   + D  +  TP+H A  +G    V LL++  +GA V+D     G TPL  A+     + V  LL++ A +   + KGL  L LA   A    +  +  + DA     D +GR
Sbjct:  569 AAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQ-DACLLQGDSQGR 732          

HSP 5 Score: 70.8626 bits (172), Expect = 5.015e-12
Identity = 49/157 (31.21%), Postives = 79/157 (50.32%), Query Frame = 3
Query: 1632 GDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGR 2102
            GD + I++ + K   ++  D   +T L +AA  G+ ++   LI  GA VNAKDN  +TPLH A  S   D V++LI + A V+A+  N  TPL  A  ++     E ++     + + +  G T L  A     + ++N++ AK   +     K GR
Sbjct:   19 GDPEEIRMLIYKSEDINVLDAEKRTPLHAAAFLGDAEITELLILSGARVNAKDNMWFTPLHRAVASRSQDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGR 175          

HSP 6 Score: 70.8626 bits (172), Expect = 5.461e-12
Identity = 49/128 (38.28%), Postives = 69/128 (53.91%), Query Frame = 3
Query: 1674 KVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA-YNWADSRVINII 2054
             V+  DR  +TAL  AA  G+ +M   L+  GA++NA D      LH AA  G +D+V +L+++GA V  K   G TPL  A  S +  VV+ LL    +I   N+ G T L LA +N  D+ V  +I
Sbjct:  132 SVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELI 259          

HSP 7 Score: 67.781 bits (164), Expect = 4.180e-11
Identity = 79/326 (24.23%), Postives = 132/326 (40.49%), Query Frame = 3
Query:  222 IKKLVDNGVEHLINYNEPDN-GKTCLSIAT-SENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAG------------------------HASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVE---RSFGKLGKNNEPWALGLY 1112
            + +L+D G     N ++P+N G T L  A  S +    ++FL++ GA  ++   +GKS + + A +G     ++L + G ++   D +G   L+  V+    H+  + T +    D       G   L  A  +   + + C  LL  G   +    + G+T L AA A G+       LK G + N  D+ G+T +HYAA S ++  L  L   G   +  D    + +HYAAA                          A C +FL Q G    +K+  G      A   G + C++ ++      +     G    P  L  Y
Sbjct:  255 VSELIDYGA----NVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLH--VAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNA--HSDCCRKLLSSGFQIDT-PDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGRQEEADCGNAQSPLHLAAY 571          

HSP 8 Score: 65.855 bits (159), Expect = 1.762e-10
Identity = 73/273 (26.74%), Postives = 116/273 (42.49%), Query Frame = 3
Query:  255 LINYNEPD-NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKAT-GKTPLMAACASGSTSIPSKCLKL----GVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAA-GHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIK 1052
            L + N  D  G+T L  A      + +  LL  GA+ +  D +   A+  AA  GH+     L   GA++   D  G   L+   S  +     ++  L  +V+++  +  G T L  AC +G+  + +   L+ +GA  N+ Q    G TPL  A AS   ++   CL+     G D N   R GK+ +H  A  G F     L   G + +  D   N P+H AA  GH      L   G +   +  +G F   +A      DC ++++ 
Sbjct:  130 LTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQ--IAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQ--DAVVSELIDYGA--NVSQPNNKGFTPLHFAAASTHGAL---CLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNAHSDCCRKLLS 393          

HSP 9 Score: 58.5362 bits (140), Expect = 2.927e-8
Identity = 49/163 (30.06%), Postives = 75/163 (46.01%), Query Frame = 3
Query: 1611 MNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKG 2099
            ++ AA  GD +  +L +  G +V+ +D  + T L  A    + D    LI + ADVNA+D    TPLH AA +  +   E++I     V+     G T L  A  +    +V  LL KGA I   + K    L  A       V++++ +   A    KDK+G
Sbjct:   45 LHAAAFLGDAEITELLILSGARVNAKDNMWFTPLHRAVASRSQDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSH-GAEVSCKDKRG 206          

HSP 10 Score: 57.3806 bits (137), Expect = 6.566e-8
Identity = 57/237 (24.05%), Postives = 106/237 (44.73%), Query Frame = 3
Query:  288 TCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAGH--ASCCKFLGQRGCNPKVKNSNGE 992
            T L  A +    D ++ L+   A  +  D   ++ + +AA    +   E +      + ++D  G+  L++  +    H E +   L    ++N   K     L  A   G  + ++  +L+ HGA+ +   K  G TPL AA +SG  ++    L L V+ +  +  G TA+H A  +G    +  L  +GA     ++    P+H+AAA    A C +FL   G +  +++ +G+
Sbjct:   76 TPLHRAVASRSQDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHH--AALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMG--HLDVVSVLVSHGAEVSCKDK-RGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQSRDGK 307          

HSP 11 Score: 57.3806 bits (137), Expect = 6.851e-8
Identity = 43/168 (25.60%), Postives = 71/168 (42.26%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAI-----------------------ESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA +   D  +  L  G+++DT D   +T L +AA  GN+D    L+  G + N  D    TPLH+AA S     +E L+  G  ++A    G + L  A                        E      +EFLL+ GA   +++ +G +P+  A  +     + ++
Sbjct:  379 AALNAHSDCCRKLLSSGFQIDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELL 546          

HSP 12 Score: 57.3806 bits (137), Expect = 7.523e-8
Identity = 45/134 (33.58%), Postives = 66/134 (49.25%), Query Frame = 3
Query: 1701 KTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGR 2102
            + AL+ A   G+ +    LI    D+N  D    TPLH AA  G  +I ELLI +GA V+AK     TPL RA+ S   + V+ L++  A +   +    TPL +A      R   +I   + ++  V D+ GR
Sbjct:    9 QPALIQAIFSGDPEEIRMLIYKSEDINVLDAEKRTPLHAAAFLGDAEITELLILSGARVNAKDNMWFTPLHRAVASRSQDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSV-NVSDRGGR 141          

HSP 13 Score: 55.4546 bits (132), Expect = 2.432e-7
Identity = 36/104 (34.62%), Postives = 56/104 (53.85%), Query Frame = 3
Query: 1767 GADVNA-KDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA-YNWADSRVINIIKAKVDA 2072
            G+D+   +D    TPLH AA +G  + ++LL+++ A VD    +G TPL  A    R   +E LL  GA + + +  G TPL +A  N  +  V+ I++   DA
Sbjct:  825 GSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNGTEDGVLMILQRLSDA 928          

HSP 14 Score: 53.5286 bits (127), Expect = 1.023e-6
Identity = 47/174 (27.01%), Postives = 74/174 (42.53%), Query Frame = 3
Query:  645 ILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALG---LYDWTVENMTEIVEEL 1154
            +L++H AD N   K   +TPL  A A+ +       + L    N +DR G+TA+H+AA +G+ + +  L A GA  + +D      +H+AA  GH      L   G     K+  G      A   G    +K ++ +          +EP A G   L+         +V EL
Sbjct:   92 VLIRHSADVNARDK-NWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEI------DEPNAFGNTALHLACFNGQDAVVSEL 258          

HSP 15 Score: 51.6026 bits (122), Expect = 3.690e-6
Identity = 39/132 (29.55%), Postives = 59/132 (44.70%), Query Frame = 3
Query: 1623 AKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            A HG     +  ++ G ++++ D+   T L  AA YG+  +   LI  GAD   +      PLH AA +   D    L+++G  +D     G T L  A      + V+ LLK G +    +  G TPL  A
Sbjct:  314 AVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNAHSDCCRKLLSSGFQIDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYA 445          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000006938.1 (SMESG000006938.1)

HSP 1 Score: 837.025 bits (2161), Expect = 0.000e+0
Identity = 405/407 (99.51%), Postives = 405/407 (99.51%), Query Frame = 3
Query:  141 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFE 1361
            MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLE ALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWAL LYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFE
Sbjct:    1 MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLEIALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALALYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFE 407          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000006940.1 (SMESG000006940.1)

HSP 1 Score: 479.174 bits (1232), Expect = 3.879e-164
Identity = 243/244 (99.59%), Postives = 243/244 (99.59%), Query Frame = 3
Query: 1713 MSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKASGLED 2444
            MSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTSSKGRRTASPTKPVEQPPEPPQRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPD FQSYFHKNLTERVKASGLED
Sbjct:    1 MSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTSSKGRRTASPTKPVEQPPEPPQRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDVFQSYFHKNLTERVKASGLED 244          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000006940.1 (SMESG000006940.1)

HSP 1 Score: 389.037 bits (998), Expect = 6.641e-130
Identity = 203/204 (99.51%), Postives = 203/204 (99.51%), Query Frame = 3
Query: 1833 MIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTSSKGRRTASPTKXXXXXXXXXXRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQSYFHKNLTERVKASGLED 2444
            MIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTSSKGRRTASPTKPVEQPPEPPQRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPD FQSYFHKNLTERVKASGLED
Sbjct:    1 MIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKDKKGRGNQKSGRTSSKGRRTASPTKPVEQPPEPPQRSYSELALKRANNLLSYSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDVFQSYFHKNLTERVKASGLED 204          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000006933.1 (SMESG000006933.1)

HSP 1 Score: 334.724 bits (857), Expect = 2.884e-109
Identity = 173/218 (79.36%), Postives = 173/218 (79.36%), Query Frame = 3
Query:  708 MAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAAAGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFE 1361
            MAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKS                                            GCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWAL LYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFE
Sbjct:    1 MAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKS--------------------------------------------GCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALALYDWTVENMTEIVEELKLLDLENSGIVNKKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKLYLMSAFE 174          
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.555e-19
Identity = 146/651 (22.43%), Postives = 272/651 (41.78%), Query Frame = 3
Query:  279 NGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKH----------------------------GADPNI-IQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA-AGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMKEVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLD--LENSGIVNKK-----------------EFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFL---------TGKKYVNKLYLMS------AFEXXXXXXXXXXXXXXXXXXIPIEICVMPESH--IMRPIDGGPPVMYIPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPD----RTFVNMNDAAKHGDLD-SIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            NG   + +A  E + + ++ L++ G   D+   +G +++ IA+  G +     L ++ A++ +   NG   LY  ++  E H + ++  L Y  +    + DG T L  A + G  N+++  ILL +                             +D N+  Q A+G TPL  A    + ++    ++   D N   ++  T +H AAK G  + L  L +  A  +       +PIH AA +G  +    L + G + + K+ NG  A  +A      +  + +I          K  +  A+ +   T  ++      +   +  L+N+  VN +                 + V+LLI+ KA +N   E  + P       G+ +  + L         T  K  N L+L +       F+      +     ++R+++ P+ I V   ++  + + ++ G     + K+ Y T L+  + E    +EI      +   PD    + F  ++ A+K+G +  + +L L      ++      T L  A +Y + +M   L++  A+VN      +TPLH  A   MI++ +LLI+ GA V+A++  G TPL     +    ++E LL   A +  +   GLT L LA
Sbjct:  124 NGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLY--MAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQG--NDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLI---------NKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNY-TALHIAAKEG--RHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLA 758          

HSP 2 Score: 87.8113 bits (216), Expect = 3.060e-17
Identity = 53/145 (36.55%), Postives = 77/145 (53.10%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA+ G  + I + L+ G  +  + +   TAL  A      ++C  LIN G DV+A    + T LH AAH G I+  E+L+ N   V+A+ALNG TPL  A +  +  +VE L+K  A I      GLTPL +A       ++NI+
Sbjct:  360 AARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNIL 504          

HSP 3 Score: 75.485 bits (184), Expect = 1.500e-13
Identity = 45/145 (31.03%), Postives = 78/145 (53.79%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA+ G+++ +K  L+   K D  +     A+  AA  GN ++   LI  G  V+       T LH A+ +G +++V LL+ + A ++ K+ NG TPL+ A + +  +VV+ LL+ GA   +    G TPL +A    + +V+ I+
Sbjct:   99 AARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQIL 243          

HSP 4 Score: 69.707 bits (169), Expect = 1.059e-11
Identity = 56/158 (35.44%), Postives = 84/158 (53.16%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGY-KVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVN--AKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAK---VDAL 2075
            AAK  D+++  L +      VD +     T L  AAHY N+++   LI   ADVN  AK+N   TPLH AA  G  ++++LLI+  A V++   +G +P+  A  S   N++  LL+ GA IQ ++  GLT L +A     + V   +  K   VDA+
Sbjct:  260 AAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNI--TPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAV 415          

HSP 5 Score: 64.6994 bits (156), Expect = 2.988e-10
Identity = 69/279 (24.73%), Postives = 116/279 (41.58%), Query Frame = 3
Query:  189 LQCTYEKDYDQIKK-LVDNG--VEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGA--------------------------------DPNIIQKA-TGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQNNPIHYAA 917
            + C     ++ I   L++NG  ++H     +  NG T L +AT  +  +  + L++ G   D V  +  +A+ +AA  G++ + E L K   ++    LNG   L+      +   + +E  ++Y   +N+ ++ G T L  A   G  ++EI  ILLK+GA                                + N   +A   +TPL  A   G+ SI  + L  G DPN   +   TA+H AAK G  +    L     + D        P+H A+
Sbjct:  357 IHCAARSGFENIILILLENGADIQH-----KSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQ--SKMVELLIKYKAHINSTTETGLTPLHIAAFMG--SKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIAS 626          

HSP 6 Score: 64.6994 bits (156), Expect = 3.540e-10
Identity = 41/120 (34.17%), Postives = 66/120 (55.00%), Query Frame = 3
Query: 1704 TALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAK 2063
            T L   A    +++   LI+ GA+VNA+    +TPLH  + +G  +I+ELL++  A V+ +A NG T L  A E +R ++VE LLK  A I  +   G T L  A ++   + + ++  K
Sbjct:  687 TPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEK 806          

HSP 7 Score: 63.929 bits (154), Expect = 6.038e-10
Identity = 41/127 (32.28%), Postives = 67/127 (52.76%), Query Frame = 3
Query: 1590 PDRTFVN----MNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLL 1958
            PD +  N    M+ AAK G+ + ++L ++ G  VD   R   T+L  A+  G L++   L+   A++N K    +TPL+ AA    +D+V++L+  GA       +G TPL  A++     VV+ LL
Sbjct:  118 PDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILL 244          

HSP 8 Score: 61.2326 bits (147), Expect = 3.828e-9
Identity = 39/114 (34.21%), Postives = 56/114 (49.12%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLK 1961
            AA+    D ++  LK    + T+ +   TAL +A H+G +     L+    DVNA+ N   T LH AA  G I IV LL++N   V+ +   G T L  A +    N+ E L K
Sbjct:  758 AAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSK 871          

HSP 9 Score: 59.3066 bits (142), Expect = 1.399e-8
Identity = 40/145 (27.59%), Postives = 65/145 (44.83%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AAK G  + +KL + +   V++  R   + +  AA  G  ++ + L+  GAD+  K     T L  A      ++ + LIN G  VDA  ++  T L  A      N  E LLK    +      G TPL +A     S+++ ++
Sbjct:  327 AAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELL 471          

HSP 10 Score: 59.3066 bits (142), Expect = 1.472e-8
Identity = 41/140 (29.29%), Postives = 67/140 (47.86%), Query Frame = 3
Query: 1599 TFVNMNDAAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLA 2018
            T +++N  A  G+ + ++L L     V+ +     TAL  AA     D+   L+   AD++ K    +T LH A H G I  V++L+     V+A+   G T L  A +     +V  LL     +  +N +GLT L++A
Sbjct:  720 TPLHLNSMA--GNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVA 857          

HSP 11 Score: 56.6102 bits (135), Expect = 9.092e-8
Identity = 40/145 (27.59%), Postives = 66/145 (45.52%), Query Frame = 3
Query: 1620 AAKHGDLDSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
             AK   ++  KL + +G  V+ + +   T L   +  GN ++   L++  ADVN +     T LH AA     DIVE L+   A +  K   G T L  A+   +   V+ LL+K   +  + + G T L LA       ++ ++
Sbjct:  692 VAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLL 836          

HSP 12 Score: 55.8398 bits (133), Expect = 1.617e-7
Identity = 46/147 (31.29%), Postives = 66/147 (44.90%), Query Frame = 3
Query: 1620 AAKHGDLDSIK-LALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKDNFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFNVV-EFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINII 2054
            AA++   ++ K L L      + R R  +T L  A   GN  +   L+N GAD N     ++T LH AA  G  +I  LL+ +    DAK   G TPL  A +  R  V  + LL            GLTPL +A  +    +I ++
Sbjct:  525 AARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELL 671          

HSP 13 Score: 54.6842 bits (130), Expect = 4.139e-7
Identity = 67/277 (24.19%), Postives = 117/277 (42.24%), Query Frame = 3
Query:  210 DYDQIKKLVDNGVEHLINYNEPDNGKTCLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESLAKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGKTVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSIPSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDTQ------NNPIHYAAAGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKG 1022
            +Y  +++L++ G +   N    DN  T L IA  E   +  + LL+    PD    +G + + IA++YG V     L    A +  N L    +    V+    H E +E  L    ++N + K+G T L    +  K   E+  +L+  GA+ N  Q   G TPL     +G+  I    L    D N    +G TA+H AA+    ++ +  +    + D+   TQ      +  +H+   G     K L ++  +   + + G  +  +A  +G
Sbjct:  564 NYSIVEQLLNAGADP--NMVTKDN-YTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLL-LSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAK--KNMIEVTKLLIDRGANVNA-QSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKN--RTDIVEQLLKTEADISTKTQMGYTALHTAVHF---GQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQG 828          
The following BLAST results are available for this feature:
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKEF13.298e-18041.24ankyrin repeat and EF-hand domain containing 1 [So... [more]
ANKEF13.298e-18041.24ankyrin repeat and EF-hand domain containing 1 [So... [more]
ANK38.333e-2423.21ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
TNKS2.573e-2323.77tankyrase [Source:HGNC Symbol;Acc:HGNC:11941][more]
TNKS2.573e-2323.77tankyrase [Source:HGNC Symbol;Acc:HGNC:11941][more]
back to top
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-449.617e-2524.10AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-449.617e-2524.10AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.487e-2424.10AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.487e-2424.10AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.668e-2424.10AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank3.191e-2424.96gene:FBgn0011747 transcript:FBtr0089172[more]
Ank3.191e-2424.96gene:FBgn0011747 transcript:FBtr0300497[more]
Ank3.191e-2424.96gene:FBgn0011747 transcript:FBtr0089171[more]
Ank3.191e-2424.96gene:FBgn0011747 transcript:FBtr0089173[more]
CG100116.726e-2327.82gene:FBgn0039590 transcript:FBtr0085319[more]
back to top
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankef1a0.000e+040.66ankyrin repeat and EF-hand domain containing 1a [S... [more]
ankef1a0.000e+040.66ankyrin repeat and EF-hand domain containing 1a [S... [more]
ankef1b3.213e-14939.49ankyrin repeat and EF-hand domain containing 1b [S... [more]
ankef1b3.213e-14939.49ankyrin repeat and EF-hand domain containing 1b [S... [more]
ank3a2.108e-2522.42ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankef10.000e+041.47ankyrin repeat and EF-hand domain containing 1 [So... [more]
ankef11.727e-17740.70ankyrin repeat and EF-hand domain containing 1 [So... [more]
ANK11.606e-2422.35ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK11.932e-2422.22ankyrin 1 [Source:NCBI gene;Acc:613080][more]
foxj38.956e-2423.38forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185... [more]
back to top
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankef18.460e-17939.90ankyrin repeat and EF-hand domain containing 1 [So... [more]
Ankef18.460e-17939.90ankyrin repeat and EF-hand domain containing 1 [So... [more]
Ankef18.460e-17939.90ankyrin repeat and EF-hand domain containing 1 [So... [more]
Ankef15.530e-9239.81ankyrin repeat and EF-hand domain containing 1 [So... [more]
Ankef12.329e-4847.78ankyrin repeat and EF-hand domain containing 1 [So... [more]
back to top
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NU02|ANKE1_HUMAN1.584e-17941.24Ankyrin repeat and EF-hand domain-containing prote... [more]
sp|Q9D2J7|ANKE1_MOUSE5.918e-17839.90Ankyrin repeat and EF-hand domain-containing prote... [more]
sp|Q6PFX9|TNKS1_MOUSE2.547e-2223.58Poly [ADP-ribose] polymerase tankyrase-1 OS=Mus mu... [more]
sp|O95271|TNKS1_HUMAN3.162e-2223.77Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo s... [more]
sp|G5E8K5|ANK3_MOUSE7.120e-2222.89Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
back to top
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J7J30.000e+051.15ankyrin repeat and EF-hand domain-containing prote... [more]
A0A1S3J7U60.000e+056.05ankyrin repeat and EF-hand domain-containing prote... [more]
A0A1I8JDQ00.000e+046.43ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267GTK00.000e+046.43ANK_REP_REGION domain-containing protein (Fragment... [more]
A0A210QF970.000e+048.07Ankyrin repeat and EF-hand domain-containing prote... [more]
back to top
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankef1a0.000e+041.62ankyrin repeat and EF-hand domain-containing prote... [more]
ankef1a0.000e+041.62ankyrin repeat and EF-hand domain-containing prote... [more]
ankef1a0.000e+041.56ankyrin repeat and EF-hand domain-containing prote... [more]
ankef1b1.418e-17538.39ankyrin repeat and EF-hand domain-containing prote... [more]
ank3a8.538e-2823.48ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankef1b1.810e-10837.57ankyrin repeat and EF-hand domain containing 1b [S... [more]
ankef1b4.798e-7938.16ankyrin repeat and EF-hand domain containing 1b [S... [more]
ENSPMAT00000009608.11.624e-2625.77pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
ENSPMAT00000003991.13.072e-2624.96pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000000095.13.225e-2322.68pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
back to top
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HOS42.613e-1542.86Subunit of the Set3 complex; complex is a meiotic-... [more]
NAS63.544e-833.94Evolutionarily conserved 19S regulatory particle a... [more]
PHO815.893e-836.71Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
AKR21.981e-733.33Ankyrin repeat-containing protein; member of a fam... [more]
AKR14.926e-627.03Palmitoyl transferase involved in protein palmitoy... [more]
back to top
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO280231.335e-1337.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492691.560e-1327.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411012.173e-1336.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411042.173e-1336.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366112.183e-1242.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankef1a7.241e-15536.26ankyrin repeat and EF-hand domain containing 1 [So... [more]
ENSORLT00000038944.11.220e-2124.77tankyrase-1 [Source:NCBI gene;Acc:101158122][more]
tnksb2.769e-2024.77tankyrase-1-like [Source:NCBI gene;Acc:105353570][more]
ankrd441.077e-1923.89ankyrin repeat domain 44 [Source:NCBI gene;Acc:101... [more]
ankrd441.173e-1923.70ankyrin repeat domain 44 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Ankyrin repeat and EF-hand domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006938.10.000e+099.51SMESG000006938.1[more]
SMESG000006940.13.879e-16499.59SMESG000006940.1[more]
SMESG000006940.16.641e-13099.51SMESG000006940.1[more]
SMESG000006933.12.884e-10979.36SMESG000006933.1[more]
SMESG000026655.12.555e-1922.43SMESG000026655.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025084 ID=SMED30025084|Name=Ankyrin repeat and EF-hand domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2749bp
CTTAAAAATGTTATTAAATTTATAATTATATTATAAGCAAGAAAAATATA
TAGCTAATGATTAATTTTAAAGAAAATTCAACCGATATATTTTAATTATT
TTCTATTAAATAAAAATTATTCAAATCTCCTTACAATAAAATGCCTATTG
CTCAATCCAGATTGGAAATATTACAGATTAGAAAAGTTTTGCAATGCACT
TATGAAAAAGATTACGATCAAATAAAAAAACTTGTGGATAATGGAGTTGA
ACACCTTATAAATTACAATGAACCGGATAATGGGAAAACTTGTTTATCAA
TAGCTACGTCGGAAAATGATTTGGATACAATTAAGTTTCTTTTGGATCTG
GGCGCTCATCCTGATGTTGTAGATTTTGAAGGTAAATCAGCTATCATGAT
AGCAGCTCAATATGGCCACGTAGCATCTTTTGAAAGTTTAGCAAAGGCAG
GAGCTGATTTGAAATTAAATGATTTAAATGGAAAAAATGTCCTTTATTAT
TGCGTGTCACCTACAGAAAGACACAAAGAATGCCTTGAAACAGCTTTGCG
CTATAATGTTGATTTGAACAATGTTTCAAAAGACGGGAAGACTGTATTAT
TTCATGCGTGTGAAGATGGAAAGGAAAATGAAGAAATTTGCTTGATTCTT
TTAAAACACGGAGCTGATCCTAATATTATACAAAAAGCAACTGGAAAAAC
TCCATTAATGGCAGCTTGTGCCAGTGGATCGACATCCATCCCGTCTAAAT
GCTTAAAATTAGGAGTAGATCCGAATACAGCCGATAGACATGGTAAAACC
GCAGTTCATTATGCTGCAAAATCTGGTAATTTTAAATCATTGGTTGCCCT
GAGAGCGTTTGGAGCACAATTTGATGTGTATGACGACACACAAAATAATC
CAATACATTATGCAGCTGCTGGGCACGCTTCGTGTTGCAAATTTCTTGGC
CAACGAGGCTGCAATCCTAAAGTAAAAAATTCCAATGGAGAATTTGCTCG
AACCATTGCAAAAGATAAAGGGGCAAAGGATTGCATGAAAGAGGTTATAA
AAGTTGAAAGATCATTTGGGAAACTGGGAAAAAATAACGAGCCATGGGCA
TTGGGATTGTATGATTGGACTGTTGAAAATATGACAGAAATTGTGGAAGA
ATTGAAATTGTTGGATCTAGAAAATTCAGGAATTGTAAATAAAAAAGAAT
TCGTTGATCTTTTAATTCGGTTGAAAGCTCCTCTTAATGAAGAAATTGAA
AAGAAAATTCTGCCTCAATTCGATAAAAACAAAGATGGAACATTTGACTA
TGCTGATTTCCTCACAGGAAAGAAATATGTCAACAAACTTTATTTGATGT
CGGCATTTGAAGGTAAAAAGAAAAAGAAAAAGAAAGGAGGAAAAGGTAAA
AGCAGAAAAAGTAAAATTCCAATTGAAATTTGTGTAATGCCTGAAAGTCA
TATTATGCGACCAATTGATGGAGGTCCTCCGGTTATGTATATTCCGAAAG
AGCAGTATTCAACAGATCTTAATAGATTTTCCAGTGAAAATCCTCCGCAT
AATGAAATTGAAGATGATTGTTCATGGTATATCGGTGATCCCGACAGGAC
ATTTGTAAATATGAATGATGCTGCCAAACATGGAGATTTAGATTCTATTA
AATTAGCACTGAAAAAAGGATATAAAGTCGATACTAGAGATAGATTTTAT
AAAACGGCTTTGATGAGCGCGGCTCATTATGGAAATTTGGACATGTGTAT
GCATTTAATAAATTACGGAGCTGATGTTAATGCAAAAGATAATTTTCACT
GGACACCTTTGCACCACGCGGCTCATTCAGGAATGATTGATATCGTGGAA
CTCCTCATTAATAATGGCGCCGTTGTTGACGCTAAGGCTCTTAATGGAGC
CACTCCTTTATTCAGAGCTATAGAATCGTCTAGGTTTAATGTTGTAGAAT
TTTTGTTAAAGAAAGGTGCAAAAATACAAATGGAAAACAGCAAAGGACTA
ACTCCATTGGACCTCGCGTATAATTGGGCCGATTCTCGTGTAATAAACAT
AATTAAAGCAAAAGTTGACGCTTTACCTCCAGTAAAAGACAAAAAGGGAA
GAGGCAATCAGAAATCTGGTAGAACCAGCTCTAAAGGCCGTCGAACCGCT
AGTCCTACCAAGCCAGTTGAACAGCCACCAGAACCTCCTCAAAGATCATA
CTCAGAACTAGCTCTGAAACGTGCAAATAATTTATTGTCATATTCTAGTA
AACCAGAGGATATTGAAGACATATCCTTTACTCCTCGTTATTTGTTAGTT
AATAGACCTCACCTAGAATCTTTATTGCAAATTCGTCATGAAAGACGTCA
AAGATTTGGTTGGGAAATTGACTTTCCAGATGAATTCCAAAGTTATTTTC
ATAAAAACTTAACAGAGCGAGTTAAAGCGTCTGGTTTGGAGGATTAGATC
TTTATACAATTTTATACTTTTATTATGAGCCTTGTTTCGTTTGTTTTTAT
GAACCATGTTCATCTTCATTCTCAGATTTTTCTGTAGGAGATTTCATTAC
GAAATAGATAACTCATTTATTTTTTATATATGTCGGTTAAAACTTTTATC
TACAATTATTTTCAATTTTTTAAACTGTTTTGTTGTTTTTATTTCATAGA
AAATTGTTACAGCGTTCCTTTCACATATGATATGATAATTTTTCAAGAAT
TTAAAACTATTGCTTATAAAAAATATAGAGTATTTTGTATTATTTCAAT
back to top

protein sequence of SMED30025084-orf-1

>SMED30025084-orf-1 ID=SMED30025084-orf-1|Name=SMED30025084-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=769bp
MPIAQSRLEILQIRKVLQCTYEKDYDQIKKLVDNGVEHLINYNEPDNGKT
CLSIATSENDLDTIKFLLDLGAHPDVVDFEGKSAIMIAAQYGHVASFESL
AKAGADLKLNDLNGKNVLYYCVSPTERHKECLETALRYNVDLNNVSKDGK
TVLFHACEDGKENEEICLILLKHGADPNIIQKATGKTPLMAACASGSTSI
PSKCLKLGVDPNTADRHGKTAVHYAAKSGNFKSLVALRAFGAQFDVYDDT
QNNPIHYAAAGHASCCKFLGQRGCNPKVKNSNGEFARTIAKDKGAKDCMK
EVIKVERSFGKLGKNNEPWALGLYDWTVENMTEIVEELKLLDLENSGIVN
KKEFVDLLIRLKAPLNEEIEKKILPQFDKNKDGTFDYADFLTGKKYVNKL
YLMSAFEGKKKKKKKGGKGKSRKSKIPIEICVMPESHIMRPIDGGPPVMY
IPKEQYSTDLNRFSSENPPHNEIEDDCSWYIGDPDRTFVNMNDAAKHGDL
DSIKLALKKGYKVDTRDRFYKTALMSAAHYGNLDMCMHLINYGADVNAKD
NFHWTPLHHAAHSGMIDIVELLINNGAVVDAKALNGATPLFRAIESSRFN
VVEFLLKKGAKIQMENSKGLTPLDLAYNWADSRVINIIKAKVDALPPVKD
KKGRGNQKSGRTSSKGRRTASPTKPVEQPPEPPQRSYSELALKRANNLLS
YSSKPEDIEDISFTPRYLLVNRPHLESLLQIRHERRQRFGWEIDFPDEFQ
SYFHKNLTERVKASGLED*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR011992EF-hand-dom_pair
IPR020683Ankyrin_rpt-contain_dom
IPR002048EF_hand_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 218..233
score: 35.98
coord: 568..582
score: 40.89
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 47..76
e-value: 0.0043
score: 26.3
coord: 148..179
e-value: 0.0024
score: 27.1
coord: 552..581
e-value: 1.5E-5
score: 34.4
coord: 113..144
e-value: 74.0
score: 12.2
coord: 250..278
e-value: 12.0
score: 14.8
coord: 585..614
e-value: 0.047
score: 22.8
coord: 80..109
e-value: 2.3
score: 17.2
coord: 519..548
e-value: 3.0E-4
score: 30.1
coord: 217..246
e-value: 0.41
score: 19.7
coord: 184..213
e-value: 39.0
score: 13.1
IPR002110Ankyrin repeatPFAMPF13606Ank_3coord: 585..612
e-value: 0.0022
score: 18.3
coord: 148..179
e-value: 0.0031
score: 17.9
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 47..79
score: 10.499
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 148..182
score: 9.511
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 585..617
score: 12.022
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 519..551
score: 10.9
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 217..249
score: 10.446
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 552..584
score: 11.327
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 80..112
score: 10.045
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 184..216
score: 9.19
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 322..392
e-value: 4.7E-9
score: 38.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 648..687
NoneNo IPR availablePANTHERPTHR24127FAMILY NOT NAMEDcoord: 3..741
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 16..318
e-value: 8.6E-61
score: 207.7
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 485..697
e-value: 1.8E-45
score: 157.5
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 491..638
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 46..261
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 493..582
e-value: 3.6E-15
score: 56.3
coord: 20..111
e-value: 1.2E-10
score: 41.8
coord: 189..280
e-value: 5.2E-10
score: 39.8
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 47..638
score: 67.514
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 365..400
score: 8.293
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 329..364
score: 9.52
IPR002048EF-hand domainCDDcd00051EFhcoord: 333..395
e-value: 5.65447E-8
score: 47.9277
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 321..391