Cytoskeleton-associated protein 5-A

Overview
NameCytoskeleton-associated protein 5-A
Smed IDSMED30025079
Length (bp)4003
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytoskeleton-associated protein 5-A (SMED30025079) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytoskeleton-associated protein 5-A (SMED30025079) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytoskeleton-associated protein 5-A (SMED30025079) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytoskeleton-associated protein 5-A (SMED30025079) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025079

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025079h1SMcG0002157 SmedASXL_014938SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30025079h1SMcG0002157 SmedASXL_005047SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30025079h1SMcG0002157 SmedASXL_003790SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30025079h1SMcG0002157 Contig13856newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025079h1SMcG0002157 Contig13856uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025079h1SMcG0002469 Contig45426newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025079h1SMcG0002469 Contig45426uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30025079h1SMcG0002157 dd_Smed_v4_16537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30025079h1SMcG0002157 dd_Smed_v4_16537_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025079h1SMcG0002157 SmWIOct06_010412GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025079h1SMcG0002157 SMED_06293_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025079h1SMcG0002157 SMED_06293_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025079h1SMcG0002157 SMED_11878_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025079h1SMcG0002157 SMED_11878_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025079h1SMcG0002469 SMED_06293_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025079h1SMcG0002469 SMED_06293_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Human
Match: CKAP5 (cytoskeleton associated protein 5 [Source:HGNC Symbol;Acc:HGNC:28959])

HSP 1 Score: 377.096 bits (967), Expect = 3.579e-107
Identity = 208/491 (42.36%), Postives = 301/491 (61.30%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEALK+ Q   +   P ++ +L L+K  V DSNAV Q K LE  L++ +  +V  K   ++  G+V+K FN P+ K +EL  EI  + +EIE+ + V +ELLKGL++KNPK++      L++ L++FG KI+ +K + K + KL E R+K VR+  K + +E+YRWI   AL P L  I  VQ+ EL  E+ KLP   P P+R+L+SQ+  E+ L +    G             PQ    ID Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP I+ +T LF+ R F      +    LL      L     DS PEVR+AAF+ LGTA+KV+ EK + P+L ++  LKL +I E  EK +L
Sbjct:   14 QKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWI-RDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----IDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLADVDKLKLDKIKECSEKVEL 499          

HSP 2 Score: 83.9593 bits (206), Expect = 2.181e-15
Identity = 88/343 (25.66%), Postives = 153/343 (44.61%), Query Frame = 3
Query:  159 NWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNK-----CFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGL 1163
            NWK R+   EE  K +++ D R +    + + +L  K    ++N    +  L +V L AQ  N    +A+ +  G+V+K     C N+ ++    +A   +  +     Q V M       + KNPK  S +   L   + +FG   + +K     V   L   +  VR A   L+  MY ++G + L       KP  +++++AEFEK+  Q  P P+R +             T G D   +   G  P +  + D  DL+   E+  KI +    +I +K W  RK+ L+ +  + N+ K +    G+L  +L   L+ D+N +LV  +  I+ Q+A  +
Sbjct:  612 NWKERLACMEEFQKAVELMD-RTEMPCQALVRMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQVVLDGLVDKIGDVKCGNNAKEAMTAIAEACM--LPWTAEQVVSM-----AFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVKTALAATNPAVRTAAITLLGVMYLYVGPS-LRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGISKHS---------TSGTD---EGEDGDEPDDGSN-DVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPNIGELPTALKGRLN-DSNKILVQQTLNILQQLAVAM 931          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Human
Match: CKAP5 (cytoskeleton associated protein 5 [Source:HGNC Symbol;Acc:HGNC:28959])

HSP 1 Score: 376.711 bits (966), Expect = 3.602e-107
Identity = 209/496 (42.14%), Postives = 303/496 (61.09%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNV-------DIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEALK+ Q   +   P ++ +L L+K  V DSNAV Q K LE  L++ +  +V  K   ++  G+V+K FN P+ K +EL  EI  + +EIE+ + V +ELLKGL++KNPK++      L++ L++FG KI+ +K + K + KL E R+K VR+  K + +E+YRWI   AL P L  I  VQ+ EL  E+ KLP   P P+R+L+SQ+  E+ L +         QQS G   +           ID Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP I+ +T LF+ R F      +    LL      L     DS PEVR+AAF+ LGTA+KV+ EK + P+L ++  LKL +I E  EK +L
Sbjct:   14 QKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWI-RDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQ---------QQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLADVDKLKLDKIKECSEKVEL 499          

HSP 2 Score: 83.9593 bits (206), Expect = 2.077e-15
Identity = 88/343 (25.66%), Postives = 153/343 (44.61%), Query Frame = 3
Query:  159 NWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNK-----CFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGL 1163
            NWK R+   EE  K +++ D R +    + + +L  K    ++N    +  L +V L AQ  N    +A+ +  G+V+K     C N+ ++    +A   +  +     Q V M       + KNPK  S +   L   + +FG   + +K     V   L   +  VR A   L+  MY ++G + L       KP  +++++AEFEK+  Q  P P+R +             T G D   +   G  P +  + D  DL+   E+  KI +    +I +K W  RK+ L+ +  + N+ K +    G+L  +L   L+ D+N +LV  +  I+ Q+A  +
Sbjct:  612 NWKERLACMEEFQKAVELMD-RTEMPCQALVRMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQVVLDGLVDKIGDVKCGNNAKEAMTAIAEACM--LPWTAEQVVSM-----AFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVKTALAATNPAVRTAAITLLGVMYLYVGPS-LRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGISKHS---------TSGTD---EGEDGDEPDDGSN-DVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPNIGELPTALKGRLN-DSNKILVQQTLNILQQLAVAM 931          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Human
Match: CKAP5 (cytoskeleton associated protein 5 [Source:HGNC Symbol;Acc:HGNC:28959])

HSP 1 Score: 376.711 bits (966), Expect = 3.602e-107
Identity = 209/496 (42.14%), Postives = 303/496 (61.09%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNV-------DIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEALK+ Q   +   P ++ +L L+K  V DSNAV Q K LE  L++ +  +V  K   ++  G+V+K FN P+ K +EL  EI  + +EIE+ + V +ELLKGL++KNPK++      L++ L++FG KI+ +K + K + KL E R+K VR+  K + +E+YRWI   AL P L  I  VQ+ EL  E+ KLP   P P+R+L+SQ+  E+ L +         QQS G   +           ID Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP I+ +T LF+ R F      +    LL      L     DS PEVR+AAF+ LGTA+KV+ EK + P+L ++  LKL +I E  EK +L
Sbjct:   14 QKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWI-RDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQ---------QQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLADVDKLKLDKIKECSEKVEL 499          

HSP 2 Score: 83.9593 bits (206), Expect = 2.077e-15
Identity = 88/343 (25.66%), Postives = 153/343 (44.61%), Query Frame = 3
Query:  159 NWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNK-----CFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGL 1163
            NWK R+   EE  K +++ D R +    + + +L  K    ++N    +  L +V L AQ  N    +A+ +  G+V+K     C N+ ++    +A   +  +     Q V M       + KNPK  S +   L   + +FG   + +K     V   L   +  VR A   L+  MY ++G + L       KP  +++++AEFEK+  Q  P P+R +             T G D   +   G  P +  + D  DL+   E+  KI +    +I +K W  RK+ L+ +  + N+ K +    G+L  +L   L+ D+N +LV  +  I+ Q+A  +
Sbjct:  612 NWKERLACMEEFQKAVELMD-RTEMPCQALVRMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQVVLDGLVDKIGDVKCGNNAKEAMTAIAEACM--LPWTAEQVVSM-----AFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVKTALAATNPAVRTAAITLLGVMYLYVGPS-LRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGISKHS---------TSGTD---EGEDGDEPDDGSN-DVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPNIGELPTALKGRLN-DSNKILVQQTLNILQQLAVAM 931          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Human
Match: CKAP5 (cytoskeleton associated protein 5 [Source:HGNC Symbol;Acc:HGNC:28959])

HSP 1 Score: 121.324 bits (303), Expect = 4.293e-31
Identity = 57/128 (44.53%), Postives = 84/128 (65.62%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVV 524
            +K  HK WKAR+ GYEEALK+ Q   +   P ++ +L L+K  V DSNAV Q K LE  L++ +  +V  K   ++  G+V+K FN P+ K +EL  EI  + +EIE+ + V +ELLKGL++KNPK++
Sbjct:   14 QKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKII 141          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Celegans
Match: zyg-9 (Zygote defective protein 9 [Source:UniProtKB/Swiss-Prot;Acc:G5EEM5])

HSP 1 Score: 179.874 bits (455), Expect = 3.002e-45
Identity = 161/506 (31.82%), Postives = 245/506 (48.42%), Query Frame = 3
Query:  156 KNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVI----DSNAVAQEKALEVVLLFAQIVNVD-NKAAKDICPGIVNKCFNSP---RQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVP---MKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQI-----KPVQVTEL----NAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALE-IIEKLTNNPKLVP-GEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLA--NLKLVRINEFCEKA 1601
            K W+ R E  E  LK++   DN    +  SY EL+ ++ +    D+N   Q  A + +  FA  +    +  A  + P I  K        R+   + + E+ + +  +E      +++L  L   NP++   + + +   L+   P   P   +K +     KL  D D++VREA  + +  + R IG   +  +L        K  ++ E      A F +  Q K  P     S  P  SA      GG A    S G       + DP+D +D  +V+SK+P  +   IE KKW +RK+ALE +++ +T NPKL P   YG L++ L KVL KD NI + AL+A  I  IA GLR KF P+AV+   I  EKFKEKK  +   +  CID      N+    + ++ A    NP+I+T+T LF+ R F K N ++   K L  LIP+L     DS  EVR A++  +G  M+ + EK     L ++A  NLK+ +I EF +KA
Sbjct:   27 KKWQERKEALEALLKVLT--DNERLSTKASYAELIGHLQMVLAKDANINCQALAAKCIGKFATGLRAKFSSFAGPLLPVIFEKMKEKKPMLREPLVDCSNEVGRTMQSLE---TGQEDILAALAKPNPQIKQQTALFVARQLDLVVPAKQPKGFIKAVVPVFGKLTGDADQDVREASLQGLGAVQRIIGDKNVKNLLGDASSDEGKMKKIGEYAEKSTASFAE-EQAKNAPPVAPTSSTPSASAASGDPSGGTATAVVSSGAPV---AEADPWDFLDAFDVLSKMPDGFDTNIESKKWQERKEALEGLLQLITANPKLDPKANYGALVERLQKVLEKDANINVAALAANCITGIANGLRTKFQPFAVSVTPIIFEKFKEKKPTLRDPLVACIDAVVATTNLEAVGEIVLAALGKPNPSIKTQTDLFLQRCFMKLNSQTMPKKTLKTLIPSLIKHSGDSDSEVREASYAAMGAMMRAIGEKPSLQLLADIASDNLKMSKIKEFHQKA 523          

HSP 2 Score: 110.153 bits (274), Expect = 7.137e-24
Identity = 76/235 (32.34%), Postives = 129/235 (54.89%), Query Frame = 3
Query:  912 YDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEK-LTNNPKL-VPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCI-DVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLAN--LKLVRINEFCEKA 1601
            +D +D V+++ K+P N+ +  E KKW +RK+ALE + K LT+N +L     Y +L+  L  VL+KD NI   AL+AK I + ATGLR KFS +A   + +  EK KEKK  +   + +C  +V     ++    +D++ A    NP I+ +T LF+ R  +           +  ++P    L  D+  +VR A+ + LG   +++ +K +K  L + ++   K+ +I E+ EK+
Sbjct:    4 WDYLDEVDILPKLPPNFDELRESKKWQERKEALEALLKVLTDNERLSTKASYAELIGHLQMVLAKDANINCQALAAKCIGKFATGLRAKFSSFAGPLLPVIFEKMKEKKPMLREPLVDCSNEVGRTMQSLETGQEDILAALAKPNPQIKQQTALFVARQLDLVVPAKQPKGFIKAVVPVFGKLTGDADQDVREASLQGLGAVQRIIGDKNVKNLLGDASSDEGKMKKIGEYAEKS 238          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Celegans
Match: F54A3.2 (pep chromosome:WBcel235:II:2243642:2254323:1 gene:WBGene00018781.1 transcript:F54A3.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F54A3.2)

HSP 1 Score: 90.1225 bits (222), Expect = 5.466e-18
Identity = 111/494 (22.47%), Postives = 217/494 (43.93%), Query Frame = 3
Query:  162 WKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNM--VID--SNAVAQEKALEVVLLFAQIVNVDNKAAKDI---CPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLL----EDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQ-EKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVD----------IDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLV--PGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKL 1571
            WK R EG E     ++     +  +   Y EL+  +  ++D  SN V    A+  V L A+   +  + A  I    P ++ +  +  ++  R+     +  + +    + +  +L+      +P+       LL  +   F  +  P  +  KT+  L+     + D  VR+   + +  + R IG T    + + I P+      A+ EK+ Q ++     + K Q+       +P  GGD   + S     +N  +          +D ++L++P +   KI  +   Q+ +K W +R    E ++K   N   +       ++ K L+K++ KD N+ + A+SA+I+ +IA   R  F+P A+    +  +K K+KK+ +   +    D + +   ++   + +I A  +KNP  R +T LF++R F K++ ++   + + QL  ++     D+  EVR AA + +    K L E   K  L  + + KL
Sbjct:   31 WKERKEGLEALNTQIEQNPRLSTSTMTIYGELMDELRKILDRESNIVVVTTAIRTVELLAR--GIRQRFAGFIGMVVPFLIKRAKDK-KKNVRDAILAAMGAVADTTTSERLQKDLIDWFGIPSPE---SKKTLLHFLYAYFCRQCTPDIQFIKTIAPLIVKASSESDVTVRDKACQALGSIKRLIGDT----ITAFIGPISTE--TAKIEKINQYQQEAAEEFKKFQE------TQPKAGGDGGAENSAENLDENQENSPEKAEKPQVLDAWELLEPEDCSKKIDKSVETQLIDKNWKERLAGAENVKKSMENAGRIEISERLTEISKLLMKIVEKDVNVNVGAISAQILAEIAKKSRFSFAPLALRAFPVVFDKLKDKKAILRDALVEFCDEAANTTPLSAYSEAVITALSNKNPQARQQTALFLSRFFAKNDPKTVETEAVKQLAEHILKTSNDADKEVREAALRIVAAVQKCLGEGVAKRLLAEVYDDKL 506          

HSP 2 Score: 68.1662 bits (165), Expect = 3.546e-11
Identity = 36/119 (30.25%), Postives = 71/119 (59.66%), Query Frame = 3
Query:  903 IDPYDLVDPVEVISKIPANYYDQIEE--KKWTDRKDALEII-EKLTNNPKLVPGE---YGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNI 1241
            +D +  +D V+V++K PA +   + E   KW +RK+ LE +  ++  NP+L       YG+LM  L K+L +++NIV+V  + + +  +A G+R++F+ +    +   +++ K+KK N+
Sbjct:    1 MDEWQFLDEVDVLAKWPAEHKKAVLEPGAKWKERKEGLEALNTQIEQNPRLSTSTMTIYGELMDELRKILDRESNIVVVTTAIRTVELLARGIRQRFAGFIGMVVPFLIKRAKDKKKNV 119          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Celegans
Match: T08D2.8 (pep chromosome:WBcel235:X:192834:197901:1 gene:WBGene00011613.1 transcript:T08D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T08D2.8)

HSP 1 Score: 63.929 bits (154), Expect = 3.693e-10
Identity = 63/237 (26.58%), Postives = 115/237 (48.52%), Query Frame = 3
Query: 1008 LEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXS--KHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEE---KKL--KPYLDNLANLKLVRINEFCEKAKLEPQLETQISQIQSKFNLKTNPIVSNVNSPP 1697
            +EI E+LT           ++ K L+K++ KD N+ + A+SA+I+ +IA   R  FS  A+    +  +K K+K +    ++R+ + V F     N       + +   +KNP  R +T LF++R F K++ +    + + QL  ++     D+  EVR AA + +    K L E   K+L  + Y D L   KL  + E  EK + E     ++ ++   + + +    S+ ++PP
Sbjct:    7 IEISERLT-----------EISKILMKIVEKDVNVNVGAISAQILAEIAKKSRFSFSALALRAFPVVFDKLKDKNA----ILRDAL-VEFCDEAANTTPLSAYSEAGLSNKNPQARQQTALFLSRFFAKNDPKIVETEEVKQLAEHILKTSNDADKEVRKAALRIVAAVQKCLGEGVAKRLLAEVYHDKLKTEKLPPLIEELEK-EFESSASPEMLRLAKHYKIGS----SSTSAPP 222          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Fly
Match: msps (gene:FBgn0027948 transcript:FBtr0304803)

HSP 1 Score: 377.481 bits (968), Expect = 1.064e-107
Identity = 204/503 (40.56%), Postives = 325/503 (64.61%), Query Frame = 3
Query:  102 MVEEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEK-LTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            M E+   K L   E+  HK WKARV+GYEEA K+ +  D+   P ++ +  L+K MV+DSNA+AQEK LE  L+F +   +  +   D+  GIV KC  +P+ KT+EL+ ++  + VEIE+Q+ V++EL+KG+ +KNPK+VS         L +FG K++ +K + K +  L+ DRDK VR+ GK+L +E+YRWIG+ A+   +S +  V + EL  EF+KL  E+  PSRYLKSQ+ K++ +       DA  +       +   +IDP DL+DPV+++SK+P ++YD++EEKKWT RK++LE++EK LT++PKL  GEYG L+ +L KV++KD+N+VLVA++ K +  +A GL K+FS YA   +   LEKFKEKK N+VT +R  ID  + + ++    + ++ +  +KNP++++ET LF+ R   ++   + + KLL  L  +L     +  P VR+++ + LGT +K++ +K + P L ++  LK+ +I E  EKA++
Sbjct:    1 MAEDTEYKKLPVEERCVHKLWKARVDGYEEAAKIFRELDDEKSPEWSKFAGLIKKMVVDSNALAQEKGLEAALIFVENSGLAGRTVGDVMTGIVQKCIAAPKTKTKELSVQVALMYVEIEKQEAVVEELVKGMEAKNPKIVSACVAATTLALREFGHKVIGVKPLIKKLAPLMSDRDKTVRDEGKQLAVEIYRWIGA-AMKAQISTLPQVTLKELEDEFDKLKGERVEPSRYLKSQQEKQAKIADAAATEDAYNEDDGEAGVE---EIDPMDLLDPVDILSKMPKDFYDKLEEKKWTLRKESLEVLEKLLTDHPKLENGEYGALVSALKKVITKDSNVVLVAMAGKCLALLAKGLAKRFSNYASACVPSLLEKFKEKKPNVVTALREAIDAIYASTSLEAQQESIVESLSNKNPSVKSETALFIARALTRTQPTALNKKLLKLLTTSLVKTLNEPDPTVRDSSAEALGTLIKLMGDKAVTPLLADVDPLKMAKIKECQEKAEI 499          

HSP 2 Score: 67.0106 bits (162), Expect = 1.211e-10
Identity = 92/407 (22.60%), Postives = 169/407 (41.52%), Query Frame = 3
Query:  432 EILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVD----------IDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXS---KHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVR-NAAFKTLGTAM--------KVLEEKKLKPYLDNLANLKLVRIN 1583
            ++L    E  + + V+ ++L      K+PKV S +   +   + +FG ++ P K + + V K ++  +  VR +  +++  M  ++G  AL       KP   +++  EF+K   EKP          PK    V+ + GG A      G  P N  D          I+  DL+  V++  +I      ++ +K W  R + L  ++ + +  +L+    GDL  +L   L  D+N  +   +  I  Q+AT +      +  N     L    + KS +     NCI+ SF          +    +   K  +P ++TE   ++         +S S + ++ ++P+L     D   +VR NA    LG  +        + L+++K     D LA L+  R N
Sbjct:  696 DVLSAFAEATKLEYVVGKVLSFAFEQKSPKVQSEAFNWVNRSIIEFGFQLQP-KTLIEDVRKGVQSTNPTVRASAIQMVGTMSMYMGK-ALMMFFDSEKPALKSQIQVEFDKNVGEKP----------PKPVRGVQRSSGGTA------GNSPDNEDDDGGAAGEEEPINMADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIISEARLIKPSIGDLAPALAHRLV-DSNAKIAQTTLAICEQLATAMGAGCRNHVRNLFPGFLHALGDNKSFVRAAALNCIN-SFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLADKLPGLPPKSVSKEDIHSMVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRALDKQKPASKKDILAALEKARPN 1082          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Fly
Match: msps (gene:FBgn0027948 transcript:FBtr0301479)

HSP 1 Score: 377.481 bits (968), Expect = 1.064e-107
Identity = 204/503 (40.56%), Postives = 325/503 (64.61%), Query Frame = 3
Query:  102 MVEEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEK-LTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            M E+   K L   E+  HK WKARV+GYEEA K+ +  D+   P ++ +  L+K MV+DSNA+AQEK LE  L+F +   +  +   D+  GIV KC  +P+ KT+EL+ ++  + VEIE+Q+ V++EL+KG+ +KNPK+VS         L +FG K++ +K + K +  L+ DRDK VR+ GK+L +E+YRWIG+ A+   +S +  V + EL  EF+KL  E+  PSRYLKSQ+ K++ +       DA  +       +   +IDP DL+DPV+++SK+P ++YD++EEKKWT RK++LE++EK LT++PKL  GEYG L+ +L KV++KD+N+VLVA++ K +  +A GL K+FS YA   +   LEKFKEKK N+VT +R  ID  + + ++    + ++ +  +KNP++++ET LF+ R   ++   + + KLL  L  +L     +  P VR+++ + LGT +K++ +K + P L ++  LK+ +I E  EKA++
Sbjct:    1 MAEDTEYKKLPVEERCVHKLWKARVDGYEEAAKIFRELDDEKSPEWSKFAGLIKKMVVDSNALAQEKGLEAALIFVENSGLAGRTVGDVMTGIVQKCIAAPKTKTKELSVQVALMYVEIEKQEAVVEELVKGMEAKNPKIVSACVAATTLALREFGHKVIGVKPLIKKLAPLMSDRDKTVRDEGKQLAVEIYRWIGA-AMKAQISTLPQVTLKELEDEFDKLKGERVEPSRYLKSQQEKQAKIADAAATEDAYNEDDGEAGVE---EIDPMDLLDPVDILSKMPKDFYDKLEEKKWTLRKESLEVLEKLLTDHPKLENGEYGALVSALKKVITKDSNVVLVAMAGKCLALLAKGLAKRFSNYASACVPSLLEKFKEKKPNVVTALREAIDAIYASTSLEAQQESIVESLSNKNPSVKSETALFIARALTRTQPTALNKKLLKLLTTSLVKTLNEPDPTVRDSSAEALGTLIKLMGDKAVTPLLADVDPLKMAKIKECQEKAEI 499          

HSP 2 Score: 67.0106 bits (162), Expect = 1.211e-10
Identity = 92/407 (22.60%), Postives = 169/407 (41.52%), Query Frame = 3
Query:  432 EILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVD----------IDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXS---KHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVR-NAAFKTLGTAM--------KVLEEKKLKPYLDNLANLKLVRIN 1583
            ++L    E  + + V+ ++L      K+PKV S +   +   + +FG ++ P K + + V K ++  +  VR +  +++  M  ++G  AL       KP   +++  EF+K   EKP          PK    V+ + GG A      G  P N  D          I+  DL+  V++  +I      ++ +K W  R + L  ++ + +  +L+    GDL  +L   L  D+N  +   +  I  Q+AT +      +  N     L    + KS +     NCI+ SF          +    +   K  +P ++TE   ++         +S S + ++ ++P+L     D   +VR NA    LG  +        + L+++K     D LA L+  R N
Sbjct:  696 DVLSAFAEATKLEYVVGKVLSFAFEQKSPKVQSEAFNWVNRSIIEFGFQLQP-KTLIEDVRKGVQSTNPTVRASAIQMVGTMSMYMGK-ALMMFFDSEKPALKSQIQVEFDKNVGEKP----------PKPVRGVQRSSGGTA------GNSPDNEDDDGGAAGEEEPINMADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIISEARLIKPSIGDLAPALAHRLV-DSNAKIAQTTLAICEQLATAMGAGCRNHVRNLFPGFLHALGDNKSFVRAAALNCIN-SFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLADKLPGLPPKSVSKEDIHSMVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRALDKQKPASKKDILAALEKARPN 1082          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Fly
Match: msps (gene:FBgn0027948 transcript:FBtr0304802)

HSP 1 Score: 377.481 bits (968), Expect = 1.181e-107
Identity = 204/503 (40.56%), Postives = 325/503 (64.61%), Query Frame = 3
Query:  102 MVEEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEK-LTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            M E+   K L   E+  HK WKARV+GYEEA K+ +  D+   P ++ +  L+K MV+DSNA+AQEK LE  L+F +   +  +   D+  GIV KC  +P+ KT+EL+ ++  + VEIE+Q+ V++EL+KG+ +KNPK+VS         L +FG K++ +K + K +  L+ DRDK VR+ GK+L +E+YRWIG+ A+   +S +  V + EL  EF+KL  E+  PSRYLKSQ+ K++ +       DA  +       +   +IDP DL+DPV+++SK+P ++YD++EEKKWT RK++LE++EK LT++PKL  GEYG L+ +L KV++KD+N+VLVA++ K +  +A GL K+FS YA   +   LEKFKEKK N+VT +R  ID  + + ++    + ++ +  +KNP++++ET LF+ R   ++   + + KLL  L  +L     +  P VR+++ + LGT +K++ +K + P L ++  LK+ +I E  EKA++
Sbjct:    1 MAEDTEYKKLPVEERCVHKLWKARVDGYEEAAKIFRELDDEKSPEWSKFAGLIKKMVVDSNALAQEKGLEAALIFVENSGLAGRTVGDVMTGIVQKCIAAPKTKTKELSVQVALMYVEIEKQEAVVEELVKGMEAKNPKIVSACVAATTLALREFGHKVIGVKPLIKKLAPLMSDRDKTVRDEGKQLAVEIYRWIGA-AMKAQISTLPQVTLKELEDEFDKLKGERVEPSRYLKSQQEKQAKIADAAATEDAYNEDDGEAGVE---EIDPMDLLDPVDILSKMPKDFYDKLEEKKWTLRKESLEVLEKLLTDHPKLENGEYGALVSALKKVITKDSNVVLVAMAGKCLALLAKGLAKRFSNYASACVPSLLEKFKEKKPNVVTALREAIDAIYASTSLEAQQESIVESLSNKNPSVKSETALFIARALTRTQPTALNKKLLKLLTTSLVKTLNEPDPTVRDSSAEALGTLIKLMGDKAVTPLLADVDPLKMAKIKECQEKAEI 499          

HSP 2 Score: 67.0106 bits (162), Expect = 1.223e-10
Identity = 92/407 (22.60%), Postives = 169/407 (41.52%), Query Frame = 3
Query:  432 EILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVD----------IDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXS---KHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVR-NAAFKTLGTAM--------KVLEEKKLKPYLDNLANLKLVRIN 1583
            ++L    E  + + V+ ++L      K+PKV S +   +   + +FG ++ P K + + V K ++  +  VR +  +++  M  ++G  AL       KP   +++  EF+K   EKP          PK    V+ + GG A      G  P N  D          I+  DL+  V++  +I      ++ +K W  R + L  ++ + +  +L+    GDL  +L   L  D+N  +   +  I  Q+AT +      +  N     L    + KS +     NCI+ SF          +    +   K  +P ++TE   ++         +S S + ++ ++P+L     D   +VR NA    LG  +        + L+++K     D LA L+  R N
Sbjct:  696 DVLSAFAEATKLEYVVGKVLSFAFEQKSPKVQSEAFNWVNRSIIEFGFQLQP-KTLIEDVRKGVQSTNPTVRASAIQMVGTMSMYMGK-ALMMFFDSEKPALKSQIQVEFDKNVGEKP----------PKPVRGVQRSSGGTA------GNSPDNEDDDGGAAGEEEPINMADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIISEARLIKPSIGDLAPALAHRLV-DSNAKIAQTTLAICEQLATAMGAGCRNHVRNLFPGFLHALGDNKSFVRAAALNCIN-SFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLADKLPGLPPKSVSKEDIHSMVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRALDKQKPASKKDILAALEKARPN 1082          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Fly
Match: msps (gene:FBgn0027948 transcript:FBtr0304801)

HSP 1 Score: 377.481 bits (968), Expect = 1.193e-107
Identity = 204/503 (40.56%), Postives = 325/503 (64.61%), Query Frame = 3
Query:  102 MVEEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEK-LTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            M E+   K L   E+  HK WKARV+GYEEA K+ +  D+   P ++ +  L+K MV+DSNA+AQEK LE  L+F +   +  +   D+  GIV KC  +P+ KT+EL+ ++  + VEIE+Q+ V++EL+KG+ +KNPK+VS         L +FG K++ +K + K +  L+ DRDK VR+ GK+L +E+YRWIG+ A+   +S +  V + EL  EF+KL  E+  PSRYLKSQ+ K++ +       DA  +       +   +IDP DL+DPV+++SK+P ++YD++EEKKWT RK++LE++EK LT++PKL  GEYG L+ +L KV++KD+N+VLVA++ K +  +A GL K+FS YA   +   LEKFKEKK N+VT +R  ID  + + ++    + ++ +  +KNP++++ET LF+ R   ++   + + KLL  L  +L     +  P VR+++ + LGT +K++ +K + P L ++  LK+ +I E  EKA++
Sbjct:    1 MAEDTEYKKLPVEERCVHKLWKARVDGYEEAAKIFRELDDEKSPEWSKFAGLIKKMVVDSNALAQEKGLEAALIFVENSGLAGRTVGDVMTGIVQKCIAAPKTKTKELSVQVALMYVEIEKQEAVVEELVKGMEAKNPKIVSACVAATTLALREFGHKVIGVKPLIKKLAPLMSDRDKTVRDEGKQLAVEIYRWIGA-AMKAQISTLPQVTLKELEDEFDKLKGERVEPSRYLKSQQEKQAKIADAAATEDAYNEDDGEAGVE---EIDPMDLLDPVDILSKMPKDFYDKLEEKKWTLRKESLEVLEKLLTDHPKLENGEYGALVSALKKVITKDSNVVLVAMAGKCLALLAKGLAKRFSNYASACVPSLLEKFKEKKPNVVTALREAIDAIYASTSLEAQQESIVESLSNKNPSVKSETALFIARALTRTQPTALNKKLLKLLTTSLVKTLNEPDPTVRDSSAEALGTLIKLMGDKAVTPLLADVDPLKMAKIKECQEKAEI 499          

HSP 2 Score: 67.0106 bits (162), Expect = 1.287e-10
Identity = 92/407 (22.60%), Postives = 169/407 (41.52%), Query Frame = 3
Query:  432 EILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVD----------IDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXS---KHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVR-NAAFKTLGTAM--------KVLEEKKLKPYLDNLANLKLVRIN 1583
            ++L    E  + + V+ ++L      K+PKV S +   +   + +FG ++ P K + + V K ++  +  VR +  +++  M  ++G  AL       KP   +++  EF+K   EKP          PK    V+ + GG A      G  P N  D          I+  DL+  V++  +I      ++ +K W  R + L  ++ + +  +L+    GDL  +L   L  D+N  +   +  I  Q+AT +      +  N     L    + KS +     NCI+ SF          +    +   K  +P ++TE   ++         +S S + ++ ++P+L     D   +VR NA    LG  +        + L+++K     D LA L+  R N
Sbjct:  696 DVLSAFAEATKLEYVVGKVLSFAFEQKSPKVQSEAFNWVNRSIIEFGFQLQP-KTLIEDVRKGVQSTNPTVRASAIQMVGTMSMYMGK-ALMMFFDSEKPALKSQIQVEFDKNVGEKP----------PKPVRGVQRSSGGTA------GNSPDNEDDDGGAAGEEEPINMADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIISEARLIKPSIGDLAPALAHRLV-DSNAKIAQTTLAICEQLATAMGAGCRNHVRNLFPGFLHALGDNKSFVRAAALNCIN-SFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLADKLPGLPPKSVSKEDIHSMVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRALDKQKPASKKDILAALEKARPN 1082          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Fly
Match: msps (gene:FBgn0027948 transcript:FBtr0301480)

HSP 1 Score: 377.096 bits (967), Expect = 1.371e-107
Identity = 204/503 (40.56%), Postives = 325/503 (64.61%), Query Frame = 3
Query:  102 MVEEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEK-LTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            M E+   K L   E+  HK WKARV+GYEEA K+ +  D+   P ++ +  L+K MV+DSNA+AQEK LE  L+F +   +  +   D+  GIV KC  +P+ KT+EL+ ++  + VEIE+Q+ V++EL+KG+ +KNPK+VS         L +FG K++ +K + K +  L+ DRDK VR+ GK+L +E+YRWIG+ A+   +S +  V + EL  EF+KL  E+  PSRYLKSQ+ K++ +       DA  +       +   +IDP DL+DPV+++SK+P ++YD++EEKKWT RK++LE++EK LT++PKL  GEYG L+ +L KV++KD+N+VLVA++ K +  +A GL K+FS YA   +   LEKFKEKK N+VT +R  ID  + + ++    + ++ +  +KNP++++ET LF+ R   ++   + + KLL  L  +L     +  P VR+++ + LGT +K++ +K + P L ++  LK+ +I E  EKA++
Sbjct:    1 MAEDTEYKKLPVEERCVHKLWKARVDGYEEAAKIFRELDDEKSPEWSKFAGLIKKMVVDSNALAQEKGLEAALIFVENSGLAGRTVGDVMTGIVQKCIAAPKTKTKELSVQVALMYVEIEKQEAVVEELVKGMEAKNPKIVSACVAATTLALREFGHKVIGVKPLIKKLAPLMSDRDKTVRDEGKQLAVEIYRWIGA-AMKAQISTLPQVTLKELEDEFDKLKGERVEPSRYLKSQQEKQAKIADAAATEDAYNEDDGEAGVE---EIDPMDLLDPVDILSKMPKDFYDKLEEKKWTLRKESLEVLEKLLTDHPKLENGEYGALVSALKKVITKDSNVVLVAMAGKCLALLAKGLAKRFSNYASACVPSLLEKFKEKKPNVVTALREAIDAIYASTSLEAQQESIVESLSNKNPSVKSETALFIARALTRTQPTALNKKLLKLLTTSLVKTLNEPDPTVRDSSAEALGTLIKLMGDKAVTPLLADVDPLKMAKIKECQEKAEI 499          

HSP 2 Score: 67.0106 bits (162), Expect = 1.210e-10
Identity = 92/407 (22.60%), Postives = 169/407 (41.52%), Query Frame = 3
Query:  432 EILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVD----------IDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXS---KHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVR-NAAFKTLGTAM--------KVLEEKKLKPYLDNLANLKLVRIN 1583
            ++L    E  + + V+ ++L      K+PKV S +   +   + +FG ++ P K + + V K ++  +  VR +  +++  M  ++G  AL       KP   +++  EF+K   EKP          PK    V+ + GG A      G  P N  D          I+  DL+  V++  +I      ++ +K W  R + L  ++ + +  +L+    GDL  +L   L  D+N  +   +  I  Q+AT +      +  N     L    + KS +     NCI+ SF          +    +   K  +P ++TE   ++         +S S + ++ ++P+L     D   +VR NA    LG  +        + L+++K     D LA L+  R N
Sbjct:  696 DVLSAFAEATKLEYVVGKVLSFAFEQKSPKVQSEAFNWVNRSIIEFGFQLQP-KTLIEDVRKGVQSTNPTVRASAIQMVGTMSMYMGK-ALMMFFDSEKPALKSQIQVEFDKNVGEKP----------PKPVRGVQRSSGGTA------GNSPDNEDDDGGAAGEEEPINMADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIISEARLIKPSIGDLAPALAHRLV-DSNAKIAQTTLAICEQLATAMGAGCRNHVRNLFPGFLHALGDNKSFVRAAALNCIN-SFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLADKLPGLPPKSVSKEDIHSMVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRALDKQKPASKKDILAALEKARPN 1082          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Zebrafish
Match: ckap5 (cytoskeleton associated protein 5 [Source:ZFIN;Acc:ZDB-GENE-051120-174])

HSP 1 Score: 374.4 bits (960), Expect = 1.436e-106
Identity = 205/490 (41.84%), Postives = 301/490 (61.43%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESAL-VKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEALKL Q  D ++ P ++ YL L+K  V +SNAVAQ K LE  L F +  +V  K   ++  G+VNK FN P+ + +EL  EI  + +EIE+ +VV DEL+KGL++KNPK+V      L++ L +FG KI+ +K + K + KL E R+K VR+  K L +E+YRWI   AL   L  I  VQ+ EL  E+ K+P   P   R+L+SQ+  ++    +   GGD        +     V +D Y+L++ VE++SK+P ++Y++IE KKW +RK+ALE +E LT NPKL  G+YGDL+++L KV+ KD N++LV+++AK +  +ATGLRKKF  YA   +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP+I+ +  LF+ R F      +    +L            DS PEVR+AAF+ LGTAMKV+ EK + P+L ++  LKL +I E  +K +L
Sbjct:   14 QKCEHKVWKARLSGYEEALKLFQKLDEKS-PEWSKYLGLIKKFVTESNAVAQLKGLEAALAFIENAHVAGKTVGEVVSGVVNKVFNQPKARAKELGTEICLMYIEIEKAEVVQDELIKGLDNKNPKIVVACIEALRKALCEFGSKIITLKPVVKVLPKLFESREKAVRDEAKLLAVEIYRWI-RDALRAPLQNINSVQLKELEEEWVKVPATAPKQIRFLRSQQDLKAKFEQQQAAGGDEADGDD--EEVAEAVQVDAYELLEAVEILSKLPKDFYEKIEAKKWQERKEALEAVEALTKNPKLESGDYGDLVRALKKVIGKDANVMLVSMAAKCLAGLATGLRKKFGTYAGLVVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPSIKQQASLFLARSFRHCTPSTLPKSVLKPFCAAFLKQVNDSAPEVRDAAFEALGTAMKVIGEKAVNPFLTDVDKLKLDKIKECADKVEL 499          

HSP 2 Score: 65.0846 bits (157), Expect = 7.952e-10
Identity = 104/457 (22.76%), Postives = 186/457 (40.70%), Query Frame = 3
Query:  159 NWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCID--VSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAM 1511
            NWK R+   EE  K ++  D    P   + +++L  K    ++N    +  L +V L AQ       +A  +  G+V+K  +    K    A E L  I E        ++++      KNPK  + +   L   + +FG   + +K     V   L   +  VR +   L+  MY ++G+  L       KP  +++++AEF K+  Q  P P+R  K    +E   V      D       G         D  D++   ++  KI +    +I +K W  RK+ L+ +  + +  K +    G+L  +L   L+ D+N +LV  +  I+ QIA  +      +  N     +    + K N+       ++  V    +      +DL    K +NP +R E + +++       + +    L+   +P+L T  +D   +VR  A   L T M
Sbjct:  596 NWKERLASMEEFQKAVEQMDKSEMPC-QALVKMLAKKPGWKETNFQVMQMKLSIVGLVAQKGQFSKTSALVVLDGLVDKIGDV---KCGGNAKEALTAIGEACSLPWTAEQVVSIAFAQKNPKNQAETLNWLANAMKEFGFAGINVKGFINNVKTALGATNPAVRTSAIALLGVMYLYMGAP-LRMFFEDEKPALLSQIDAEFVKMQGQSPPAPTRGAKKAGAEEDGDVADEDEADG----GAG---------DIMDMLPRTDISDKITSEMVSKISDKNWKIRKEGLDEVAAVISEAKFIQANIGELPMALKGRLN-DSNKLLVQQTLNILQQIAIAMGPSLKQHVKNLGIPVVTVLGDSKPNVRATAMATLNAWVEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLSEKL--PTLRTVPADLM-LCVPHLYTCLEDRSGDVRKKAQDALPTFM 1030          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Zebrafish
Match: ckap5 (cytoskeleton associated protein 5 [Source:ZFIN;Acc:ZDB-GENE-051120-174])

HSP 1 Score: 374.015 bits (959), Expect = 2.124e-106
Identity = 205/490 (41.84%), Postives = 301/490 (61.43%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESAL-VKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEALKL Q  D ++ P ++ YL L+K  V +SNAVAQ K LE  L F +  +V  K   ++  G+VNK FN P+ + +EL  EI  + +EIE+ +VV DEL+KGL++KNPK+V      L++ L +FG KI+ +K + K + KL E R+K VR+  K L +E+YRWI   AL   L  I  VQ+ EL  E+ K+P   P   R+L+SQ+  ++    +   GGD        +     V +D Y+L++ VE++SK+P ++Y++IE KKW +RK+ALE +E LT NPKL  G+YGDL+++L KV+ KD N++LV+++AK +  +ATGLRKKF  YA   +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP+I+ +  LF+ R F      +    +L            DS PEVR+AAF+ LGTAMKV+ EK + P+L ++  LKL +I E  +K +L
Sbjct:   14 QKCEHKVWKARLSGYEEALKLFQKLDEKS-PEWSKYLGLIKKFVTESNAVAQLKGLEAALAFIENAHVAGKTVGEVVSGVVNKVFNQPKARAKELGTEICLMYIEIEKAEVVQDELIKGLDNKNPKIVVACIEALRKALCEFGSKIITLKPVVKVLPKLFESREKAVRDEAKLLAVEIYRWI-RDALRAPLQNINSVQLKELEEEWVKVPATAPKQIRFLRSQQDLKAKFEQQQAAGGDEADGDD--EEVAEAVQVDAYELLEAVEILSKLPKDFYEKIEAKKWQERKEALEAVEALTKNPKLESGDYGDLVRALKKVIGKDANVMLVSMAAKCLAGLATGLRKKFGTYAGLVVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPSIKQQASLFLARSFRHCTPSTLPKSVLKPFCAAFLKQVNDSAPEVRDAAFEALGTAMKVIGEKAVNPFLTDVDKLKLDKIKECADKVEL 499          

HSP 2 Score: 64.6994 bits (156), Expect = 8.744e-10
Identity = 104/457 (22.76%), Postives = 186/457 (40.70%), Query Frame = 3
Query:  159 NWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCID--VSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAM 1511
            NWK R+   EE  K ++  D    P   + +++L  K    ++N    +  L +V L AQ       +A  +  G+V+K  +    K    A E L  I E        ++++      KNPK  + +   L   + +FG   + +K     V   L   +  VR +   L+  MY ++G+  L       KP  +++++AEF K+  Q  P P+R  K    +E   V      D       G         D  D++   ++  KI +    +I +K W  RK+ L+ +  + +  K +    G+L  +L   L+ D+N +LV  +  I+ QIA  +      +  N     +    + K N+       ++  V    +      +DL    K +NP +R E + +++       + +    L+   +P+L T  +D   +VR  A   L T M
Sbjct:  596 NWKERLASMEEFQKAVEQMDKSEMPC-QALVKMLAKKPGWKETNFQVMQMKLSIVGLVAQKGQFSKTSALVVLDGLVDKIGDV---KCGGNAKEALTAIGEACSLPWTAEQVVSIAFAQKNPKNQAETLNWLANAMKEFGFAGINVKGFINNVKTALGATNPAVRTSAIALLGVMYLYMGAP-LRMFFEDEKPALLSQIDAEFVKMQGQSPPAPTRGAKKAGAEEDGDVADEDEADG----GAG---------DIMDMLPRTDISDKITSEMVSKISDKNWKIRKEGLDEVAAVISEAKFIQANIGELPMALKGRLN-DSNKLLVQQTLNILQQIAIAMGPSLKQHVKNLGIPVVTVLGDSKPNVRATAMATLNAWVEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLSEKL--PTLRTVPADLM-LCVPHLYTCLEDRSGDVRKKAQDALPTFM 1030          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Zebrafish
Match: ckap5 (cytoskeleton associated protein 5 [Source:ZFIN;Acc:ZDB-GENE-051120-174])

HSP 1 Score: 128.257 bits (321), Expect = 1.010e-33
Identity = 64/129 (49.61%), Postives = 88/129 (68.22%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVS 527
            +K  HK WKAR+ GYEEALKL Q  D ++ P ++ YL L+K  V +SNAVAQ K LE  L F +  +V  K   ++  G+VNK FN P+ + +EL  EI  + +EIE+ +VV DEL+KGL++KNPK+VS
Sbjct:   14 QKCEHKVWKARLSGYEEALKLFQKLDEKS-PEWSKYLGLIKKFVTESNAVAQLKGLEAALAFIENAHVAGKTVGEVVSGVVNKVFNQPKARAKELGTEICLMYIEIEKAEVVQDELIKGLDNKNPKIVS 141          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Zebrafish
Match: ckap5 (cytoskeleton associated protein 5 [Source:ZFIN;Acc:ZDB-GENE-051120-174])

HSP 1 Score: 121.324 bits (303), Expect = 3.236e-27
Identity = 61/125 (48.80%), Postives = 84/125 (67.20%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNP 515
            +K  HK WKAR+ GYEEALKL Q  D ++ P ++ YL L+K  V +SNAVAQ K LE  L F +  +V  K   ++  G+VNK FN P+ + +EL  EI  + +EIE+ +VV DEL+KGL++KNP
Sbjct:   14 QKCEHKVWKARLSGYEEALKLFQKLDEKS-PEWSKYLGLIKKFVTESNAVAQLKGLEAALAFIENAHVAGKTVGEVVSGVVNKVFNQPKARAKELGTEICLMYIEIEKAEVVQDELIKGLDNKNP 137          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Xenopus
Match: CKAP5 (cytoskeleton associated protein 5 [Source:NCBI gene;Acc:100145713])

HSP 1 Score: 385.185 bits (988), Expect = 4.905e-110
Identity = 212/494 (42.91%), Postives = 303/494 (61.34%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESAL--VKPTGGGDA---VPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEA+KL Q   +   P ++ YL L+K  V +SNAVAQ K LE  L++ +  +V  K   ++  G+VNK FN P+ + +EL  +I  + VEIE+ + V +ELLKGL++KNPK+V      L++ L++FG KI+ +K + K + KL E R+K VR+  K L +E+YRWI   AL P L  I PVQ+ EL  E+ KLPQ  P  SR+L+SQ+  ++     +  GG D    VPQ            +D Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPK+  G++ DL+K+L K++ KDTN++LVAL+AK I  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP I+ +T LF+ R F      +    LL      L     DS PEVR+AAF+ LGTA KV+ EK + P+L  +  LKL RI E  EK +L
Sbjct:   14 QKCEHKVWKARLNGYEEAVKLFQKIVDEKSPEWSKYLGLIKKFVTESNAVAQLKGLEAALVYVENAHVAGKTTGEVVSGVVNKVFNQPKARAKELGADICLMYVEIEKAEAVQEELLKGLDNKNPKIVVACVETLRKALSEFGSKIMTLKPIIKVLPKLFESREKAVRDEAKLLAVEIYRWI-RDALRPPLQNINPVQLKELEEEWVKLPQSAPKQSRFLRSQQDLKAKFEQQQQAGGDDGEEVVPQ------------VDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALEAVEALVKNPKIEAGDFADLVKALKKIVGKDTNVMLVALAAKCIAGLAAGLRKKFGSYAGHIVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFLARSFRHCTPSTLPKSLLKPFCAALLKQINDSAPEVRDAAFEALGTAQKVVGEKAVNPFLAEVDKLKLDRIKECAEKVEL 494          

HSP 2 Score: 70.0922 bits (170), Expect = 2.746e-11
Identity = 86/367 (23.43%), Postives = 156/367 (42.51%), Query Frame = 3
Query:  153 HKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNI 1241
            + NWK R+   EE  K ++  + RND    + +++L  K    ++N    +  L +V L AQ  N    +A  +  G+V+K  +    K    A E L  I E        ++++      KNPK  S +   L   + +FG   + +K     V   L   +  +R +   L+  MY ++G+  L     + KP  +++++AEF+K+  Q  P P+R                       +   G+    +   D  DL+   E+  KI ++   +I +K W  RK+ L+ +  + N  K +    G+L  S LK    D+N +LV  +  I+ Q++T +      +  N     +    + K+N+
Sbjct:  587 YNNWKERLASMEEFQKAVETME-RNDIPCQALVKMLAKKPGFKETNFQVMQMKLHIVALVAQKGNFSKTSAYVVLDGLVDKVGDV---KCGVNAKEALSGIAEACNLPWTAEQVVSLAFAQKNPKNQSETLNWLSNAIKEFGFTGINVKAFINNVKTALAATNPAIRTSAITLLGVMYLYMGA-PLRMFFEEEKPALLSQIDAEFDKMKGQTPPPPTRGSSKHGSGGGD------------EAEEGEEQDEDAPADVMDLLPRTEINDKISSDLVSKIGDKNWKIRKEGLDEVTAIINEAKFIQPNIGEL-PSALKARLNDSNKILVQQTLTILQQLSTAMGPNIKQHVKNLGMPIISVLGDSKANV 935          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Xenopus
Match: CKAP5 (cytoskeleton associated protein 5 [Source:NCBI gene;Acc:100145713])

HSP 1 Score: 385.185 bits (988), Expect = 4.942e-110
Identity = 212/494 (42.91%), Postives = 303/494 (61.34%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESAL--VKPTGGGDA---VPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEA+KL Q   +   P ++ YL L+K  V +SNAVAQ K LE  L++ +  +V  K   ++  G+VNK FN P+ + +EL  +I  + VEIE+ + V +ELLKGL++KNPK+V      L++ L++FG KI+ +K + K + KL E R+K VR+  K L +E+YRWI   AL P L  I PVQ+ EL  E+ KLPQ  P  SR+L+SQ+  ++     +  GG D    VPQ            +D Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPK+  G++ DL+K+L K++ KDTN++LVAL+AK I  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP I+ +T LF+ R F      +    LL      L     DS PEVR+AAF+ LGTA KV+ EK + P+L  +  LKL RI E  EK +L
Sbjct:   14 QKCEHKVWKARLNGYEEAVKLFQKIVDEKSPEWSKYLGLIKKFVTESNAVAQLKGLEAALVYVENAHVAGKTTGEVVSGVVNKVFNQPKARAKELGADICLMYVEIEKAEAVQEELLKGLDNKNPKIVVACVETLRKALSEFGSKIMTLKPIIKVLPKLFESREKAVRDEAKLLAVEIYRWI-RDALRPPLQNINPVQLKELEEEWVKLPQSAPKQSRFLRSQQDLKAKFEQQQQAGGDDGEEVVPQ------------VDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALEAVEALVKNPKIEAGDFADLVKALKKIVGKDTNVMLVALAAKCIAGLAAGLRKKFGSYAGHIVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFLARSFRHCTPSTLPKSLLKPFCAALLKQINDSAPEVRDAAFEALGTAQKVVGEKAVNPFLAEVDKLKLDRIKECAEKVEL 494          

HSP 2 Score: 65.855 bits (159), Expect = 6.019e-10
Identity = 83/372 (22.31%), Postives = 148/372 (39.78%), Query Frame = 3
Query:  132 NTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNI 1241
            +  +++   NWK R+   EE               F      L N+   S     +  L +V L AQ  N    +A  +  G+V+K  +    K    A E L  I E        ++++      KNPK  S +   L   + +FG   + +K     V   L   +  +R +   L+  MY ++G+  L     + KP  +++++AEF+K+  Q  P P+R                       +   G+    +   D  DL+   E+  KI ++   +I +K W  RK+ L+ +  + N  K +    G+L  S LK    D+N +LV  +  I+ Q++T +      +  N     +    + K+N+
Sbjct:  589 SCMQQLDSNNWKERLASMEE---------------FQKVTTKLFNLCFISGLQVMQMKLHIVALVAQKGNFSKTSAYVVLDGLVDKVGDV---KCGVNAKEALSGIAEACNLPWTAEQVVSLAFAQKNPKNQSETLNWLSNAIKEFGFTGINVKAFINNVKTALAATNPAIRTSAITLLGVMYLYMGAP-LRMFFEEEKPALLSQIDAEFDKMKGQTPPPPTRGSSKHGSGGGD------------EAEEGEEQDEDAPADVMDLLPRTEINDKISSDLVSKIGDKNWKIRKEGLDEVTAIINEAKFIQPNIGEL-PSALKARLNDSNKILVQQTLTILQQLSTAMGPNIKQHVKNLGMPIISVLGDSKANV 928          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Xenopus
Match: CKAP5 (cytoskeleton associated protein 5 [Source:NCBI gene;Acc:100145713])

HSP 1 Score: 385.185 bits (988), Expect = 5.644e-110
Identity = 212/494 (42.91%), Postives = 303/494 (61.34%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESAL--VKPTGGGDA---VPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEA+KL Q   +   P ++ YL L+K  V +SNAVAQ K LE  L++ +  +V  K   ++  G+VNK FN P+ + +EL  +I  + VEIE+ + V +ELLKGL++KNPK+V      L++ L++FG KI+ +K + K + KL E R+K VR+  K L +E+YRWI   AL P L  I PVQ+ EL  E+ KLPQ  P  SR+L+SQ+  ++     +  GG D    VPQ            +D Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPK+  G++ DL+K+L K++ KDTN++LVAL+AK I  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP I+ +T LF+ R F      +    LL      L     DS PEVR+AAF+ LGTA KV+ EK + P+L  +  LKL RI E  EK +L
Sbjct:   14 QKCEHKVWKARLNGYEEAVKLFQKIVDEKSPEWSKYLGLIKKFVTESNAVAQLKGLEAALVYVENAHVAGKTTGEVVSGVVNKVFNQPKARAKELGADICLMYVEIEKAEAVQEELLKGLDNKNPKIVVACVETLRKALSEFGSKIMTLKPIIKVLPKLFESREKAVRDEAKLLAVEIYRWI-RDALRPPLQNINPVQLKELEEEWVKLPQSAPKQSRFLRSQQDLKAKFEQQQQAGGDDGEEVVPQ------------VDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALEAVEALVKNPKIEAGDFADLVKALKKIVGKDTNVMLVALAAKCIAGLAAGLRKKFGSYAGHIVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFLARSFRHCTPSTLPKSLLKPFCAALLKQINDSAPEVRDAAFEALGTAQKVVGEKAVNPFLAEVDKLKLDRIKECAEKVEL 494          

HSP 2 Score: 70.0922 bits (170), Expect = 2.769e-11
Identity = 86/374 (22.99%), Postives = 159/374 (42.51%), Query Frame = 3
Query:  132 NTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNI 1241
            +  +++   NWK R+   EE  K ++  + RND    + +++L  K    ++N    +  L +V L AQ  N    +A  +  G+V+K  +    K    A E L  I E        ++++      KNPK  S +   L   + +FG   + +K     V   L   +  +R +   L+  MY ++G+  L     + KP  +++++AEF+K+  Q  P P+R                       +   G+    +   D  DL+   E+  KI ++   +I +K W  RK+ L+ +  + N  K +    G+L  S LK    D+N +LV  +  I+ Q++T +      +  N     +    + K+N+
Sbjct:  576 SCMQQLDSNNWKERLASMEEFQKAVETME-RNDIPCQALVKMLAKKPGFKETNFQVMQMKLHIVALVAQKGNFSKTSAYVVLDGLVDKVGDV---KCGVNAKEALSGIAEACNLPWTAEQVVSLAFAQKNPKNQSETLNWLSNAIKEFGFTGINVKAFINNVKTALAATNPAIRTSAITLLGVMYLYMGAP-LRMFFEEEKPALLSQIDAEFDKMKGQTPPPPTRGSSKHGSGGGD------------EAEEGEEQDEDAPADVMDLLPRTEINDKISSDLVSKIGDKNWKIRKEGLDEVTAIINEAKFIQPNIGEL-PSALKARLNDSNKILVQQTLTILQQLSTAMGPNIKQHVKNLGMPIISVLGDSKANV 931          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Xenopus
Match: CKAP5 (cytoskeleton associated protein 5 [Source:NCBI gene;Acc:100145713])

HSP 1 Score: 378.252 bits (970), Expect = 1.234e-107
Identity = 209/491 (42.57%), Postives = 301/491 (61.30%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEA+KL Q   +   P ++ YL L+K  V +SNAVAQ K LE  L++ +  +V  K   ++  G+VNK FN P+ + +EL  +I  + VEIE+ + V +ELLKGL++KNPK+V      L++ L++FG KI+ +K + K + KL E R+K VR+  K L +E+YRWI   AL P L  I PVQ+ EL  E+ KLPQ  P  SR+L+SQ+  ++   +    G         +   PQ    +D Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPK+  G++ DL+K+L K++ KDTN++LVAL+AK I  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP I+ +T LF+ R F      +    LL      L     DS PEVR+AAF+ LGTA KV+ EK + P+L  +  LKL RI E  EK +L
Sbjct:   14 QKCEHKVWKARLNGYEEAVKLFQKIVDEKSPEWSKYLGLIKKFVTESNAVAQLKGLEAALVYVENAHVAGKTTGEVVSGVVNKVFNQPKARAKELGADICLMYVEIEKAEAVQEELLKGLDNKNPKIVVACVETLRKALSEFGSKIMTLKPIIKVLPKLFESREKAVRDEAKLLAVEIYRWI-RDALRPPLQNINPVQLKELEEEWVKLPQSAPKQSRFLRSQQDLKAKFEQQQQAGGDDGGDEGEEEVVPQ----VDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALEAVEALVKNPKIEAGDFADLVKALKKIVGKDTNVMLVALAAKCIAGLAAGLRKKFGSYAGHIVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFLARSFRHCTPSTLPKSLLKPFCAALLKQINDSAPEVRDAAFEALGTAQKVVGEKAVNPFLAEVDKLKLDRIKECAEKVEL 499          

HSP 2 Score: 70.4774 bits (171), Expect = 2.338e-11
Identity = 86/367 (23.43%), Postives = 156/367 (42.51%), Query Frame = 3
Query:  153 HKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNI 1241
            + NWK R+   EE  K ++  + RND    + +++L  K    ++N    +  L +V L AQ  N    +A  +  G+V+K  +    K    A E L  I E        ++++      KNPK  S +   L   + +FG   + +K     V   L   +  +R +   L+  MY ++G+  L     + KP  +++++AEF+K+  Q  P P+R                       +   G+    +   D  DL+   E+  KI ++   +I +K W  RK+ L+ +  + N  K +    G+L  S LK    D+N +LV  +  I+ Q++T +      +  N     +    + K+N+
Sbjct:  582 YNNWKERLASMEEFQKAVETME-RNDIPCQALVKMLAKKPGFKETNFQVMQMKLHIVALVAQKGNFSKTSAYVVLDGLVDKVGDV---KCGVNAKEALSGIAEACNLPWTAEQVVSLAFAQKNPKNQSETLNWLSNAIKEFGFTGINVKAFINNVKTALAATNPAIRTSAITLLGVMYLYMGAP-LRMFFEEEKPALLSQIDAEFDKMKGQTPPPPTRGSSKHGSGGGD------------EAEEGEEQDEDAPADVMDLLPRTEINDKISSDLVSKIGDKNWKIRKEGLDEVTAIINEAKFIQPNIGEL-PSALKARLNDSNKILVQQTLTILQQLSTAMGPNIKQHVKNLGMPIISVLGDSKANV 930          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Xenopus
Match: CKAP5 (cytoskeleton associated protein 5 [Source:NCBI gene;Acc:100145713])

HSP 1 Score: 377.867 bits (969), Expect = 1.274e-107
Identity = 209/491 (42.57%), Postives = 301/491 (61.30%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEA+KL Q   +   P ++ YL L+K  V +SNAVAQ K LE  L++ +  +V  K   ++  G+VNK FN P+ + +EL  +I  + VEIE+ + V +ELLKGL++KNPK+V      L++ L++FG KI+ +K + K + KL E R+K VR+  K L +E+YRWI   AL P L  I PVQ+ EL  E+ KLPQ  P  SR+L+SQ+  ++   +    G         +   PQ    +D Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPK+  G++ DL+K+L K++ KDTN++LVAL+AK I  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP I+ +T LF+ R F      +    LL      L     DS PEVR+AAF+ LGTA KV+ EK + P+L  +  LKL RI E  EK +L
Sbjct:   14 QKCEHKVWKARLNGYEEAVKLFQKIVDEKSPEWSKYLGLIKKFVTESNAVAQLKGLEAALVYVENAHVAGKTTGEVVSGVVNKVFNQPKARAKELGADICLMYVEIEKAEAVQEELLKGLDNKNPKIVVACVETLRKALSEFGSKIMTLKPIIKVLPKLFESREKAVRDEAKLLAVEIYRWI-RDALRPPLQNINPVQLKELEEEWVKLPQSAPKQSRFLRSQQDLKAKFEQQQQAGGDDGGDEGEEEVVPQ----VDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALEAVEALVKNPKIEAGDFADLVKALKKIVGKDTNVMLVALAAKCIAGLAAGLRKKFGSYAGHIVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFLARSFRHCTPSTLPKSLLKPFCAALLKQINDSAPEVRDAAFEALGTAQKVVGEKAVNPFLAEVDKLKLDRIKECAEKVEL 499          

HSP 2 Score: 70.4774 bits (171), Expect = 2.539e-11
Identity = 86/367 (23.43%), Postives = 156/367 (42.51%), Query Frame = 3
Query:  153 HKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNI 1241
            + NWK R+   EE  K ++  + RND    + +++L  K    ++N    +  L +V L AQ  N    +A  +  G+V+K  +    K    A E L  I E        ++++      KNPK  S +   L   + +FG   + +K     V   L   +  +R +   L+  MY ++G+  L     + KP  +++++AEF+K+  Q  P P+R                       +   G+    +   D  DL+   E+  KI ++   +I +K W  RK+ L+ +  + N  K +    G+L  S LK    D+N +LV  +  I+ Q++T +      +  N     +    + K+N+
Sbjct:  570 YNNWKERLASMEEFQKAVETME-RNDIPCQALVKMLAKKPGFKETNFQVMQMKLHIVALVAQKGNFSKTSAYVVLDGLVDKVGDV---KCGVNAKEALSGIAEACNLPWTAEQVVSLAFAQKNPKNQSETLNWLSNAIKEFGFTGINVKAFINNVKTALAATNPAIRTSAITLLGVMYLYMGA-PLRMFFEEEKPALLSQIDAEFDKMKGQTPPPPTRGSSKHGSGGGD------------EAEEGEEQDEDAPADVMDLLPRTEINDKISSDLVSKIGDKNWKIRKEGLDEVTAIINEAKFIQPNIGEL-PSALKARLNDSNKILVQQTLTILQQLSTAMGPNIKQHVKNLGMPIISVLGDSKANV 918          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Mouse
Match: Ckap5 (cytoskeleton associated protein 5 [Source:MGI Symbol;Acc:MGI:1923036])

HSP 1 Score: 380.178 bits (975), Expect = 1.870e-108
Identity = 211/491 (42.97%), Postives = 298/491 (60.69%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEALK+ Q   +   P ++ YL L+K  V DSNAV Q K LE  L++ +  +V  K   ++  G+V+K FN P+ K +EL  EI  + VEIE+ + V +ELLKGL++KNPK++      L++ L++FG KI+ +K + K + KL E RDK VR+  K   IE+YRW    A+   L  I  VQ+ EL  E+ KLP   P PSR+L+SQ+  E+ L +    G             PQ    +D Y+L+D VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP I+ +T LF+ R F      +    LL      L     DS PEVR+AAF+ LGTA+KV+ EK + P+L ++  LKL RI E  EK +L
Sbjct:   14 QKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKYLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYVEIEKGESVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIISLKPIIKVLPKLFESRDKAVRDEAKLFAIEIYRW-NRDAVKHTLQNINSVQLKELEEEWVKLPTGAPKPSRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----VDAYELLDAVEILSKLPKDFYDKIEAKKWQERKEALEAVEVLVKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTSSTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKSVNPFLADVDKLKLDRIKECSEKVEL 499          

HSP 2 Score: 73.9442 bits (180), Expect = 1.624e-12
Identity = 84/347 (24.21%), Postives = 154/347 (44.38%), Query Frame = 3
Query:  159 NWKARV---EGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNK-----CFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGL 1163
            NWK R+   E +++A++LM+    R +    + +++L  K    ++N    +  L +V L AQ  N    +A+ +  G+V+K     C N+        A E +  I E        ++++    + KNPK  S +   L   + +FG   + +K     V   L   +  VR +   L+  MY ++G + L  +    KP  +++++AEF+K+  Q  P P+R +             T   D            N+V     DL+  +E+  KI +    +I +K W  RK+ L+ +  + N  K +    G+L  +L   L+ D+N +LV  +  I+ Q+A  +
Sbjct:  612 NWKERLACMEEFQKAVELME----RTEMPCQALVKMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQIVLDGLVDKIGDVKCGNN--------AKEAMTAIAEACMLPWTAEQVMSMAFSQKNPKNQSETLNWLSNAIKEFGFSELNVKAFISNVKTALAATNPAVRTSAITLLGVMYLYVGPS-LRMIFEDEKPALLSQIDAEFQKMQGQSPPAPTRGIAKHS---------TSATDEGEDGEEPGEGGNDV----VDLLPRIEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINEAKFIQPNIGELPTALKGRLN-DSNKILVQQTLNILQQLAVAM 931          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Mouse
Match: Ckap5 (cytoskeleton associated protein 5 [Source:MGI Symbol;Acc:MGI:1923036])

HSP 1 Score: 379.793 bits (974), Expect = 2.510e-108
Identity = 211/491 (42.97%), Postives = 298/491 (60.69%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEALK+ Q   +   P ++ YL L+K  V DSNAV Q K LE  L++ +  +V  K   ++  G+V+K FN P+ K +EL  EI  + VEIE+ + V +ELLKGL++KNPK++      L++ L++FG KI+ +K + K + KL E RDK VR+  K   IE+YRW    A+   L  I  VQ+ EL  E+ KLP   P PSR+L+SQ+  E+ L +    G             PQ    +D Y+L+D VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP I+ +T LF+ R F      +    LL      L     DS PEVR+AAF+ LGTA+KV+ EK + P+L ++  LKL RI E  EK +L
Sbjct:   14 QKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKYLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYVEIEKGESVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIISLKPIIKVLPKLFESRDKAVRDEAKLFAIEIYRW-NRDAVKHTLQNINSVQLKELEEEWVKLPTGAPKPSRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----VDAYELLDAVEILSKLPKDFYDKIEAKKWQERKEALEAVEVLVKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTSSTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKSVNPFLADVDKLKLDRIKECSEKVEL 499          

HSP 2 Score: 73.9442 bits (180), Expect = 1.747e-12
Identity = 83/347 (23.92%), Postives = 154/347 (44.38%), Query Frame = 3
Query:  159 NWKARV---EGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNK-----CFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGL 1163
            NWK R+   E +++A++LM+    R +    + +++L  K    ++N    +  L +V L AQ  N    +A+ +  G+V+K     C N+        A E +  I E        ++++    + KNPK  S +   L   + +FG   + +K     V   L   +  VR +   L+  MY ++G + L  +    KP  +++++AEF+K+  Q  P P+R           + K +       +         N   D  DL+  +E+  KI +    +I +K W  RK+ L+ +  + N  K +    G+L  +L   L+ D+N +LV  +  I+ Q+A  +
Sbjct:  612 NWKERLACMEEFQKAVELME----RTEMPCQALVKMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQIVLDGLVDKIGDVKCGNN--------AKEAMTAIAEACMLPWTAEQVMSMAFSQKNPKNQSETLNWLSNAIKEFGFSELNVKAFISNVKTALAATNPAVRTSAITLLGVMYLYVGPS-LRMIFEDEKPALLSQIDAEFQKMQGQSPPAPTR----------GIAKHSTSATDEGEDGEEPGEGGN---DVVDLLPRIEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINEAKFIQPNIGELPTALKGRLN-DSNKILVQQTLNILQQLAVAM 931          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Mouse
Match: Ckap5 (cytoskeleton associated protein 5 [Source:MGI Symbol;Acc:MGI:1923036])

HSP 1 Score: 379.793 bits (974), Expect = 2.510e-108
Identity = 211/491 (42.97%), Postives = 298/491 (60.69%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEALK+ Q   +   P ++ YL L+K  V DSNAV Q K LE  L++ +  +V  K   ++  G+V+K FN P+ K +EL  EI  + VEIE+ + V +ELLKGL++KNPK++      L++ L++FG KI+ +K + K + KL E RDK VR+  K   IE+YRW    A+   L  I  VQ+ EL  E+ KLP   P PSR+L+SQ+  E+ L +    G             PQ    +D Y+L+D VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP I+ +T LF+ R F      +    LL      L     DS PEVR+AAF+ LGTA+KV+ EK + P+L ++  LKL RI E  EK +L
Sbjct:   14 QKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKYLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYVEIEKGESVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIISLKPIIKVLPKLFESRDKAVRDEAKLFAIEIYRW-NRDAVKHTLQNINSVQLKELEEEWVKLPTGAPKPSRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----VDAYELLDAVEILSKLPKDFYDKIEAKKWQERKEALEAVEVLVKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTSSTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKSVNPFLADVDKLKLDRIKECSEKVEL 499          

HSP 2 Score: 73.9442 bits (180), Expect = 1.747e-12
Identity = 83/347 (23.92%), Postives = 154/347 (44.38%), Query Frame = 3
Query:  159 NWKARV---EGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNK-----CFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGL 1163
            NWK R+   E +++A++LM+    R +    + +++L  K    ++N    +  L +V L AQ  N    +A+ +  G+V+K     C N+        A E +  I E        ++++    + KNPK  S +   L   + +FG   + +K     V   L   +  VR +   L+  MY ++G + L  +    KP  +++++AEF+K+  Q  P P+R           + K +       +         N   D  DL+  +E+  KI +    +I +K W  RK+ L+ +  + N  K +    G+L  +L   L+ D+N +LV  +  I+ Q+A  +
Sbjct:  612 NWKERLACMEEFQKAVELME----RTEMPCQALVKMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQIVLDGLVDKIGDVKCGNN--------AKEAMTAIAEACMLPWTAEQVMSMAFSQKNPKNQSETLNWLSNAIKEFGFSELNVKAFISNVKTALAATNPAVRTSAITLLGVMYLYVGPS-LRMIFEDEKPALLSQIDAEFQKMQGQSPPAPTR----------GIAKHSTSATDEGEDGEEPGEGGN---DVVDLLPRIEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINEAKFIQPNIGELPTALKGRLN-DSNKILVQQTLNILQQLAVAM 931          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Mouse
Match: Ckap5 (cytoskeleton associated protein 5 [Source:MGI Symbol;Acc:MGI:1923036])

HSP 1 Score: 379.793 bits (974), Expect = 2.584e-108
Identity = 211/491 (42.97%), Postives = 298/491 (60.69%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEALK+ Q   +   P ++ YL L+K  V DSNAV Q K LE  L++ +  +V  K   ++  G+V+K FN P+ K +EL  EI  + VEIE+ + V +ELLKGL++KNPK++      L++ L++FG KI+ +K + K + KL E RDK VR+  K   IE+YRW    A+   L  I  VQ+ EL  E+ KLP   P PSR+L+SQ+  E+ L +    G             PQ    +D Y+L+D VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP I+ +T LF+ R F      +    LL      L     DS PEVR+AAF+ LGTA+KV+ EK + P+L ++  LKL RI E  EK +L
Sbjct:   14 QKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKYLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYVEIEKGESVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIISLKPIIKVLPKLFESRDKAVRDEAKLFAIEIYRW-NRDAVKHTLQNINSVQLKELEEEWVKLPTGAPKPSRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----VDAYELLDAVEILSKLPKDFYDKIEAKKWQERKEALEAVEVLVKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTSSTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKSVNPFLADVDKLKLDRIKECSEKVEL 499          

HSP 2 Score: 73.559 bits (179), Expect = 1.866e-12
Identity = 82/347 (23.63%), Postives = 154/347 (44.38%), Query Frame = 3
Query:  159 NWKARV---EGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNK-----CFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGL 1163
            NWK R+   E +++A++LM+    R +    + +++L  K    ++N    +  L +V L AQ  N    +A+ +  G+V+K     C N+ +        E +  I E        ++++    + KNPK  S +   L   + +FG   + +K     V   L   +  VR +   L+  MY ++G + L  +    KP  +++++AEF+K+  Q  P P+R           + K +       +         N   D  DL+  +E+  KI +    +I +K W  RK+ L+ +  + N  K +    G+L  +L   L+ D+N +LV  +  I+ Q+A  +
Sbjct:  612 NWKERLACMEEFQKAVELME----RTEMPCQALVKMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQIVLDGLVDKIGDVKCGNNAK--------EAMTAIAEACMLPWTAEQVMSMAFSQKNPKNQSETLNWLSNAIKEFGFSELNVKAFISNVKTALAATNPAVRTSAITLLGVMYLYVGPS-LRMIFEDEKPALLSQIDAEFQKMQGQSPPAPTR----------GIAKHSTSATDEGEDGEEPGEGGN---DVVDLLPRIEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINEAKFIQPNIGELPTALKGRLN-DSNKILVQQTLNILQQLAVAM 931          
BLAST of Cytoskeleton-associated protein 5-A vs. UniProt/SwissProt
Match: sp|A2AGT5|CKAP5_MOUSE (Cytoskeleton-associated protein 5 OS=Mus musculus OX=10090 GN=Ckap5 PE=1 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 1.693e-107
Identity = 211/491 (42.97%), Postives = 298/491 (60.69%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEALK+ Q   +   P ++ YL L+K  V DSNAV Q K LE  L++ +  +V  K   ++  G+V+K FN P+ K +EL  EI  + VEIE+ + V +ELLKGL++KNPK++      L++ L++FG KI+ +K + K + KL E RDK VR+  K   IE+YRW    A+   L  I  VQ+ EL  E+ KLP   P PSR+L+SQ+  E+ L +    G             PQ    +D Y+L+D VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP I+ +T LF+ R F      +    LL      L     DS PEVR+AAF+ LGTA+KV+ EK + P+L ++  LKL RI E  EK +L
Sbjct:   14 QKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKYLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYVEIEKGESVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIISLKPIIKVLPKLFESRDKAVRDEAKLFAIEIYRW-NRDAVKHTLQNINSVQLKELEEEWVKLPTGAPKPSRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----VDAYELLDAVEILSKLPKDFYDKIEAKKWQERKEALEAVEVLVKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTSSTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKSVNPFLADVDKLKLDRIKECSEKVEL 499          

HSP 2 Score: 73.9442 bits (180), Expect = 1.202e-11
Identity = 83/347 (23.92%), Postives = 154/347 (44.38%), Query Frame = 3
Query:  159 NWKARV---EGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNK-----CFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGL 1163
            NWK R+   E +++A++LM+    R +    + +++L  K    ++N    +  L +V L AQ  N    +A+ +  G+V+K     C N+        A E +  I E        ++++    + KNPK  S +   L   + +FG   + +K     V   L   +  VR +   L+  MY ++G + L  +    KP  +++++AEF+K+  Q  P P+R           + K +       +         N   D  DL+  +E+  KI +    +I +K W  RK+ L+ +  + N  K +    G+L  +L   L+ D+N +LV  +  I+ Q+A  +
Sbjct:  612 NWKERLACMEEFQKAVELME----RTEMPCQALVKMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQIVLDGLVDKIGDVKCGNN--------AKEAMTAIAEACMLPWTAEQVMSMAFSQKNPKNQSETLNWLSNAIKEFGFSELNVKAFISNVKTALAATNPAVRTSAITLLGVMYLYVGPS-LRMIFEDEKPALLSQIDAEFQKMQGQSPPAPTR----------GIAKHSTSATDEGEDGEEPGEGGN---DVVDLLPRIEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINEAKFIQPNIGELPTALKGRLN-DSNKILVQQTLNILQQLAVAM 931          
BLAST of Cytoskeleton-associated protein 5-A vs. UniProt/SwissProt
Match: sp|Q9VEZ3|MSPS_DROME (Protein mini spindles OS=Drosophila melanogaster OX=7227 GN=msps PE=1 SV=3)

HSP 1 Score: 377.096 bits (967), Expect = 1.375e-106
Identity = 204/503 (40.56%), Postives = 325/503 (64.61%), Query Frame = 3
Query:  102 MVEEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEK-LTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            M E+   K L   E+  HK WKARV+GYEEA K+ +  D+   P ++ +  L+K MV+DSNA+AQEK LE  L+F +   +  +   D+  GIV KC  +P+ KT+EL+ ++  + VEIE+Q+ V++EL+KG+ +KNPK+VS         L +FG K++ +K + K +  L+ DRDK VR+ GK+L +E+YRWIG+ A+   +S +  V + EL  EF+KL  E+  PSRYLKSQ+ K++ +       DA  +       +   +IDP DL+DPV+++SK+P ++YD++EEKKWT RK++LE++EK LT++PKL  GEYG L+ +L KV++KD+N+VLVA++ K +  +A GL K+FS YA   +   LEKFKEKK N+VT +R  ID  + + ++    + ++ +  +KNP++++ET LF+ R   ++   + + KLL  L  +L     +  P VR+++ + LGT +K++ +K + P L ++  LK+ +I E  EKA++
Sbjct:    1 MAEDTEYKKLPVEERCVHKLWKARVDGYEEAAKIFRELDDEKSPEWSKFAGLIKKMVVDSNALAQEKGLEAALIFVENSGLAGRTVGDVMTGIVQKCIAAPKTKTKELSVQVALMYVEIEKQEAVVEELVKGMEAKNPKIVSACVAATTLALREFGHKVIGVKPLIKKLAPLMSDRDKTVRDEGKQLAVEIYRWIGA-AMKAQISTLPQVTLKELEDEFDKLKGERVEPSRYLKSQQEKQAKIADAAATEDAYNEDDGEAGVE---EIDPMDLLDPVDILSKMPKDFYDKLEEKKWTLRKESLEVLEKLLTDHPKLENGEYGALVSALKKVITKDSNVVLVAMAGKCLALLAKGLAKRFSNYASACVPSLLEKFKEKKPNVVTALREAIDAIYASTSLEAQQESIVESLSNKNPSVKSETALFIARALTRTQPTALNKKLLKLLTTSLVKTLNEPDPTVRDSSAEALGTLIKLMGDKAVTPLLADVDPLKMAKIKECQEKAEI 499          

HSP 2 Score: 67.0106 bits (162), Expect = 1.213e-9
Identity = 92/407 (22.60%), Postives = 169/407 (41.52%), Query Frame = 3
Query:  432 EILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVD----------IDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXS---KHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVR-NAAFKTLGTAM--------KVLEEKKLKPYLDNLANLKLVRIN 1583
            ++L    E  + + V+ ++L      K+PKV S +   +   + +FG ++ P K + + V K ++  +  VR +  +++  M  ++G  AL       KP   +++  EF+K   EKP          PK    V+ + GG A      G  P N  D          I+  DL+  V++  +I      ++ +K W  R + L  ++ + +  +L+    GDL  +L   L  D+N  +   +  I  Q+AT +      +  N     L    + KS +     NCI+ SF          +    +   K  +P ++TE   ++         +S S + ++ ++P+L     D   +VR NA    LG  +        + L+++K     D LA L+  R N
Sbjct:  696 DVLSAFAEATKLEYVVGKVLSFAFEQKSPKVQSEAFNWVNRSIIEFGFQLQP-KTLIEDVRKGVQSTNPTVRASAIQMVGTMSMYMGK-ALMMFFDSEKPALKSQIQVEFDKNVGEKP----------PKPVRGVQRSSGGTA------GNSPDNEDDDGGAAGEEEPINMADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIISEARLIKPSIGDLAPALAHRLV-DSNAKIAQTTLAICEQLATAMGAGCRNHVRNLFPGFLHALGDNKSFVRAAALNCIN-SFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLADKLPGLPPKSVSKEDIHSMVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRALDKQKPASKKDILAALEKARPN 1082          
BLAST of Cytoskeleton-associated protein 5-A vs. UniProt/SwissProt
Match: sp|Q14008|CKAP5_HUMAN (Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=3)

HSP 1 Score: 377.096 bits (967), Expect = 1.719e-106
Identity = 208/491 (42.36%), Postives = 301/491 (61.30%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKH--PQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEALK+ Q   +   P ++ +L L+K  V DSNAV Q K LE  L++ +  +V  K   ++  G+V+K FN P+ K +EL  EI  + +EIE+ + V +ELLKGL++KNPK++      L++ L++FG KI+ +K + K + KL E R+K VR+  K + +E+YRWI   AL P L  I  VQ+ EL  E+ KLP   P P+R+L+SQ+  E+ L +    G             PQ    ID Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPKL  G+Y DL+K+L KV+ KDTN++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP I+ +T LF+ R F      +    LL      L     DS PEVR+AAF+ LGTA+KV+ EK + P+L ++  LKL +I E  EK +L
Sbjct:   14 QKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWI-RDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQ----IDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLADVDKLKLDKIKECSEKVEL 499          

HSP 2 Score: 83.9593 bits (206), Expect = 1.047e-14
Identity = 88/343 (25.66%), Postives = 153/343 (44.61%), Query Frame = 3
Query:  159 NWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNK-----CFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGL 1163
            NWK R+   EE  K +++ D R +    + + +L  K    ++N    +  L +V L AQ  N    +A+ +  G+V+K     C N+ ++    +A   +  +     Q V M       + KNPK  S +   L   + +FG   + +K     V   L   +  VR A   L+  MY ++G + L       KP  +++++AEFEK+  Q  P P+R +             T G D   +   G  P +  + D  DL+   E+  KI +    +I +K W  RK+ L+ +  + N+ K +    G+L  +L   L+ D+N +LV  +  I+ Q+A  +
Sbjct:  612 NWKERLACMEEFQKAVELMD-RTEMPCQALVRMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQVVLDGLVDKIGDVKCGNNAKEAMTAIAEACM--LPWTAEQVVSM-----AFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVKTALAATNPAVRTAAITLLGVMYLYVGPS-LRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGISKHS---------TSGTD---EGEDGDEPDDGSN-DVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPNIGELPTALKGRLN-DSNKILVQQTLNILQQLAVAM 931          
BLAST of Cytoskeleton-associated protein 5-A vs. UniProt/SwissProt
Match: sp|Q9PT63|CKAP5_XENLA (Cytoskeleton-associated protein 5-A OS=Xenopus laevis OX=8355 GN=ckap5-a PE=1 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 6.707e-106
Identity = 208/490 (42.45%), Postives = 303/490 (61.84%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGK-HPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            +K  HK WKAR+ GYEEA+KL Q   +   P ++ YL L+K  V +SNAVAQ K LE  L++ +  +V  K   ++  G+VNK FN P+ + +EL  +I  + VEIE+ +VV +ELLKGL++KNPK+V      +++ L++FG KI+ +K + K + KL E R+K +R+  K L +E+YRWI   AL P L  I PVQ+ EL  E+ KLPQ  P  +R+L+SQ+  ++   +    GD        +  PQ    +D Y+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E L  NPK+  G++ DL+K+L  V+ KDTN++LVAL+AK I  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP I+ +T LF+ R F      +    LL      L     DS PEVR+AAF+ LGTA KV+ EK + P+L  +  LKL RI E  +KA+L
Sbjct:   14 QKCEHKVWKARLNGYEEAVKLFQKIVDEKSPEWSKYLGLIKRFVTESNAVAQLKGLEAALVYVENAHVAGKTTGEVVNGVVNKVFNQPKARAKELGADICLMYVEIEKAEVVQEELLKGLDNKNPKIVVACVETVRKALSEFGSKIMTLKPIIKVLPKLFESREKAIRDEAKLLAVEIYRWI-RDALRPPLQNINPVQLKELEEEWVKLPQSAPKQTRFLRSQQDLKAKFEQQQAAGDDGGDDGEEEIVPQ----VDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALEAVEALVKNPKIEAGDFADLVKALKTVVGKDTNVMLVALAAKCIAGLAAGLRKKFGSYAGHIVPTILEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPAIKQQTSLFLARSFRHCTPSTLPKSLLKPFCVALLKQINDSAPEVRDAAFEALGTAQKVVGEKAVNPFLAEVDKLKLDRIKECADKAEL 498          

HSP 2 Score: 78.5666 bits (192), Expect = 4.528e-13
Identity = 88/373 (23.59%), Postives = 163/373 (43.70%), Query Frame = 3
Query:  132 NTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNI 1241
            +  +++   NWK R+   EE  K ++  + RND    + +++L  K    ++N    +  L +V L AQ  N    +A  +  G+V+K  +    K    A E L  I E        ++++      KNPK  S +   L   + +FG   + +K     V   L   +  +R +   L+  MY ++G+  L     + KP  +++++AEFEK+           K Q P  S  ++ +  G    +   G+    +   D  DL+   ++  KI ++   +IE+K W  RK+ L+ +  + N  K +    G+L  S LK    D+N +LV  +  I+ Q++T +      +  N     +    + K+N+
Sbjct:  600 SCMQQLDSSNWKERLASMEEFQKTVESME-RNDIPCQALVKMLAKKPGFKETNFQVMQMKLHIVALIAQKGNFSKTSACAVLDGLVDKVGDV---KCGGNAKEALSGIAEACTLPWTAEQVVSLAFAQKNPKNQSETLNWLSNAIKEFGFTGINVKAFISNVKTALAATNPAIRTSAITLLGVMYLYMGAP-LRMFFEEEKPALLSQIDAEFEKM-----------KGQTPPVS--IRGSKHGSGRDEGEEGEEQDEDAPADVTDLLPRTDISDKISSDLVSKIEDKNWKIRKEGLDEVTAIINEAKFIQPSIGEL-PSALKGRLNDSNKILVQQTLTILQQLSTAMGHNIKQHVKNLGMPIITVLGDSKANV 953          
BLAST of Cytoskeleton-associated protein 5-A vs. UniProt/SwissProt
Match: sp|O94534|ALP14_SCHPO (Spindle pole body component alp14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp14 PE=1 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.121e-65
Identity = 159/522 (30.46%), Postives = 271/522 (51.92%), Query Frame = 3
Query:  108 EEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSF---NSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDN--KAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKL-----LNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKLEPQLETQISQIQ 1643
            EE YSK L    +I HK WK R+  YEE  K   +  + +D  F   N+  EL K+++ DSN  AQE      + + +  +  +  KA +     I  KC  SPR  TRE A E L ++VE +    V++ ++  L++++PKV++ +   +  ++  FG K++P K +   +  L    DKNVR+    L + +YRW G    + +   ++PVQ  EL + F +LP E P  +R+LKSQ+P     V+     +  P     +      D D +DLV+ V+V+  +  N    +   KW DRK+AL+ +  + + PK+   ++ +L+  L K +SKD NI++V  +A  I  +A GLR  FS YA  +I   LE+ KEKK+N++  + + +D      +++   + + + + +KNP I++      +R F  SNM S   K          +P ++    D+   VR+AA + LG  MK++ E+ +  YL  L +++  +I  F E A ++ +  T+ S+++
Sbjct:    6 EEDYSK-LPLESRIVHKVWKVRLSAYEECSKSFSLSADGSDNCFELWNNQSELWKSVLTDSNVAAQEAGTAAFVAYCRFSDPSHLLKAREISVLSISEKCLTSPRAGTRENALEALMLLVEADSAAPVIESIIPSLSARSPKVIASNVAAIASLVEQFGAKVIPSKMIIPHISNLFGHADKNVRKEASRLTVNIYRWTGDPLKDLLFKDLRPVQTKELESLFAELPTEPPKQTRFLKSQQPTSEPNVE--TQVEEQPALENEESEPEPSD-DQFDLVEEVDVLPNVDPNLETLMASSKWKDRKEALDKLLPVLSQPKIKDNDFFNLVAILTKSVSKDANIMVVINAAHCIQAMAKGLRSNFSKYASTSINALLERSKEKKANVIESLSSAMDAVLATSSLDDLAELIASFAGNKNPQIKSSCFSLFSRSF--SNMTSLPSKFTVDTCAKACVPGVS----DTFEPVRSAAAEALGVLMKLVGERAINQYLSPLDDIRKSKIRSFYETATVKAKAPTKKSKVK 517          
BLAST of Cytoskeleton-associated protein 5-A vs. TrEMBL
Match: A0A183PF57 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS12993 PE=4 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 4.583e-143
Identity = 235/499 (47.09%), Postives = 334/499 (66.93%), Query Frame = 3
Query:  108 EEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSV--GKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEK 1598
            E+ +SK L T  K+ HK W ARV GYEEA K+     N   P FN Y+ L+K  V DS+A AQEKAL+ VL + +      K A DIC GI++KC  S R KT++ + E L +++EIER ++V++EL+KGL++KNPKVV GS   L+E LN FGP +VP+K  FK   +LL+DRD+ +R   K LI+E+YRWIG T  + +L  IKPV +TEL   F  +P  KPV  RYL+SQKPKE   + P  G ++ P      G    + VD+D  D++ PVEV+SKIP++Y+ QI EKKW DR+DALE +EK+TN P++VPG++ DL++SL++V++KDTNI+LV L+AKI+ QIA GL+ KFSPY+  T++ CL KFKEKK N+V  +R   D +  + +++  +DD++ A  HK PN+R E  L ++R F+K +  S + K+L      L   C D++PEVR  +F  LG AM V+  K ++P+L  L +++L +INE CE+
Sbjct:    4 EDDWSK-LPTLSKVQHKLWNARVAGYEEAFKIFSTETNGKSPVFNEYVGLMKKFVTDSHAGAQEKALDAVLAYIETAAAATKCAGDICSGIISKCLGSTRIKTKDKSIECLLMLIEIERHELVIEELIKGLSTKNPKVVVGSLQTLREALNLFGPTVVPIKPFFKEFGRLLDDRDQGIRNETKNLIVEVYRWIGVTTKD-LLKDIKPVVMTELCELFNSIPPGKPVRLRYLRSQKPKE---ITPDTGAESNPIDGAIPGGTLTDQVDLD--DMITPVEVLSKIPSDYWQQIGEKKWQDRRDALEALEKITNVPRIVPGDFTDLVRSLIQVVNKDTNIILVTLAAKILGQIARGLKSKFSPYSQQTLQACLGKFKEKKPNVVQALRESADGAVSSNSLDHFVDDIVAALSHKTPNVRAEAALILSRAFKKCSATSLNKKVLKSFTVPLCVTCNDTVPEVRECSFAALGAAMFVVSAKTIQPFLSELDSIRLAKINECCER 495          
BLAST of Cytoskeleton-associated protein 5-A vs. TrEMBL
Match: A0A5K3F8Q2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 459.914 bits (1182), Expect = 4.103e-140
Identity = 239/498 (47.99%), Postives = 331/498 (66.47%), Query Frame = 3
Query:  129 LNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPK--------ESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEK 1598
            L T EKI HK WKARV GYEEA+KL Q   +     F  YL L+K MV DSNA+AQEKAL+ VL+F +   V  +AA DIC GIV+KC  +PR KT+E   E+L   +E+E+ DVV++E+LKGL+ K PKVV GS   L+  L+ FG K++ +K + K   +LLEDRD N+R   KEL++EMYRW G+  +   LS +KPVQ+TEL  EF K P EKP P+RYLKSQ PK         ++   P  GGD      VG   + ++ +DPY+L DPV ++SKIP ++++Q+E KKW DRK+AL ++E L++  +L PG+YG+LMK+LLKV++KDTN++LV  SAK++ QIA GLRK F  YA  TI++C+EKFKEKK  +++ VR+  D + ++ ++    DD+I A+ +K P +R ET L++ R F   N  + + KLL  LI  L     D+  EVR A+F  LG AM V+ EK + P+L ++ N++L RI EF EK
Sbjct:   10 LPTIEKIEHKQWKARVAGYEEAIKLFQTQPSEKSNVFTDYLGLMKKMVTDSNAIAQEKALDAVLVFVENAAVAPRAATDICAGIVSKCMGAPRAKTKEKGIEVLLFYIELEKTDVVLEEVLKGLSVKQPKVVVGSLQTLRSALSLFGSKVISIKSILKDTLRLLEDRDPNIRSESKELVVEMYRWAGAP-IKAQLSGLKPVQLTELENEFAKCPAEKPSPTRYLKSQVPKILSQQQNNAASEDGPDSGGD------VGA--EVDIALDPYELADPVNILSKIPNDFWEQMESKKWQDRKEALSLVENLSDTMRLAPGDYGELMKALLKVIAKDTNLILVGQSAKVVTQIANGLRKDFQVYASETIKVCIEKFKEKKPAVLSAVRSAADAALNSTSLESVQDDVIAATSNKIPGVRAETCLYLGRAFANMNTTTLNKKLLKALIVPLIKCSVDTNMEVREASFSALGMAMFVVTEKNIMPFLTDVDNIRLGRIKEFYEK 498          
BLAST of Cytoskeleton-associated protein 5-A vs. TrEMBL
Match: A0A564XW58 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS430 PE=4 SV=1)

HSP 1 Score: 457.218 bits (1175), Expect = 4.316e-139
Identity = 241/513 (46.98%), Postives = 333/513 (64.91%), Query Frame = 3
Query:  102 MVEEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPK-------------ESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKA 1601
            M E+     L T EKI +K WKAR+ GY+EA+KL Q   +   P FN YL LLK MV DSNA+AQE+AL+ VL F +  +V  +AA D+C GI+ KC N+ R KT+E   EIL   +E+E+ DVV++EL+KGL+ K PK V      L+  L  FG K++P+K + K   +LLEDRD+ VR   KELI+EMYRW G T +   LS +KPVQ+TEL  EF+K   +KPVP+RYLKSQKPK             +  LV+ T GG+            N  ++DPYDL DPV ++SK+P ++Y+QIE KKW +RK+AL ++E LT+  KL PG+YGDLMK+L+KV+SKDTN++LV  SAKI+ QIA+GLRK F  YA  TIR C++KFKEKK  I+  +R+  D +  A  ++   +D+I A+ +K P++R E  +F+NR F    + + + KLL   +  L     D+  EVR A+F  LGTAM V+ EK + P+L ++ ++++ RI EF EKA
Sbjct:    1 MAEDSEWLKLPTIEKIENKLWKARIAGYDEAIKLFQTQASDKSPIFNDYLILLKKMVTDSNAIAQERALDAVLAFLENASVAPRAAPDVCEGILTKCLNAARAKTKEKGMEILLYYIELEKVDVVLEELIKGLSLKQPKTVVSCLQTLRMALAGFGSKVIPIKSILKDTLRLLEDRDQTVRNESKELIVEMYRWAG-TPVKTQLSSLKPVQLTELEVEFDKCSGQKPVPTRYLKSQKPKGLPQQNNNASAPADQVLVEDTSGGN------------NEPELDPYDLADPVNILSKLPNDFYEQIEAKKWQERKEALSLVENLTDVMKLAPGDYGDLMKALIKVISKDTNVILVGQSAKIVAQIASGLRKGFHLYAGETIRTCIDKFKEKKPAILIALRSAADAALKATTLDAVQEDIIAATANKVPSVRAEICMFLNRAFSNMTVATLNKKLLKTFVGPLIKCSTDTTVEVREASFAALGTAMYVVTEKNIMPFLTDIDSIRMGRIKEFYEKA 500          
BLAST of Cytoskeleton-associated protein 5-A vs. TrEMBL
Match: A0A0R3T8Z1 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS3528 PE=4 SV=1)

HSP 1 Score: 456.833 bits (1174), Expect = 4.854e-139
Identity = 232/494 (46.96%), Postives = 334/494 (67.61%), Query Frame = 3
Query:  129 LNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPK---ESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKA 1601
            L+T +KI +K WKARV GY+EA+KL Q   +   P FN YL LLK MV DSNA+AQE+AL+VVL F +  +V  +AA D+C GI+ KC N+ R KT+E   EIL   +E+ER D+V++EL+KGL++K PK V      L+  L  FG K++ +K + K   +LLEDRD+ VR   KELI+EMYRW G+  +   LS +KPVQ+ EL AEF K   +KP+P+RYLKSQKPK   +      +  GD V  + V +   +  ++DPYDL DPV +++K+P ++Y+QIE KKW +RK+AL ++E L++  KL PG+YG+LMK+L+K++ KDTN++LV  SAKI+ QIA+GLRK F PYA +TIR C++KFKEKK  I+T +R+  D +  A +++   +D+I A+ +K P++R E  +F+NR F    + + + KLL   +  L     D+  EVR A+F  LGTAM V+ EK + P+L ++ ++++ RI EF EKA
Sbjct:   10 LSTIDKIENKLWKARVAGYDEAIKLFQTQTSDKSPVFNDYLGLLKKMVTDSNAIAQERALDVVLAFVENASVAPRAAADVCEGILLKCLNAARAKTKEKGIEILLFYIELERTDIVLEELIKGLSAKQPKTVISCLQTLRMALAGFGSKVISIKSILKDTLRLLEDRDQTVRNESKELIVEMYRWAGAP-IKTQLSSLKPVQLNELEAEFAKCSGQKPLPTRYLKSQKPKNLPQQNNNNASAPGDQVLVEGVSEG-NDEPELDPYDLADPVNILTKLPNDFYEQIEAKKWQERKEALSLVENLSDVMKLAPGDYGELMKALIKIICKDTNVILVGQSAKIVAQIASGLRKGFQPYAGDTIRACIDKFKEKKPAILTAIRSAADAALKATSLDAVQEDIIAATSNKVPSVRAEICMFLNRAFSNMTVATLNKKLLKAFVGPLIKCSSDTTGEVREASFAALGTAMYVVTEKNITPFLADVDSIRMGRIKEFYEKA 501          
BLAST of Cytoskeleton-associated protein 5-A vs. TrEMBL
Match: A0A0V0J9X7 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR139964 PE=4 SV=1)

HSP 1 Score: 461.84 bits (1187), Expect = 2.317e-137
Identity = 252/499 (50.50%), Postives = 332/499 (66.53%), Query Frame = 3
Query:  102 MVEEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEK 1598
            M EE+  K L T EK+ HK WKARVEGYEEA+KL     +   P F+ Y+ L+K MV+D+NA+AQEKAL  VL FA+   +  + A D+C GIVNKC NS R KT+E   EIL + +E E+ DVV++ELLKGL++K PK+V G    LKE L+ FG K+V +K + K + +LLEDRD  VR   KELIIEMYRW G  A+ P LS +KPVQ+TEL AEF KLP  KPVP+RYL SQKPKE      T  G A PQ+     PQ    +D Y L D V ++SKIP +Y+++IE+KKW +RK+AL ++E+LT+  KL  G+Y  L+ SL+KV+SKDTNI+LV  SAKI+ QIA  LR  F PYAV TI+ C EKFKEKK  ++  +R   D +  ++ +    +D+I A  +KNP IR ET LF++RIF K  + + + KLL   +  L     D + EVR AAF  LGTAM ++ EK + P+L ++ N++L RI EF EK
Sbjct:    1 MAEELEWKKLPTIEKVEHKQWKARVEGYEEAVKLFSTQPSDKSPVFSDYVGLMKKMVVDNNAIAQEKALFAVLAFAENAAIATRVASDVCSGIVNKCLNSTRAKTKETGIEILFLYIEREKGDVVVEELLKGLSAKQPKIVIGCVQALKEALSLFGSKVVSIKSILKEIIRLLEDRDGTVRNESKELIIEMYRWAGP-AIKPQLSGLKPVQITELEAEFAKLPTAKPVPTRYLISQKPKEDPRAAETTSGKA-PQELEDNEPQ----LDAYALADAVNILSKIPNDYWEKIEDKKWQERKEALTLVEQLTDVIKLDNGDYSALLNSLIKVISKDTNILLVGQSAKIVAQIANALRAGFKPYAVTTIKACFEKFKEKKPTVLVAIRAAADAAQRSVTLESLQEDIIEALNNKNPGIRAETALFLSRIFAKMTIVTLNKKLLKTFVVPLLKCSADMVLEVREAAFCALGTAMFIVTEKNISPFLADIDNIRLNRIKEFYEK 493          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Cavefish
Match: ENSAMXT00000018997.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001464.1:100557:121886:-1 gene:ENSAMXG00000018449.2 transcript:ENSAMXT00000018997.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 367.081 bits (941), Expect = 1.064e-107
Identity = 202/502 (40.24%), Postives = 302/502 (60.16%), Query Frame = 3
Query:  123 KSLNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPT-----GG--GDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            K L T +K  HK WKAR+ GY EAL+  Q   +   P +  Y  L+K  V DSNAVAQ K LE  L + +  ++ ++ A ++  G+V K FN P+ + +EL  +I  + +EIE+ + V +ELLKGL++KNPK+      +L+  +++FG K+V +K + K + KL E R+K VR+  K L +E+YRWI   AL P L  I  V + EL  E+ KLP   P  SR+L+SQ+   +   +       GG  GDA P             +D Y+L++ VE++SK+P +++++IE KKW +RK+ALE +E LT NPKL  GEYGD++K+L KV+ KD+N++LV ++AK +  +A GLRKKFS YA + +   LEKFKEKK+ +V  ++  ID  F +  +    +D +    +KNP++R +  LF+ R F      +    LL      L     DS PEVR+AAF+ LGTAMKV+ E+ + P+L ++  LK+ +I E  EK +L
Sbjct:    8 KKLPTDQKCEHKVWKARLSGYTEALQQFQRITDEKSPEWGKYQGLIKKFVTDSNAVAQLKGLEAALAYIENAHLASRTAGEVVSGVVCKVFNQPKARAKELGSDICLMYIEIEKAEAVQEELLKGLDNKNPKIALACVEVLRRAISEFGSKVVTLKPVVKVLPKLFESREKAVRDEAKLLAVEVYRWI-RDALRPPLQNINSVLLKELEEEWAKLPTSAPRQSRFLRSQQDLRAKFEQQQQNAGDGGDEGDAAPA------------VDAYELLEAVEILSKLPKDFHEKIEAKKWQERKEALEALETLTKNPKLESGEYGDVVKALNKVIGKDSNVMLVTIAAKCVAGLAAGLRKKFSTYAGHLVPTILEKFKEKKAQVVQALQEAIDAVFLSTTLQNVSEDTLAVMDNKNPSVRQQASLFLARSFRHCTPTTLPKSLLKPFCVALLKQVNDSAPEVRDAAFEALGTAMKVVGERAVNPFLADVDKLKIDKIKECSEKVEL 496          

HSP 2 Score: 54.299 bits (129), Expect = 1.103e-6
Identity = 78/356 (21.91%), Postives = 146/356 (41.01%), Query Frame = 3
Query:  132 NTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLP-QEKPVPSRYLKSQKPKESALVKPTGGGDA-VPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPY 1184
            +  + +   NWK R+   EE  K  +  D++  P   + + +L  K    ++N    +  ++V+   AQ       +A  +   +V K  +    K    A E L  + E        ++++      KNPK  + +   L   + +FG   V +K     V   L   +  VR +   L+  M+ ++G+  L       K   +++++AEFEK+  Q  P P R                GG  A   +++  +  +     D  DL+   ++  KI +    +I +K W  RK+ L+ +  + +  K +    G+L  + LK    D+N +LV  +  I+ Q+AT +      Y
Sbjct:  570 SCMQTLDSANWKERLAAMEEFHKAAEQMDSKEMPC-QALVRMLAKKPGWKETNFQVMQLKMQVIATVAQRGTFSRTSALAVLEPVVEKVGDV---KCGVKAKEALTGVAEACGLPWTAEQVVSLAFGQKNPKNQAEALNWLCNAIKEFGFAGVNVKAFINNVKTALAATNPAVRTSAISLLSVMFLYVGAP-LRMFFEGEKAALLSQIDAEFEKVKCQTPPAPIR----------------GGSKASGGEEADEQEEEAEAGDDVVDLLPRTDISDKITSEMLSKIGDKNWKIRKEGLDEVTAVLSEAKFIKPGVGEL-PTALKARLTDSNKILVQQTLSILQQMATAMGPAIKQY 903          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Cavefish
Match: ckap5 (cytoskeleton associated protein 5 [Source:ZFIN;Acc:ZDB-GENE-051120-174])

HSP 1 Score: 258.455 bits (659), Expect = 2.611e-69
Identity = 143/350 (40.86%), Postives = 211/350 (60.29%), Query Frame = 3
Query:  558 NDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            N+FG KI+ +K + K + KL E R+K VR+  K L +E+Y+WI   AL   L  +  VQ+ EL  E+ KLP   P  SR+L+SQ+  ++   +    G    +       Q +  +DPY+L++ VE++SK+P ++YD+IE KKW +RK+ALE +E LT  PKL  G+YGDL+++L KV+ KD N++LV L+AK +  +ATGLRKKF  YA   +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP+I+ +  LF+ R F      +    +L  L         DS PEVR+AAF+ LGTAMKV+ EK + P+L +L  LKL +I E  +K +L
Sbjct:   84 NEFGSKIITLKPVVKVLPKLFESREKAVRDEAKLLAVEIYKWI-RDALRTPLQNLNSVQLKELEEEWVKLPTGIPKQSRFLRSQQDLKAKFEQQQAAGS--DEADGDDDEQTDTRVDPYELLEAVEILSKLPKDFYDKIEAKKWQERKEALEAVETLTKIPKLESGDYGDLVRALKKVVGKDANVMLVTLAAKCLAGLATGLRKKFGTYAGLVVPTVLEKFKEKKPQVVQALQEAIDAVFLTTTLQNISEDVLAVMDNKNPSIKQQASLFLARSFRHCTPSTLPKSVLKPLCAAFLKQVNDSAPEVRDAAFEALGTAMKVVGEKAVNPFLADLDKLKLDKIKECADKVEL 430          

HSP 2 Score: 70.0922 bits (170), Expect = 1.623e-11
Identity = 47/118 (39.83%), Postives = 62/118 (52.54%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNV-DNKAAKDICP-----GIVNKCFNSPRQKTRE----LAFEILKVIVEIER 464
            +K  HK WKAR+ GYEEALKL Q   +   P +  YL L+K  V +SNAVAQ K LE  L+F +  +V  N+    I        ++ K F S  +  R+    LA EI K I +  R
Sbjct:   14 QKCEHKVWKARLNGYEEALKLFQRISDEKSPEWGKYLGLIKKFVTESNAVAQLKGLEAALVFVENAHVAGNEFGSKIITLKPVVKVLPKLFESREKAVRDEAKLLAVEIYKWIRDALR 131          

HSP 3 Score: 68.5514 bits (166), Expect = 5.199e-11
Identity = 114/488 (23.36%), Postives = 195/488 (39.96%), Query Frame = 3
Query:  159 NWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCID--VSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAK 1604
            NWK R+   EE  + ++  D    P   + + +L  K    ++N    +  L +V L A        +A  +  G+V+K  +    K    A E L  I E        ++++      KNPK  + S   L   + +FG   + +K     V   L   +  VR +   L+  MY ++G+  L       KP  +++++AEFEK+  Q  P P+R    Q  K +         +    +  G         D  DL+   ++  KI ++   +I +K W  RK+ L+ +  + +  K +    GDL  +L   L  D+N +LV  +  I  QIAT +      +  N     +    + K NI       ++  V    +      +DL    K +NP +R E + +++      NM +    L+   IP+L    +D   +VR  A   L T M  L   K+      L      ++    EKA+
Sbjct:  529 NWKERLASMEEFQRAVEQMDKSEMPC-QALVRMLAKKPGWKETNFQVMQMKLHIVGLIAGKGTFSKTSALVVLDGLVDKIGDV---KCGGNAKEALTNIGEACSLPWTAEQVVSLAFAQKNPKNQAESLNWLANAMKEFGFAGINVKAFINNVKTALGATNPAVRTSAIALLGVMYLYMGA-PLRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTR---GQTKKGAEEDGEDADEEDGVDRGAG---------DIMDLLPRTDISDKITSDMVAKISDKNWKIRKEGLDEVSAVISEAKFIQSNIGDLPMALKGRLG-DSNKLLVQQTLNIFQQIATAMGPSLKQHVRNLGFPIITVLGDSKPNIRATALATLNSWVEQTGMKEWLEGEDLSEELKRENPFLRQELLGWLSERL--PNMRTVPADLM-LFIPHLYACLEDRNGDVRKKAQDALPTFMMHLGYDKMNKATSKLKTSSKDQVVAMLEKAR 995          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009507.1 (pep scaffold:Pmarinus_7.0:GL477430:472908:497137:1 gene:ENSPMAG00000008554.1 transcript:ENSPMAT00000009507.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 378.637 bits (971), Expect = 7.563e-109
Identity = 207/492 (42.07%), Postives = 304/492 (61.79%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESAL-VKPTGGGDAVPQQSVGKHPQNNV--DIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKL 1607
            ++  HK WKAR+ GYEEALK+ Q  D ++ P F+ YL L+K  V DSNAVAQ K LE  L+F +  NV  K   ++  GIVNK FN P+ + +EL  +I  + +EI++ D V +E+LKGL++KNPK+V       ++ L +FG KIV +K + K + KL E RDK VR+  K L +E+YRWI   AL   L  I P+Q+ EL  E+EK+P      +R+++SQ+        + T  GD     + G   + +    +DPYDL++P+E++SK+P ++YD++E KKW +RK+ALE +E L  +PKL PG+YGD+++ L KV+ KD+N++LVAL+AK +  +A GLRKKF  YA + +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP+I+ +  LF+ R F      +    LL      L     DS PEVR+AA++ L TA+KV+ EK + PYLD +  LKL +I E  EK +L
Sbjct:   14 QRCEHKVWKARLNGYEEALKIFQKLDEKS-PEFSKYLGLIKKFVTDSNAVAQLKGLEAGLIFVENANVAGKTGGEVVAGIVNKVFNQPKARAKELGMDICLMYIEIDKPDPVQEEMLKGLDNKNPKIVVACIETFRKALCEFGSKIVQLKPIVKLLPKLFESRDKPVRDEAKSLAVEIYRWI-RDALRAPLKNINPLQLKELEDEWEKMPNTPAKQTRFMRSQQDLRMKFEQQQTDNGDV----AAGHEDEADAAPALDPYDLLEPMEILSKLPKDFYDKVEAKKWQERKEALEALEVLLKHPKLEPGDYGDVVRVLKKVIGKDSNVMLVALAAKCLGCLAAGLRKKFHTYAPHVMSTLLEKFKEKKPAVVQALQEAIDEVFLTTTLQVVSEDVLAVLDNKNPSIKQQASLFLARSFRHCTTSTLPKSLLKPFCVALLKQTNDSAPEVRDAAYEALATALKVVGEKAVNPYLDEVDKLKLEKIKECAEKVEL 499          

HSP 2 Score: 77.0258 bits (188), Expect = 2.826e-14
Identity = 81/347 (23.34%), Postives = 152/347 (43.80%), Query Frame = 3
Query:  132 NTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGL 1163
            +  +++   NWK R+   EE  K ++       P   + + +L  K    ++N    +  L++V L AQ  N    +A+    G+V+K  +    K    A + L  + E        +E++      KNPK  S +   L   + +FG   V ++     V   L   +  VR +   ++  MY ++G   L       KP  + +++AEFEK   + P P+ +    K  E A            + + G+   + V ++  DLV  +++ +KI  +   ++ +K W  RK+ L+ +  + N  K +    GDL  +L   L+ D+N +L+  +  I+ Q+AT +
Sbjct:  601 SCLQQLDSSNWKERLASMEEFQKAVETMGKDEMPC-QALIRMLAKKPGWKETNFQVMQLKLQIVALVAQKGNFSKTSARIALEGLVDKIGDV---KCGNFAKDALTAVSEACNLPWTAEEIVAMAFGQKNPKNQSETLTWLANAIKEFGFAGVNVRAFISHVKTALSATNPAVRTSAIAILGVMYLYMGP-PLRMFFEDEKPALLNQIDAEFEKTKGQTP-PAPFRGQSKRGEDA-----------SEDADGETEVDCVMVNVQDLVTRIDICNKITPDLVTKLGDKNWKIRKEGLDEVVAILNEAKFITANIGDLPGALKSRLN-DSNKILMQQTLGILQQVATAM 929          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Yeast
Match: STU2 (Microtubule-associated protein (MAP) of the XMAP215/Dis1 family; regulates microtubule dynamics during spindle orientation and metaphase chromosome alignment; interacts with spindle pole body component Spc72p [Source:SGD;Acc:S000004035])

HSP 1 Score: 126.716 bits (317), Expect = 6.074e-30
Identity = 155/604 (25.66%), Postives = 266/604 (44.04%), Query Frame = 3
Query:  108 EEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQ--IPDNRNDPSFNSYLE---LLKNMVIDSNAVAQEKALEVVL--LFAQIVNVDNKAAKDIC------PGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDEL-LKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMK----EMFKTVHKLLEDRDKNVREAGKELIIEMYRWIG--STALNPVL-SQIKPVQVTELNAEFEKLPQEKPVPSRYL-----------KSQ----KPKESALVKPTG------GGDAVPQQSVGKHP---QNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALE----IIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRK-KFSPYAVNTIRI-CLEKFKEKKSNIVTVVRNCI-------DVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIF--EKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCE--------KAKLEPQLET--QISQIQSKFNLKTNPIVSN--VNSPPCR 1703
            EE+   +L   E++ +K WKAR+E Y+E  +L +  + D   D +   Y     L    + DSN VAQE+A+ V L  L     +   K A +I       P +V K   S R  T+  +   +  +  ++       EL +     K PK+++ +   + E++  FG   V ++    E+ K V +L    D+NVR     LI+E+Y+  G  S  L  +L  ++KP+QV +L+  F K+  E P  S+ L           +SQ    + ++S L    G       GD +        P   Q+ V ID + ++    ++ K+P ++ ++I   KW DR +ALE     +   T   K     Y +L+     ++ KD NI  VAL+A+ +  I   L+   FS   V+ +    L++ KEKK +++  +R  +       D    +      + D++   KHK P IR E     N     EK    +    L ++++P +  +  D+ P +R   F++    +K+         L++L NLK  +I E  +               +ET  Q   +++KF LK + ++ +  V S P R
Sbjct:    5 EEVDYTTLPLEERLTYKLWKARLEAYKELNQLFRNSVGDISRDDNIQIYWRDPTLFAQYITDSNVVAQEQAI-VALNSLIDAFASSSLKNAHNITLISTWTPLLVEKGLTSSRATTKTQSMSCILSLCGLDTSITQSVELVIPFFEKKLPKLIAAAANCVYELMAAFGLTNVNVQTFLPELLKHVPQLAGHGDRNVRSQTMNLIVEIYKVTGNNSDLLEEILFKKLKPIQVKDLHKLFAKVGDE-PSSSKMLFEWEKRELEKKRSQEEEARKRKSILSNDEGEYQIDKDGDTLMGMETDMPPSKQQSGVQIDTFSMLPEETILDKLPKDFQERITSSKWKDRVEALEEFWDSVLSQTKKLKSTSQNYSNLLGIYGHIIQKDANIQAVALAAQSVELICDKLKTPGFSKDYVSLVFTPLLDRTKEKKPSVIEAIRKALLTICKYYDPLASSGRNEDMLKDILEHMKHKTPQIRMECTQLFNASMKEEKDGYSTLQRYLKDEVVPIVIQIVNDTQPAIRTIGFESFAILIKIFGMNTFVKTLEHLDNLKRKKIEETVKTLPNFSIASGSTHSTIETNKQTGPMENKFLLKKSSVLPSKRVASSPLR 606          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Nematostella
Match: EDO43210 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZB8])

HSP 1 Score: 380.563 bits (976), Expect = 4.475e-109
Identity = 204/492 (41.46%), Postives = 309/492 (62.80%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIV--NVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKLE 1610
            +++ HK WKARV GYEE +++ +  D+     F+ YL  +K MV+D+NAVAQ+K LE VL F +    ++  + A D+  G + KC N+ R KT+E   EI+ + VE+E+QD+V +ELLKGL +K PK+V+    +  +I++ FG KI  +K + K + KL +  DK+VRE  K L IE+Y+WI   AL   L  IKPVQ+ EL+ E+ KLP   P P+R  ++Q+ K     +  G  DA P    G      +DIDPY+++D VE++SK+P ++Y+ +E KKW  RK+ALE +EKL +NPKL  G+YG+LM +L K++SKD N+++V L+AK +  +ATGLRKKFS Y+   +   L+KFKEKK+ +VT +R+ ID  +    +    +DL+ A  +KNP+I+ ET  F+ R F KS         +  +  NL     D+   VR+A  ++LGT  K++ EK + PY+D L  LK  ++ EF +KA+++
Sbjct:   14 DRLTHKVWKARVNGYEELVQIFKRTDDETSSEFSKYLGFMKKMVVDNNAVAQDKGLEAVLAFLEGAAPSISGRVAGDVICGCITKCLNA-RTKTKEKGIEIILMYVEVEKQDIVQEELLKGLENKQPKIVAACINVFTQIISLFGGKIFLLKPIVKVLPKLFDHSDKSVREEAKLLAIEIYQWI-RDALRQQLQNIKPVQLKELDEEWGKLPPAPPAPTRLTRTQQKKLEEQ-QAQGISDA-PYADDGGAVAETIDIDPYEMMDAVEILSKLPKDFYENLEAKKWQTRKEALEALEKLASNPKLEGGQYGELMSALKKIISKDANVMVVTLAAKCVAHLATGLRKKFSAYSAMMVSAILDKFKEKKTTVVTALRDAIDAVYLTTTLPAMQEDLLAALDNKNPSIKEETAKFLTRTFCKSVPSQVPKAFMKPICANLVKKMDDTAGPVRDAVAESLGTLTKLIGEKAMTPYIDKLDKLKADKVKEFADKAEIK 501          

HSP 2 Score: 69.707 bits (169), Expect = 8.349e-12
Identity = 92/364 (25.27%), Postives = 165/364 (45.33%), Query Frame = 3
Query:  108 EEIYSKSLNTF-----EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSN-AVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVE---IERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEK-PVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGL 1163
            E++ +K+ + F     EK+AH NWK R+ G EE  KL++  D++        + +L  K    D+N  V + K     ++  +     +++A+   PG+V K  +    K ++   E L +I E   +    + + ++  G   KNPKV+S S   L   L DFG KI  +K   + +   L + +  VR     LI  ++ ++G T +     + K   +++++ E  K+  EK P P+R L   KP  +        G              N++    DL+   ++ ++I  +  D + +K W  R + L+ ++++    K +  + GDL  S LK    D+N  LV  +  I   IAT +
Sbjct:  567 EDVQAKAADLFPADLLEKLAHTNWKERMAGMEELHKLVESMDDKT-MECQVLIRVLGKKPGWKDNNFQVLKSKFQLCGIIAGKGKTFSSRSAEYAIPGLVEKIGDI---KLKDAVKETLMIISEKLNLGYVSLKVSQIAGG--QKNPKVISESLSWLGSALKDFGFKI-DLKPHVQYLKDALANTNPAVRTEAISLIGVLHMYVGPT-IRVFFEEEKAALLSQIDDEIAKVKDEKPPAPTRGL---KPAAADGDDDGEEGGDDAGGDEDDGSSANLE----DLIPRNDISNEIKPDLIDMLADKNWKVRGEGLQKVQEILAAAKFITPDLGDL-PSALKARLGDSNKNLVITTLNICGTIATAM 914          
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Medaka
Match: ckap5 (cytoskeleton associated protein 5 [Source:NCBI gene;Acc:101172655])

HSP 1 Score: 383.259 bits (983), Expect = 3.503e-110
Identity = 205/481 (42.62%), Postives = 300/481 (62.37%), Query Frame = 3
Query:  141 EKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESAL-VKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRI 1580
            +K  HK WKAR+ GYEEALKL Q  ++   P +  YL L+K  V DSNAVAQ K LE  L F +  +V N+   ++  G+V K FN P+ + +EL  +I  + +EIE+ +VV +ELLKGL++KNPK+V      L++ L +FG KIV +K + K + K  E R+K VR+  + L +E+Y+WI   AL P L  I  VQ+ EL  E+ KLP   P  SR+L+SQ+  ++    +   GG+     S+G      + +DPY+L++PVE++SK+P ++YD+IE KKW +RK+ALE IE LT NPKL  G+YGDL+++L KV+ KD N++LV+L+AK +  +ATGLRKKF  Y+   +   LEKFKEKK  +V  ++  ID  F    +    +D++    +KNP+I+ +  LF+ R F   +  +    +L      L     DS PEVR+AAF+ LGT MKV+ EK + P+L +L  LKL ++
Sbjct:   14 QKCEHKVWKARLNGYEEALKLFQRIEDAKSPEWGKYLGLIKKFVTDSNAVAQLKGLEAALAFVENAHVANRTTGEVVSGVVTKVFNQPKARAKELGMDICLMYIEIEKAEVVQEELLKGLDNKNPKIVVACLETLRKALGEFGSKIVTLKPVVKILPKQFESREKAVRDEARLLAVEIYKWI-RDALRPSLQNINSVQLKELEEEWVKLPSTPPKQSRFLRSQQDLKAKFEQQQVQGGEHSDGGSLG------ISVDPYELLEPVEILSKMPKDFYDKIEAKKWQERKEALEAIETLTKNPKLENGDYGDLVRALKKVVGKDANVMLVSLAAKCLAGLATGLRKKFGTYSGQVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNLSEDILAVMDNKNPSIKQQASLFLARSFRHCSQATLPKSVLKPFCAALIKQVNDSAPEVRDAAFEALGTVMKVVGEKAVNPFLADLDKLKLDKV 487          

HSP 2 Score: 69.707 bits (169), Expect = 2.285e-11
Identity = 112/488 (22.95%), Postives = 199/488 (40.78%), Query Frame = 3
Query:  102 MVEEIYSKSL--NTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELL--KNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLK-GLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKL-PQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIAT----GLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKL 1535
            + EE+ +  L  N  + +   NWK R+   EE  K ++  D    P   + + +L  K    ++N    +  L +V L AQ       +A  +  G+V+K  +    K    A E L  I E        ++L+      KNPK  + +   L   + +FG   + +K     V   L   +  VR A   L+  MY ++G+  L       KP  + +++AEFEK+  Q  P P R+ +          K     D V +             D  DL+   ++  KI ++   +I +K W  RK+ L+    + +  K +    G+L  +L   L+ D+N +LV  +  I+ Q+AT    G+++      +  I +  +     +S  +T ++  +D +     +           K +NP +R E + ++        + +  G L+   +P L T  +D   +VR  A   L T M  L   K+
Sbjct:  550 VCEELAAGVLPENCLQALDSANWKERLASMEEFQKAVETMDTVTMPC-QALVRMLAKKPGWKETNFQVMQMKLHIVALVAQRGQFSKTSASVVLEGLVDKVGDV---KCGGNAKEGLTAIGEACSLPWTAEQLVSLAFAQKNPKNQAEALNWLANAMKEFGFTGINVKAFINNVKTALGATNPGVRTAAITLLGVMYLYMGAP-LRMFFEDEKPALLAQIDAEFEKMQGQSPPAPIRFNR----------KSASAEDEVDEGEEQDEDGGGGGQDIMDLLPRSDISDKITSDLVSKIGDKNWKIRKEGLDEAAAIISEAKFIKPTIGELPFALKGRLA-DSNKILVQQTLSILQQLATAMGPGIKQHVKSLGIPIITVLGDSKANVRSAALTTLQAWVDQTGMKDWLEGEDLSEEL--KRENPFLRQEVLGWLAEKL--PALRTVPGDLM-LCVPQLYTCLEDRNGDVRKKAQDALPTFMMHLGYDKM 1016          
BLAST of Cytoskeleton-associated protein 5-A vs. Planmine SMEST
Match: SMESG000045157.1 (SMESG000045157.1)

HSP 1 Score: 1109.36 bits (2868), Expect = 0.000e+0
Identity = 565/574 (98.43%), Postives = 570/574 (99.30%), Query Frame = 3
Query:  102 MVEEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKLEPQLETQISQIQSKFNLKTNPIVSNVNSPPCRKRKEIETIENITNRYAKLPMKEQNPIVILDELRDL*VTRN 1823
            MVEEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPD+RNDPSFNSYLELLKNMVIDSNA AQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNS RQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFDAININCCIDDLINASKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDN+ANLKLVRINEFCEKAKLEPQLETQISQIQSKFNLKTNPIVSNVNSPPCRKRKEIETIENITNRYAKLPMKEQNPIVILDELRDL + ++
Sbjct:    1 MVEEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDSRNDPSFNSYLELLKNMVIDSNAFAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSQRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFDAININCCIDDLINASKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNVANLKLVRINEFCEKAKLEPQLETQISQIQSKFNLKTNPIVSNVNSPPCRKRKEIETIENITNRYAKLPMKEQNPIVILDELRDLSINQD 574          

HSP 2 Score: 262.307 bits (669), Expect = 7.769e-73
Identity = 130/132 (98.48%), Postives = 131/132 (99.24%), Query Frame = 2
Query: 3503 SINQDCKSQHVSLSDSHSIGNSKETEIIDLEISIENLEADDNQVKLQEQSNNYFDPKESVYYELLQRSKNPTDEDIETYLWLHEHDEKIEQLKRNKTILMKDHIKLLIDNIITKDLKISIFASDFVISIMSE 3898
            SINQDC+SQHVSLSDSHSIGNSKETEIIDLEIS ENLEADDNQVKLQEQSNNYFDPKESVYYELLQRSKNPTDEDIETYLWLHEHDEKIEQLKRNKTILMKDHIKLLIDNIITKDLKISIFASDFVISIMSE
Sbjct:  570 SINQDCESQHVSLSDSHSIGNSKETEIIDLEISTENLEADDNQVKLQEQSNNYFDPKESVYYELLQRSKNPTDEDIETYLWLHEHDEKIEQLKRNKTILMKDHIKLLIDNIITKDLKISIFASDFVISIMSE 701          

HSP 3 Score: 73.1738 bits (178), Expect = 1.104e-12
Identity = 34/35 (97.14%), Postives = 34/35 (97.14%), Query Frame = 3
Query: 3897 NDLFCDIDLSGVVDKIYNNCIQIPVESDAATNFNL 4001
            NDLFCDIDLSGVVDKIYNNCIQIPVESDAA NFNL
Sbjct:  831 NDLFCDIDLSGVVDKIYNNCIQIPVESDAAANFNL 865          
BLAST of Cytoskeleton-associated protein 5-A vs. Planmine SMEST
Match: SMESG000045157.1 (SMESG000045157.1)

HSP 1 Score: 793.497 bits (2048), Expect = 0.000e+0
Identity = 407/413 (98.55%), Postives = 411/413 (99.52%), Query Frame = 3
Query:  585 MKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAKLEPQLETQISQIQSKFNLKTNPIVSNVNSPPCRKRKEIETIENITNRYAKLPMKEQNPIVILDELRDL*VTRN 1823
            MKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFDAININCCIDDLINASKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDN+ANLKLVRINEFCEKAKLEPQLETQISQIQSKFNLKTNPIVSNVNSPPCRKRKEIETIENITNRYAKLPMKEQNPIVILDELRDL + ++
Sbjct:    1 MKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFDAININCCIDDLINASKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNVANLKLVRINEFCEKAKLEPQLETQISQIQSKFNLKTNPIVSNVNSPPCRKRKEIETIENITNRYAKLPMKEQNPIVILDELRDLSINQD 413          

HSP 2 Score: 261.536 bits (667), Expect = 8.132e-74
Identity = 130/132 (98.48%), Postives = 131/132 (99.24%), Query Frame = 2
Query: 3503 SINQDCKSQHVSLSDSHSIGNSKETEIIDLEISIENLEADDNQVKLQEQSNNYFDPKESVYYELLQRSKNPTDEDIETYLWLHEHDEKIEQLKRNKTILMKDHIKLLIDNIITKDLKISIFASDFVISIMSE 3898
            SINQDC+SQHVSLSDSHSIGNSKETEIIDLEIS ENLEADDNQVKLQEQSNNYFDPKESVYYELLQRSKNPTDEDIETYLWLHEHDEKIEQLKRNKTILMKDHIKLLIDNIITKDLKISIFASDFVISIMSE
Sbjct:  409 SINQDCESQHVSLSDSHSIGNSKETEIIDLEISTENLEADDNQVKLQEQSNNYFDPKESVYYELLQRSKNPTDEDIETYLWLHEHDEKIEQLKRNKTILMKDHIKLLIDNIITKDLKISIFASDFVISIMSE 540          

HSP 3 Score: 73.1738 bits (178), Expect = 1.045e-12
Identity = 34/35 (97.14%), Postives = 34/35 (97.14%), Query Frame = 3
Query: 3897 NDLFCDIDLSGVVDKIYNNCIQIPVESDAATNFNL 4001
            NDLFCDIDLSGVVDKIYNNCIQIPVESDAA NFNL
Sbjct:  670 NDLFCDIDLSGVVDKIYNNCIQIPVESDAAANFNL 704          
BLAST of Cytoskeleton-associated protein 5-A vs. Planmine SMEST
Match: SMESG000045143.1 (SMESG000045143.1)

HSP 1 Score: 425.631 bits (1093), Expect = 3.235e-124
Identity = 210/248 (84.68%), Postives = 221/248 (89.11%), Query Frame = 3
Query:  102 MVEEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTG 845
            M E +  K LNT +KI HKNWKARVEGYEEALK MQ+ D+  DP FN YL L+KNMVIDSNAVAQEKALEV+LLF Q  NV NKAA DICPGIVNKCFNS RQKTRELAFEILKVIVEIERQDVVM+EL+KGL+ K PKVV GS  +LKE+L DFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKES LVKPTG
Sbjct:    1 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESTLVKPTG 248          

HSP 2 Score: 153.295 bits (386), Expect = 4.435e-39
Identity = 75/118 (63.56%), Postives = 99/118 (83.90%), Query Frame = 3
Query: 1251 VRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAK 1604
            +R+CID +F   +I+ C+++L+NA  HK P++++ET LF+NR+FEKS+ME W+GKLL Q+IP LT LC DS+PEVR+AAF+TLGTAMKV+ EKKLKPYLD + N+KL RINEF EKAK
Sbjct:  275 LRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAK 392          

HSP 3 Score: 29.261 bits (64), Expect = 4.435e-39
Identity = 14/20 (70.00%), Postives = 17/20 (85.00%), Query Frame = 2
Query: 1172 VLSICSQYNSNLFGKIQRKK 1231
            VLSICSQYNS+   +IQR+K
Sbjct:  249 VLSICSQYNSSNSREIQREK 268          
BLAST of Cytoskeleton-associated protein 5-A vs. Planmine SMEST
Match: SMESG000045143.1 (SMESG000045143.1)

HSP 1 Score: 425.631 bits (1093), Expect = 3.803e-124
Identity = 210/248 (84.68%), Postives = 221/248 (89.11%), Query Frame = 3
Query:  102 MVEEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTG 845
            M E +  K LNT +KI HKNWKARVEGYEEALK MQ+ D+  DP FN YL L+KNMVIDSNAVAQEKALEV+LLF Q  NV NKAA DICPGIVNKCFNS RQKTRELAFEILKVIVEIERQDVVM+EL+KGL+ K PKVV GS  +LKE+L DFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKES LVKPTG
Sbjct:    1 MAEVLDFKGLNTLDKIEHKNWKARVEGYEEALKAMQMSDSGKDPLFNPYLGLVKNMVIDSNAVAQEKALEVILLFVQEANVANKAANDICPGIVNKCFNSTRQKTRELAFEILKVIVEIERQDVVMEELIKGLSCKTPKVVVGSINVLKEVLRDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESTLVKPTG 248          

HSP 2 Score: 153.295 bits (386), Expect = 4.362e-39
Identity = 75/118 (63.56%), Postives = 99/118 (83.90%), Query Frame = 3
Query: 1251 VRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKAK 1604
            +R+CID +F   +I+ C+++L+NA  HK P++++ET LF+NR+FEKS+ME W+GKLL Q+IP LT LC DS+PEVR+AAF+TLGTAMKV+ EKKLKPYLD + N+KL RINEF EKAK
Sbjct:  275 LRDCIDSAFVTTSIDACMEELLNALNHKTPSVKSETALFLNRVFEKSSMEMWTGKLLKQIIPGLTNLCLDSVPEVRDAAFQTLGTAMKVVTEKKLKPYLDKMDNVKLARINEFYEKAK 392          

HSP 3 Score: 29.261 bits (64), Expect = 4.362e-39
Identity = 14/20 (70.00%), Postives = 17/20 (85.00%), Query Frame = 2
Query: 1172 VLSICSQYNSNLFGKIQRKK 1231
            VLSICSQYNS+   +IQR+K
Sbjct:  249 VLSICSQYNSSNSREIQREK 268          
BLAST of Cytoskeleton-associated protein 5-A vs. Planmine SMEST
Match: SMESG000045133.1 (SMESG000045133.1)

HSP 1 Score: 202.216 bits (513), Expect = 2.534e-52
Identity = 144/492 (29.27%), Postives = 259/492 (52.64%), Query Frame = 3
Query:  150 AHKNWKARVEGYEEALKLMQIPDN----RNDPSFNSYLELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNSPRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGS----TILLKEILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTALNPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGGDAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRKDALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQIATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFXXXXXXXXXXXXXXXSKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTLCQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKA 1601
            A KNWK +++ Y + ++ + +        N+P      E++K++  + NA+A EK+LE+V+ + ++  +  +  K     I+ KCF S + + R    +IL ++ E    DVV + LL+ + S    +V+G      I++K++      K + +K++ K +  +++ RDK  R+  K+L IE+  + G   + P L  IKPV ++EL +EF+K+ +   +                                       I+  D   PV+++S I  + Y++I+  +  +RK+ LE + ++ +N  L+ G Y +L++ L ++ +KD+ I  V L+ K++ QIA GL+K FS Y+   +  C EKFKEKK  +++V R CID +F   N+  C + ++ + ++KNP IR ET+ F+ RI E   + S   K   +L+P L  LC D+  +VR   F+ +G  + ++ EK +KP+L+ L + KL  IN    K+
Sbjct:   14 APKNWKEKIDTYAKVIEEIDLQSPIVFLDNNP------EIIKDLFNECNALAFEKSLEMVISYCKVSEIGKRNVKLELKLIIEKCFLSTKSQIRSYGIDILIILSEKYCIDVV-EILLENILSNKRSIVNGILETLMIMIKQV------KKLQIKDIIKQIPNVIDARDKLTRDLSKKLAIEICTYYGRNRIEPCLKDIKPVLLSELQSEFDKVIENINISV-------------------------------------IENEDCKLPVDLLSHISTDMYEKIDGSRQ-ERKEVLEKLNEVIDNSPLINGNYRELIRKLCQIFTKDSQIASVILAGKLLTQIANGLKKNFSTYSSMLVESCFEKFKEKKPQVLSVTRECIDAAFMTTNLENCFEGILKSLENKNPTIRVETISFLLRITENLQVISSLKKNFKRLMPCLRKLCDDNDVKVREEVFQLIGKIICIVGEKNIKPFLEKLDSTKLQIINSITSKS 454          
The following BLAST results are available for this feature:
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CKAP53.579e-10742.36cytoskeleton associated protein 5 [Source:HGNC Sym... [more]
CKAP53.602e-10742.14cytoskeleton associated protein 5 [Source:HGNC Sym... [more]
CKAP53.602e-10742.14cytoskeleton associated protein 5 [Source:HGNC Sym... [more]
CKAP54.293e-3144.53cytoskeleton associated protein 5 [Source:HGNC Sym... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zyg-93.002e-4531.82Zygote defective protein 9 [Source:UniProtKB/Swis... [more]
F54A3.25.466e-1822.47pep chromosome:WBcel235:II:2243642:2254323:1 gene:... [more]
T08D2.83.693e-1026.58pep chromosome:WBcel235:X:192834:197901:1 gene:WBG... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msps1.064e-10740.56gene:FBgn0027948 transcript:FBtr0304803[more]
msps1.064e-10740.56gene:FBgn0027948 transcript:FBtr0301479[more]
msps1.181e-10740.56gene:FBgn0027948 transcript:FBtr0304802[more]
msps1.193e-10740.56gene:FBgn0027948 transcript:FBtr0304801[more]
msps1.371e-10740.56gene:FBgn0027948 transcript:FBtr0301480[more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ckap51.436e-10641.84cytoskeleton associated protein 5 [Source:ZFIN;Acc... [more]
ckap52.124e-10641.84cytoskeleton associated protein 5 [Source:ZFIN;Acc... [more]
ckap51.010e-3349.61cytoskeleton associated protein 5 [Source:ZFIN;Acc... [more]
ckap53.236e-2748.80cytoskeleton associated protein 5 [Source:ZFIN;Acc... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CKAP54.905e-11042.91cytoskeleton associated protein 5 [Source:NCBI gen... [more]
CKAP54.942e-11042.91cytoskeleton associated protein 5 [Source:NCBI gen... [more]
CKAP55.644e-11042.91cytoskeleton associated protein 5 [Source:NCBI gen... [more]
CKAP51.234e-10742.57cytoskeleton associated protein 5 [Source:NCBI gen... [more]
CKAP51.274e-10742.57cytoskeleton associated protein 5 [Source:NCBI gen... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ckap51.870e-10842.97cytoskeleton associated protein 5 [Source:MGI Symb... [more]
Ckap52.510e-10842.97cytoskeleton associated protein 5 [Source:MGI Symb... [more]
Ckap52.510e-10842.97cytoskeleton associated protein 5 [Source:MGI Symb... [more]
Ckap52.584e-10842.97cytoskeleton associated protein 5 [Source:MGI Symb... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2AGT5|CKAP5_MOUSE1.693e-10742.97Cytoskeleton-associated protein 5 OS=Mus musculus ... [more]
sp|Q9VEZ3|MSPS_DROME1.375e-10640.56Protein mini spindles OS=Drosophila melanogaster O... [more]
sp|Q14008|CKAP5_HUMAN1.719e-10642.36Cytoskeleton-associated protein 5 OS=Homo sapiens ... [more]
sp|Q9PT63|CKAP5_XENLA6.707e-10642.45Cytoskeleton-associated protein 5-A OS=Xenopus lae... [more]
sp|O94534|ALP14_SCHPO1.121e-6530.46Spindle pole body component alp14 OS=Schizosacchar... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183PF574.583e-14347.09Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A5K3F8Q24.103e-14047.99Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A564XW584.316e-13946.98Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3T8Z14.854e-13946.96Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0V0J9X72.317e-13750.50Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000018997.21.064e-10740.24pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ckap52.611e-6940.86cytoskeleton associated protein 5 [Source:ZFIN;Acc... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009507.17.563e-10942.07pep scaffold:Pmarinus_7.0:GL477430:472908:497137:1... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
STU26.074e-3025.66Microtubule-associated protein (MAP) of the XMAP21... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO432104.475e-10941.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ckap53.503e-11042.62cytoskeleton associated protein 5 [Source:NCBI gen... [more]
back to top
BLAST of Cytoskeleton-associated protein 5-A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045157.17.769e-7398.43SMESG000045157.1[more]
SMESG000045157.18.132e-7498.55SMESG000045157.1[more]
SMESG000045143.13.235e-12484.68SMESG000045143.1[more]
SMESG000045143.13.803e-12484.68SMESG000045143.1[more]
SMESG000045133.12.534e-5229.27SMESG000045133.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025079 ID=SMED30025079|Name=Cytoskeleton-associated protein 5-A|organism=Schmidtea mediterranea sexual|type=transcript|length=4003bp
TATATTTAAATTATAATTGTCTTTATTATAATTAATTATTTAAGTATTGT
TTCATTTTATTATTTTGAATATTAGTTACTTATTAACTAGTAATTTAATA
AATGGTTGAAGAAATATATTCCAAAAGTTTAAATACTTTTGAAAAAATTG
CACACAAAAATTGGAAAGCACGAGTTGAAGGATACGAAGAAGCTTTGAAA
TTAATGCAGATACCAGACAATAGGAACGATCCGTCATTTAATTCATATTT
AGAATTATTAAAAAATATGGTTATTGATAGTAATGCAGTTGCTCAAGAAA
AAGCTTTGGAAGTGGTTTTACTTTTTGCTCAAATAGTCAATGTCGATAAC
AAAGCTGCAAAAGATATATGTCCAGGTATTGTGAATAAATGTTTTAATTC
ACCACGGCAAAAGACCAGAGAGTTGGCATTTGAAATTCTAAAAGTCATAG
TGGAAATAGAAAGACAAGACGTGGTAATGGATGAATTGCTTAAAGGCTTA
AATTCTAAAAATCCTAAAGTTGTTTCTGGATCTACAATTTTATTAAAAGA
AATTTTGAATGATTTTGGCCCAAAAATAGTACCAATGAAGGAAATGTTCA
AAACTGTCCATAAACTGCTGGAAGATCGAGATAAAAACGTCAGAGAAGCA
GGCAAAGAGTTAATTATAGAAATGTATCGATGGATCGGTTCTACCGCGTT
GAATCCGGTTTTGTCTCAAATAAAACCCGTCCAAGTTACCGAACTTAACG
CGGAATTCGAAAAATTACCGCAAGAGAAACCGGTACCGAGCCGATATTTG
AAGTCCCAGAAACCGAAAGAATCAGCTCTAGTAAAACCAACAGGAGGTGG
CGATGCAGTGCCACAACAAAGCGTTGGGAAACACCCTCAGAACAATGTTG
ATATTGACCCGTATGATTTAGTAGACCCAGTGGAAGTGATATCGAAAATC
CCAGCCAATTATTACGATCAAATAGAAGAAAAGAAATGGACCGATAGAAA
GGATGCGTTGGAAATCATTGAAAAGCTGACAAATAATCCAAAATTAGTCC
CAGGAGAATACGGAGACCTGATGAAATCACTTCTGAAAGTGCTATCAAAG
GATACAAATATTGTACTAGTGGCTCTTTCAGCGAAAATAATTTACCAAAT
CGCCACCGGTCTACGTAAAAAGTTCTCTCCATATGCAGTCAATACAATTC
GAATTTGTTTGGAAAAATTCAAAGAAAAAAAATCTAACATAGTAACAGTT
GTTAGGAACTGTATCGATGTATCGTTCGACGCGATTAACATAAACTGTTG
CATTGATGATTTAATAAATGCTTCGAAACACAAAAATCCAAATATTAGAA
CAGAAACCGTACTTTTCATGAATCGAATATTTGAAAAAAGTAACATGGAA
TCTTGGTCTGGAAAATTACTCAATCAATTAATACCTAACCTTACTACTCT
TTGTCAAGACAGCATTCCTGAAGTTCGAAATGCGGCTTTTAAAACTTTAG
GAACAGCAATGAAAGTCTTGGAGGAAAAGAAATTGAAACCGTATCTGGAT
AATTTAGCCAATCTGAAACTTGTTCGTATAAATGAGTTTTGTGAAAAAGC
AAAACTTGAACCTCAGTTAGAGACTCAAATCAGTCAAATTCAATCCAAAT
TCAATCTCAAAACGAACCCCATAGTATCGAACGTAAATTCCCCCCCGTGC
AGGAAGAGAAAAGAAATCGAAACAATAGAAAATATTACAAATCGTTACGC
AAAATTGCCAATGAAAGAACAAAATCCAATTGTTATTTTGGATGAACTTC
GAGACTTGTAAGTAACGCGAAATATTTCTCATCTCTAATTTCTTTGACGC
GTTCTTTCAAAATAAGAGTTTAGTGAGGATTAATTAGTCCGTTACGTGCC
CTAACGAATTCCATATAGTATTCCCATGCGTTCATCATGATTTGACAACG
TTATAGCTCTTTTTTCTATCTGATGTTTCAGACAATGGGCGTAGAATGAG
TTAACCGCTTATTGCACAACTTCTTTTACTAGTAGAATAGCAACTCCGGG
TTTGTCTCGAGCAACGTTTATTGAAAACTTTTAACCAATTATAAGTCGAA
AACAAATATTTCTACAGTATATAAAATTCATATAGTTTATTTGCACTTTT
TAATCGATAAGTTACTGAATAATATAGATTTTAGCATGGAATGATTAAAT
CCACGGATTCTGGCTTCGAGTATGGTAATCTATCTAAAGGTGTGAGTGAT
AATAATGATCTGGTTATGTAAAATTAATACCGAGACACCGGTGCAATGTA
TGTGCAATGTAGGTGCAATGTAGGTGCAAAGCATCAAATGTAATTTAAAA
TCGGAAAATAGTTAATATTATTCACTCGGAAAAATCGATATTCGCATACG
GTGGGAAATGATGAGACAAATACAAAAATATAGTAATATAAAATCGATTC
AAAGTTATTTTATAAATGTAAACTAATTAATTGCAGAAAAACAAATAAAT
TTAATTAGAAACAAAATCACCGAGCTTGACATGCGAAATACCAAATTGTT
AAACTAAAATCAAAATAATTAAATTGGGAAGTAATTGACGAGTTGAAAGT
TCTATTAGACTTTATTAATTAAAGGAGTTGAGAACTTAGGTATATCGTTC
TCACAATTGAGAATAAAATAGTGAAGGAAAGTTGAACCTGAGTTAATGTC
GTTCTGAAGGCGTTTAAGAACAAATGAAGTTACAAATAAAAACAGTTATT
TTGTGAAGAAATCGAAATGCGGATAACTTTGAGGTTGTTCCAAAAAGTAT
AACAAGGGAAAATATAAAAAGGAGATCGATTTTTTACTCGGAAAAAGTTG
TCTGTTAAAGAGTTTAAGAGAAGGTTACTTGATAATAATAAATCCGAATA
ATCTACAATAAATAAGCTGAATTTGTAACGTAGAGTTCAATTTTGTGTAT
TCTTTATGAATTACTAGTAATCTCAAATAGTTGGATGACGTGTTCAATTT
TTAACGCTTGAATATGCTGGATCTTTCCTTGGGTTCTTTAGTATTGTTAC
AATGATGATAAATGACAATGACAAAACAAGAAATCCAATAATGTACGGCT
CCTTATTGACTCTTCGATTTGTGCTAAAATTCGCCCAGTTACATTGACTT
CTTCCCATTCAATAAAATCACAATTGAAATTTATTTTTAGTTTAGACAAT
TTATCGCAGAAAATGACCAAATAAACGCCTATAGTTGTTATTCGATAAAA
TAACATCACCCATCTAAAGTAGAGACATTGCTTGCTGATAGTTCATTTCT
TGTGTTATTGTACTACAGAACTCTTTATGCAAAAGTTTCTAGCTAAATTT
ATTGAATATTTTCCTTAATTGTTCCCGTAATTCTAAACATCTGTTGGCAA
TTGCCACAATATGTGAAACTTGAAGAAACTATTTTTCATTAACAAAACTA
ATTTATTTACACGTTAAATTTAAATTGAAACGTTTTTAAAAAATTCCACA
GAAGTATTAATCAAGATTGCAAAAGCCAGCATGTTTCTCTATCTGATAGT
CATAGTATTGGAAATTCAAAAGAAACTGAAATAATTGATTTAGAAATTAG
TATTGAAAACCTCGAAGCAGATGATAACCAAGTTAAGTTACAAGAACAAT
CAAATAATTATTTCGATCCTAAAGAGAGCGTCTATTACGAATTATTGCAA
AGATCTAAAAATCCAACTGACGAAGATATTGAAACCTATCTTTGGTTACA
CGAACATGATGAAAAAATTGAACAATTAAAGCGAAACAAAACTATATTGA
TGAAAGACCACATAAAACTTCTCATTGATAATATTATTACTAAAGACCTG
AAAATTAGTATTTTTGCAAGTGATTTTGTGATTAGTATAATGTCAGAATG
ATCTATTTTGCGATATTGATTTATCTGGGGTCGTTGACAAGATTTATAAC
AACTGTATTCAAATTCCAGTAGAATCTGATGCTGCGACTAACTTCAATCT
TCG
back to top

protein sequence of SMED30025079-orf-1

>SMED30025079-orf-1 ID=SMED30025079-orf-1|Name=SMED30025079-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=570bp
MVEEIYSKSLNTFEKIAHKNWKARVEGYEEALKLMQIPDNRNDPSFNSYL
ELLKNMVIDSNAVAQEKALEVVLLFAQIVNVDNKAAKDICPGIVNKCFNS
PRQKTRELAFEILKVIVEIERQDVVMDELLKGLNSKNPKVVSGSTILLKE
ILNDFGPKIVPMKEMFKTVHKLLEDRDKNVREAGKELIIEMYRWIGSTAL
NPVLSQIKPVQVTELNAEFEKLPQEKPVPSRYLKSQKPKESALVKPTGGG
DAVPQQSVGKHPQNNVDIDPYDLVDPVEVISKIPANYYDQIEEKKWTDRK
DALEIIEKLTNNPKLVPGEYGDLMKSLLKVLSKDTNIVLVALSAKIIYQI
ATGLRKKFSPYAVNTIRICLEKFKEKKSNIVTVVRNCIDVSFDAININCC
IDDLINASKHKNPNIRTETVLFMNRIFEKSNMESWSGKLLNQLIPNLTTL
CQDSIPEVRNAAFKTLGTAMKVLEEKKLKPYLDNLANLKLVRINEFCEKA
KLEPQLETQISQIQSKFNLKTNPIVSNVNSPPCRKRKEIETIENITNRYA
KLPMKEQNPIVILDELRDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR034085TOG
IPR000357HEAT
IPR011989ARM-like
IPR024395CLASP_N_dom
IPR021133HEAT_type_2
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
GO:0008017microtubule binding
GO:0043021ribonucleoprotein complex binding
GO:0051010microtubule plus-end binding
GO:0098641cadherin binding involved in cell-cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0000775chromosome, centromeric region
GO:0000776kinetochore
GO:0000777condensed chromosome kinetochore
GO:0000922spindle pole
GO:0005694chromosome
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005819spindle
GO:0005856cytoskeleton
GO:0005913cell-cell adherens junction
GO:0016020membrane
GO:0043234protein complex
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0007051spindle organization
GO:0007067mitotic nuclear division
GO:0030951establishment or maintenance of microtubule cytoskeleton polarity
GO:0046785microtubule polymerization
GO:0050658RNA transport
GO:0051297centrosome organization
GO:0051298centrosome duplication
GO:0051301cell division
GO:0098609cell-cell adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR034085TOG domainSMARTSM01349TOG_3coord: 1..228
e-value: 2.8E-56
score: 203.0
coord: 272..506
e-value: 4.5E-62
score: 222.2
IPR024395CLASP N-terminal domainPFAMPF12348CLASP_Ncoord: 86..201
e-value: 1.7E-7
score: 31.1
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 3..245
e-value: 8.7E-70
score: 237.3
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 269..500
e-value: 6.1E-74
score: 250.5
IPR000357HEAT repeatPFAMPF02985HEATcoord: 443..472
e-value: 3.2E-4
score: 20.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 226..264
NoneNo IPR availablePANTHERPTHR12609MICROTUBULE ASSOCIATED PROTEIN XMAP215coord: 11..524
IPR021133HEAT, type 2PROSITEPS50077HEAT_REPEATcoord: 443..481
score: 11.585
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 14..485