SMED30025076

Overview
NameSMED30025076
Smed IDSMED30025076
Length (bp)2947
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30025076 (SMED30025076) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30025076 (SMED30025076) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30025076 (SMED30025076) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30025076 (SMED30025076) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025076

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30025076SMESG000010166.1 dd_Smed_v4_2518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30025076SMESG000010166.1 dd_Smed_v4_2518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30025076SMESG000010166.1 dd_Smed_v6_2518_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30025076SMESG000010166.1 dd_Smed_v4_2518_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025076SMESG000010166.1 dd_Smed_v4_2518_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30025076SMESG000010166.1 dd_Smed_v4_2518_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30025076SMESG000010166.1 dd_Smed_v4_2518_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30025076 vs. Ensembl Human
Match: SEMA5B (semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737])

HSP 1 Score: 113.62 bits (283), Expect = 7.587e-25
Identity = 157/723 (21.72%), Postives = 283/723 (39.14%), Query Frame = 3
Query:  321 SSKNVYHIQTHQQQL--------IEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCE-----ERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTNCMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSL--SLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHT---------ESNELCNIGIYKLVPKENVFQISGLTTDNNAYIL-ISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER--SSC--KNIIDN---SVWSIPSICFVNDSQISLKCICKY--C-TNEIMCSN----KPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICT-----TVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCEN 2321
            SS++V    + +QQL        + F+     V +FT+   +DF+Q  +  + N     +V   N +  + L  + +       +       C+     E    N++  + V   K+      +  +N ++   T+  +  N + T + K           +H + +V++ +  ++    +D S      + P I   + S   L T   N  +     F+  ++     YF + E     +    DC      R VY +R+ R+CK D GG     E  + T  KA + C    G+  F+Y++  SA     +  +Y +F    NS     VC F+L A    FNGP R      N +     + NP+P+  C  L   +   NE +T  SL  +      ++ + PV   P +   +   + +    +  +D      +++ ++I   S T          S   C +    ++P      +  L   ++A  L +   D ++R+ +  C  Y ++  CL      CGWD +   C++L D  +++ W +  ++C  +N+  +     WS    C   D   S  C+C+   C +    C       P I I NC+     G W  W +W+ CS       ++R+R CS+         C+G++ E + C       V   W+ W             SKCS++  G    ++ R   CEN
Sbjct:   83 SSQDVSSEPSSEQQLCALSKHPTVAFEDLQPWVSNFTYPGARDFSQLALDPSGNQ---LIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNYVRVLIVAGRKVF-----MCGTNAFSPMCTSRQV-GNLSRTIE-KINGVARCPYDPRHNSTAVISSQGELYAATVIDFS-----GRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAYDIGLFAYFFLRE-----NAVEHDC-----GRTVY-SRVARVCKNDVGGRF-LLEDTWTTFMKARLNCSR-PGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFR---YQENPRAAWLPIANPIPNFQCGTLP--ETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKD-----TLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVLPPGRREPLRSLRILHSARALFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCS---RNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIFWASW----------GSWSKCSSNCGG---GMQSRRRACEN 751          

HSP 2 Score: 65.0846 bits (157), Expect = 7.384e-10
Identity = 49/160 (30.63%), Postives = 63/160 (39.38%), Query Frame = 3
Query: 2061 GEWNEWGAWSTCSP--EKKTKIRKRECS------SKFSCIGQTEETKICTT----VRSVWSQWY------ITSNPKIYNSFRSKCSTDDSGPSSTI----EIREMVCE-NTCQENLFKWYKWSKWSDCTSQNVQYRLYNCSEL----SQCPANQTQIQNC 2459
            G W  WG WS+CS   E   ++RKR C+          C+G   E + C      VR  WS W        +     Y   RS C++    P   I       E +C    C E    W  WS+WS CT    Q R  +C EL    S C  N +Q + C
Sbjct:  854 GGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPVRGAWSCWTSWSPCSASCGGGHYQRTRS-CTSPAPSPGEDICLGLHTEEALCATQACPEG---WSPWSEWSKCTDDGAQSRSRHCEELLPGSSACAGNSSQSRPC 1009          
BLAST of SMED30025076 vs. Ensembl Human
Match: SEMA5B (semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737])

HSP 1 Score: 113.62 bits (283), Expect = 7.755e-25
Identity = 157/723 (21.72%), Postives = 283/723 (39.14%), Query Frame = 3
Query:  321 SSKNVYHIQTHQQQL--------IEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCE-----ERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTNCMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSL--SLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHT---------ESNELCNIGIYKLVPKENVFQISGLTTDNNAYIL-ISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER--SSC--KNIIDN---SVWSIPSICFVNDSQISLKCICKY--C-TNEIMCSN----KPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICT-----TVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCEN 2321
            SS++V    + +QQL        + F+     V +FT+   +DF+Q  +  + N     +V   N +  + L  + +       +       C+     E    N++  + V   K+      +  +N ++   T+  +  N + T + K           +H + +V++ +  ++    +D S      + P I   + S   L T   N  +     F+  ++     YF + E     +    DC      R VY +R+ R+CK D GG     E  + T  KA + C    G+  F+Y++  SA     +  +Y +F    NS     VC F+L A    FNGP R      N +     + NP+P+  C  L   +   NE +T  SL  +      ++ + PV   P +   +   + +    +  +D      +++ ++I   S T          S   C +    ++P      +  L   ++A  L +   D ++R+ +  C  Y ++  CL      CGWD +   C++L D  +++ W +  ++C  +N+  +     WS    C   D   S  C+C+   C +    C       P I I NC+     G W  W +W+ CS       ++R+R CS+         C+G++ E + C       V   W+ W             SKCS++  G    ++ R   CEN
Sbjct:   83 SSQDVSSEPSSEQQLCALSKHPTVAFEDLQPWVSNFTYPGARDFSQLALDPSGNQ---LIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNYVRVLIVAGRKVF-----MCGTNAFSPMCTSRQV-GNLSRTIE-KINGVARCPYDPRHNSTAVISSQGELYAATVIDFS-----GRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAYDIGLFAYFFLRE-----NAVEHDC-----GRTVY-SRVARVCKNDVGGRFLL-EDTWTTFMKARLNCSR-PGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFR---YQENPRAAWLPIANPIPNFQCGTLP--ETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKD-----TLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVLPPGRREPLRSLRILHSARALFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCS---RNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIFWASW----------GSWSKCSSNCGG---GMQSRRRACEN 751          

HSP 2 Score: 65.855 bits (159), Expect = 4.318e-10
Identity = 49/160 (30.63%), Postives = 63/160 (39.38%), Query Frame = 3
Query: 2061 GEWNEWGAWSTCSP--EKKTKIRKRECS------SKFSCIGQTEETKICTT----VRSVWSQWY------ITSNPKIYNSFRSKCSTDDSGPSSTI----EIREMVCE-NTCQENLFKWYKWSKWSDCTSQNVQYRLYNCSEL----SQCPANQTQIQNC 2459
            G W  WG WS+CS   E   ++RKR C+          C+G   E + C      VR  WS W        +     Y   RS C++    P   I       E +C    C E    W  WS+WS CT    Q R  +C EL    S C  N +Q + C
Sbjct:  854 GGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPVRGAWSCWTSWSPCSASCGGGHYQRTRS-CTSPAPSPGEDICLGLHTEEALCATQACPEG---WSPWSEWSKCTDDGAQSRSRHCEELLPGSSACAGNSSQSRPC 1009          
BLAST of SMED30025076 vs. Ensembl Human
Match: SEMA5B (semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737])

HSP 1 Score: 113.62 bits (283), Expect = 7.755e-25
Identity = 157/723 (21.72%), Postives = 283/723 (39.14%), Query Frame = 3
Query:  321 SSKNVYHIQTHQQQL--------IEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCE-----ERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTNCMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSL--SLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHT---------ESNELCNIGIYKLVPKENVFQISGLTTDNNAYIL-ISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER--SSC--KNIIDN---SVWSIPSICFVNDSQISLKCICKY--C-TNEIMCSN----KPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICT-----TVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCEN 2321
            SS++V    + +QQL        + F+     V +FT+   +DF+Q  +  + N     +V   N +  + L  + +       +       C+     E    N++  + V   K+      +  +N ++   T+  +  N + T + K           +H + +V++ +  ++    +D S      + P I   + S   L T   N  +     F+  ++     YF + E     +    DC      R VY +R+ R+CK D GG     E  + T  KA + C    G+  F+Y++  SA     +  +Y +F    NS     VC F+L A    FNGP R      N +     + NP+P+  C  L   +   NE +T  SL  +      ++ + PV   P +   +   + +    +  +D      +++ ++I   S T          S   C +    ++P      +  L   ++A  L +   D ++R+ +  C  Y ++  CL      CGWD +   C++L D  +++ W +  ++C  +N+  +     WS    C   D   S  C+C+   C +    C       P I I NC+     G W  W +W+ CS       ++R+R CS+         C+G++ E + C       V   W+ W             SKCS++  G    ++ R   CEN
Sbjct:   83 SSQDVSSEPSSEQQLCALSKHPTVAFEDLQPWVSNFTYPGARDFSQLALDPSGNQ---LIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNYVRVLIVAGRKVF-----MCGTNAFSPMCTSRQV-GNLSRTIE-KINGVARCPYDPRHNSTAVISSQGELYAATVIDFS-----GRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAYDIGLFAYFFLRE-----NAVEHDC-----GRTVY-SRVARVCKNDVGGRFLL-EDTWTTFMKARLNCSR-PGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFR---YQENPRAAWLPIANPIPNFQCGTLP--ETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKD-----TLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVLPPGRREPLRSLRILHSARALFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCS---RNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIFWASW----------GSWSKCSSNCGG---GMQSRRRACEN 751          

HSP 2 Score: 65.855 bits (159), Expect = 4.318e-10
Identity = 49/160 (30.63%), Postives = 63/160 (39.38%), Query Frame = 3
Query: 2061 GEWNEWGAWSTCSP--EKKTKIRKRECS------SKFSCIGQTEETKICTT----VRSVWSQWY------ITSNPKIYNSFRSKCSTDDSGPSSTI----EIREMVCE-NTCQENLFKWYKWSKWSDCTSQNVQYRLYNCSEL----SQCPANQTQIQNC 2459
            G W  WG WS+CS   E   ++RKR C+          C+G   E + C      VR  WS W        +     Y   RS C++    P   I       E +C    C E    W  WS+WS CT    Q R  +C EL    S C  N +Q + C
Sbjct:  854 GGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPVRGAWSCWTSWSPCSASCGGGHYQRTRS-CTSPAPSPGEDICLGLHTEEALCATQACPEG---WSPWSEWSKCTDDGAQSRSRHCEELLPGSSACAGNSSQSRPC 1009          
BLAST of SMED30025076 vs. Ensembl Human
Match: SEMA5B (semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737])

HSP 1 Score: 113.62 bits (283), Expect = 8.253e-25
Identity = 157/723 (21.72%), Postives = 283/723 (39.14%), Query Frame = 3
Query:  321 SSKNVYHIQTHQQQL--------IEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCE-----ERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTNCMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSL--SLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHT---------ESNELCNIGIYKLVPKENVFQISGLTTDNNAYIL-ISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER--SSC--KNIIDN---SVWSIPSICFVNDSQISLKCICKY--C-TNEIMCSN----KPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICT-----TVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCEN 2321
            SS++V    + +QQL        + F+     V +FT+   +DF+Q  +  + N     +V   N +  + L  + +       +       C+     E    N++  + V   K+      +  +N ++   T+  +  N + T + K           +H + +V++ +  ++    +D S      + P I   + S   L T   N  +     F+  ++     YF + E     +    DC      R VY +R+ R+CK D GG     E  + T  KA + C    G+  F+Y++  SA     +  +Y +F    NS     VC F+L A    FNGP R      N +     + NP+P+  C  L   +   NE +T  SL  +      ++ + PV   P +   +   + +    +  +D      +++ ++I   S T          S   C +    ++P      +  L   ++A  L +   D ++R+ +  C  Y ++  CL      CGWD +   C++L D  +++ W +  ++C  +N+  +     WS    C   D   S  C+C+   C +    C       P I I NC+     G W  W +W+ CS       ++R+R CS+         C+G++ E + C       V   W+ W             SKCS++  G    ++ R   CEN
Sbjct:   25 SSQDVSSEPSSEQQLCALSKHPTVAFEDLQPWVSNFTYPGARDFSQLALDPSGNQ---LIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNYVRVLIVAGRKVF-----MCGTNAFSPMCTSRQV-GNLSRTIE-KINGVARCPYDPRHNSTAVISSQGELYAATVIDFS-----GRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAYDIGLFAYFFLRE-----NAVEHDC-----GRTVY-SRVARVCKNDVGGRFLL-EDTWTTFMKARLNCSR-PGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFR---YQENPRAAWLPIANPIPNFQCGTLP--ETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKD-----TLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVLPPGRREPLRSLRILHSARALFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCS---RNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIFWASW----------GSWSKCSSNCGG---GMQSRRRACEN 693          

HSP 2 Score: 65.4698 bits (158), Expect = 4.867e-10
Identity = 49/160 (30.63%), Postives = 63/160 (39.38%), Query Frame = 3
Query: 2061 GEWNEWGAWSTCSP--EKKTKIRKRECS------SKFSCIGQTEETKICTT----VRSVWSQWY------ITSNPKIYNSFRSKCSTDDSGPSSTI----EIREMVCE-NTCQENLFKWYKWSKWSDCTSQNVQYRLYNCSEL----SQCPANQTQIQNC 2459
            G W  WG WS+CS   E   ++RKR C+          C+G   E + C      VR  WS W        +     Y   RS C++    P   I       E +C    C E    W  WS+WS CT    Q R  +C EL    S C  N +Q + C
Sbjct:  795 GGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPVRGAWSCWTSWSPCSASCGGGHYQRTRS-CTSPAPSPGEDICLGLHTEEALCATQACPEG---WSPWSEWSKCTDDGAQSRSRHCEELLPGSSACAGNSSQSRPC 950          
BLAST of SMED30025076 vs. Ensembl Human
Match: SEMA5B (semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737])

HSP 1 Score: 113.235 bits (282), Expect = 1.039e-24
Identity = 157/723 (21.72%), Postives = 283/723 (39.14%), Query Frame = 3
Query:  321 SSKNVYHIQTHQQQL--------IEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCE-----ERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTNCMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSL--SLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHT---------ESNELCNIGIYKLVPKENVFQISGLTTDNNAYIL-ISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER--SSC--KNIIDN---SVWSIPSICFVNDSQISLKCICKY--C-TNEIMCSN----KPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICT-----TVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCEN 2321
            SS++V    + +QQL        + F+     V +FT+   +DF+Q  +  + N     +V   N +  + L  + +       +       C+     E    N++  + V   K+      +  +N ++   T+  +  N + T + K           +H + +V++ +  ++    +D S      + P I   + S   L T   N  +     F+  ++     YF + E     +    DC      R VY +R+ R+CK D GG     E  + T  KA + C    G+  F+Y++  SA     +  +Y +F    NS     VC F+L A    FNGP R      N +     + NP+P+  C  L   +   NE +T  SL  +      ++ + PV   P +   +   + +    +  +D      +++ ++I   S T          S   C +    ++P      +  L   ++A  L +   D ++R+ +  C  Y ++  CL      CGWD +   C++L D  +++ W +  ++C  +N+  +     WS    C   D   S  C+C+   C +    C       P I I NC+     G W  W +W+ CS       ++R+R CS+         C+G++ E + C       V   W+ W             SKCS++  G    ++ R   CEN
Sbjct:   25 SSQDVSSEPSSEQQLCALSKHPTVAFEDLQPWVSNFTYPGARDFSQLALDPSGNQ---LIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNYVRVLIVAGRKVF-----MCGTNAFSPMCTSRQV-GNLSRTIE-KINGVARCPYDPRHNSTAVISSQGELYAATVIDFS-----GRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAYDIGLFAYFFLRE-----NAVEHDC-----GRTVY-SRVARVCKNDVGGRFLL-EDTWTTFMKARLNCSR-PGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFR---YQENPRAAWLPIANPIPNFQCGTLP--ETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKD-----TLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVLPPGRREPLRSLRILHSARALFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCS---RNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIFWASW----------GSWSKCSSNCGG---GMQSRRRACEN 693          

HSP 2 Score: 55.0694 bits (131), Expect = 7.934e-7
Identity = 42/146 (28.77%), Postives = 56/146 (38.36%), Query Frame = 3
Query: 2061 GEWNEWGAWSTCSP--EKKTKIRKRECS------SKFSCIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCE-NTCQENLFKWYKWSKWSDCTSQNVQYRLYNCSEL----SQCPANQTQIQNC 2459
            G W  WG WS+CS   E   ++RKR C+          C+G   E + C              NP+        C  +D      +   E +C    C E    W  WS+WS CT    Q R  +C EL    S C  N +Q + C
Sbjct:  796 GGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDC--------------NPQA-------CPGEDI--CLGLHTEEALCATQACPEG---WSPWSEWSKCTDDGAQSRSRHCEELLPGSSACAGNSSQSRPC 915          
BLAST of SMED30025076 vs. Ensembl Celegans
Match: smp-1 (Semaphorin-1A [Source:UniProtKB/Swiss-Prot;Acc:Q17330])

HSP 1 Score: 65.0846 bits (157), Expect = 1.807e-10
Identity = 91/366 (24.86%), Postives = 151/366 (41.26%), Query Frame = 3
Query:  816 FVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYS--KAVS----ATWTNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVF-NGPMRSPLIYLNSQIL-----EKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLI--NFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHTESNELCNI----GIYKLVPKENVFQ----ISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSC 1847
            FV N  LI R  + D      S  ++ T   +        F+  F  +  +YF   E  S       + + + E   +Y  R+ R+CK D+GGA   NE  + +  KA + C + +G   F+++  KAVS    A   N  +Y +F    +      VC F +   +  F NG  +      N+Q +        +P P P  C   S  +L +N   T S +  + L    + +P V  PL+       D+TQIT          +V   +YD+   +F  T   ++  +    G   ++    VFQ    I  L T   + +++S +D I  + ++NC + T+ +KC+      C WD     C
Sbjct:  185 FVGNDALIYRKTI-DETPSSKSAANIRTQSYDARVLNAPNFVATFAYKEHVYFWFREIAS-------EAIDNNEEPQIYA-RVARVCKNDKGGARPANE-RWTSYLKARLNCSLPSGSSPFYFNELKAVSDPIDAGNNNHVVYTVFSTPDSDVRMSAVCKFSMKKIREEFDNGTFKH---QNNAQSMWMAFNRNEVPKPRPGSCSPDST-KLPEN---TVSFILHHPLL--HRPIPSVAAPLLVEGADRADLTQITVL----PRVRAVGGHNYDI---LFIGTSDGKVLKVVEVDGNATVIQSATVFQRGVPIVNLLTTKESVVIVS-ADEIASLPVHNCAQQTSCSKCVQLQDPHCAWDSSIARC 523          
BLAST of SMED30025076 vs. Ensembl Celegans
Match: C36B7.5 (pep chromosome:WBcel235:X:7089228:7096449:-1 gene:WBGene00016468.1 transcript:C36B7.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C36B7.5)

HSP 1 Score: 55.8398 bits (133), Expect = 1.906e-7
Identity = 47/179 (26.26%), Postives = 72/179 (40.22%), Query Frame = 3
Query: 1983 KYCTNEIMCSNKPKIEITNCTGAIEVGEWNEWGAWSTCSPE--KKTKIRKRECSSKFSCIGQTEETKICTTVR----SVWSQWYITSNPKIYNSFR---SKCSTDDS-----GPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTS---QNVQYRLYNCSELSQCPANQTQIQNCELV 2468
            + C N ++C   P  E   C        W+ WG W  CS E       R REC    SC G +EE  +C        S W+ W +        S R    KC   ++     GP+      +M C      +  KW +W +W+DC++   Q  Q RL  C   ++C     +++ C++ 
Sbjct:  422 RICQNGLLCPG-PATEERTCD-KRPCPHWSNWGQWEKCSKECGAGHTYRNRECIDGVSCEGASEEKILCNQQPCPEWSQWTAWTVCDERCGEESIRLRNRKCMNAENNNACDGPAQD----QMSCP---YRDCPKWEEWGEWADCSTTCGQGTQKRLRKCDSGNECSGPGEEMRFCQIA 591          
BLAST of SMED30025076 vs. Ensembl Celegans
Match: C36B7.5 (pep chromosome:WBcel235:X:7089228:7096449:-1 gene:WBGene00016468.1 transcript:C36B7.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C36B7.5)

HSP 1 Score: 55.4546 bits (132), Expect = 1.966e-7
Identity = 47/179 (26.26%), Postives = 72/179 (40.22%), Query Frame = 3
Query: 1983 KYCTNEIMCSNKPKIEITNCTGAIEVGEWNEWGAWSTCSPE--KKTKIRKRECSSKFSCIGQTEETKICTTVR----SVWSQWYITSNPKIYNSFR---SKCSTDDS-----GPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTS---QNVQYRLYNCSELSQCPANQTQIQNCELV 2468
            + C N ++C   P  E   C        W+ WG W  CS E       R REC    SC G +EE  +C        S W+ W +        S R    KC   ++     GP+      +M C      +  KW +W +W+DC++   Q  Q RL  C   ++C     +++ C++ 
Sbjct:  422 RICQNGLLCPG-PATEERTCD-KRPCPHWSNWGQWEKCSKECGAGHTYRNRECIDGVSCEGASEEKILCNQQPCPEWSQWTAWTVCDERCGEESIRLRNRKCMNAENNNACDGPAQD----QMSCP---YRDCPKWEEWGEWADCSTTCGQGTQKRLRKCDSGNECSGPGEEMRFCQIA 591          
BLAST of SMED30025076 vs. Ensembl Celegans
Match: adt-1 (A disintegrin and metalloproteinase with thrombospondin motifs adt-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECS8])

HSP 1 Score: 50.447 bits (119), Expect = 8.786e-6
Identity = 48/184 (26.09%), Postives = 79/184 (42.93%), Query Frame = 3
Query: 1962 ISLKCICKYCTNEIMCSNK---PKIEITNCTGAIEVGEWNEWGAWSTCSPE---KKTKIRKRECSSKFSCIGQTEETKICTTVR------SVWSQWYITSNP---KIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCT---SQNVQYRLYNCSELSQCPANQTQIQNC 2459
            +  +C+   C N+ +       P+IE         V +W EW +WS CS        ++R+R+CSS   C G +EE++ C  V         W +W   S      +   FR  C TD     S+  ++E   E  C +N   W  W +WS C+       +YR+  C +  +C  +  + ++C
Sbjct:  678 VGGQCLALSCDNKALVEQPEDCPRIE------GRSVHQWEEWSSWSECSVSCGLGGREVRERKCSSGRKCQGVSEESRPCEGVLRDCEEFGEWKEWGSCSEKCALGVQKRFR-PCLTDQ---CSSKHLQE---ERPC-DNEGCWTNWDEWSSCSQSCGGGRRYRIRKCLD-DKCDGDDLEKESC 846          
BLAST of SMED30025076 vs. Ensembl Celegans
Match: adt-2 (A disintegrin and metalloproteinase with thrombospondin motifs adt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q19204])

HSP 1 Score: 50.0618 bits (118), Expect = 8.990e-6
Identity = 49/181 (27.07%), Postives = 73/181 (40.33%), Query Frame = 3
Query: 1971 KCICKYCTNEIMCSNKPKIEITNCTGAI--EVGEWNEWGAWSTCSPE--KKTKIRKRECSSKFSCIGQTEETKICTT-------VRSVWSQWYITS---NPKIYNSFRSKCSTDDSGPSSTIEI-REMVCENTCQENLFKWYKWSKWSDCT---SQNVQYRLYNCSELSQCPANQTQIQNC 2459
            KC+  + T    C  K  IE+ +C       +G W  WG WSTCS      T +R+R C+ +  C G   E + C         + S+W++W   S      + +  RS   +   G SS  +   E  C ++   +   W  WS WS C+      V+ R   C     CP N  +   C
Sbjct:  783 KCLSPHRTLAFDCPEK-NIEVRSCDNGPCNAIGVWGTWGGWSTCSTSCGPGTLVRQRTCNRE-PCDGSAHERRSCNVATCQNDGIWSLWNEWSDCSRVCGKGLRSRSRSCFGSGCMGASSEQQFCNEQACASSSAND---WGTWSGWSQCSVSCGAGVKRRTRTC-RTGNCPGNYKESAIC 957          
BLAST of SMED30025076 vs. Ensembl Fly
Match: Sema5c (gene:FBgn0284221 transcript:FBtr0076052)

HSP 1 Score: 86.2705 bits (212), Expect = 1.085e-16
Identity = 130/600 (21.67%), Postives = 232/600 (38.67%), Query Frame = 3
Query:  798 HIFIGAFVDNS---LLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINP--EDPSSVLIIHYDMFIEIFSHTESNELCNIGIYKLVPKENVFQISGLTTDNNAYILIS------TSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSC-TSLNDKVDINRWERS---SCKNI---IDN--SVWSIPSICFVNDSQISLKCICKYCTNEIMCSN-KPK----------IEITNCTGAIEVGEWNEWGAWSTCSP--EKKTKIRKRECSSKFSCIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQ---NVQYRLYNCSELS------QCPANQTQIQNCEL 2465
             +F+G   D S   + I RT      G   + + L T   N  +   ++F+  FE    +YF++ E  +        C      +++Y +R+ R+CK D GG       N+ +  KA + C +  G+Y +++ +    T+  S+  LY  F    +S  G  VC ++L +    F+GP +      +S    K +     +   +   G  S    + +S   L      + + P+   PL + + +   ++    IN   E    + +      I+  S     +     + +L   ++    S L   N AY+ +S      T   + RI   +C ++ +++ CL      CGW+     C     D   +  W ++   +C  +   ID   S WS  ++C  ++ Q    C C+    +  C+N +P+           ++TNCT   + G W EW AWS CS       KIR+R C +     G        T V S  S+ Y    P       +K  + D G                      W  W +WS+C++Q     + R   C++ +      +CP  +   + C +
Sbjct:  192 QLFVGTATDFSGSDVAILRT------GVESNKRFLRTKQYNNNWLSGAQFVGSFEAGHFVYFLLRESAAEH----MSC-----GKVIY-SRVARVCKNDVGGGGQLLRDNWTSFLKARLNCSL-PGEYPYYFDEIQGMTYAESESILYATFRTSGSSIFGSAVCAYNLSSINAAFDGPFKQ---QEHSDAAWKTVNT---NQRSQFQCGTSSIGHWLESSRYQL----MDEAVQPIGAEPLYHSKLEQFGRLALDIINTKTEQVHVLFVASSGNHIKKLSVKYDGDGVQTCLVELWQADDTGTSSLL---NMAYLKVSDSLYLGTDLALTRIPAQHCSRHVSQSSCLNSMDPYCGWNELVERCMPQPQDSSVLQHWHQAPQITCPVLNAPIDGGWSTWSPWAVCQQHE-QPDSNCQCR----QRSCNNPQPQHGGATCEGISTQVTNCT---QHGGWTEWSAWSPCSQTCGIAVKIRRRTCGNPRPAFGGR------TCVGSEQSEMYCRHLPPCP---VAKPQSVDGG----------------------WGPWGEWSECSAQCGGGFRMRRRECNDPAPLNGGMECPGCRLDYEECNM 722          
BLAST of SMED30025076 vs. Ensembl Fly
Match: Sema5c (gene:FBgn0284221 transcript:FBtr0300339)

HSP 1 Score: 85.8853 bits (211), Expect = 1.122e-16
Identity = 130/600 (21.67%), Postives = 232/600 (38.67%), Query Frame = 3
Query:  798 HIFIGAFVDNS---LLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINP--EDPSSVLIIHYDMFIEIFSHTESNELCNIGIYKLVPKENVFQISGLTTDNNAYILIS------TSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSC-TSLNDKVDINRWERS---SCKNI---IDN--SVWSIPSICFVNDSQISLKCICKYCTNEIMCSN-KPK----------IEITNCTGAIEVGEWNEWGAWSTCSP--EKKTKIRKRECSSKFSCIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQ---NVQYRLYNCSELS------QCPANQTQIQNCEL 2465
             +F+G   D S   + I RT      G   + + L T   N  +   ++F+  FE    +YF++ E  +        C      +++Y +R+ R+CK D GG       N+ +  KA + C +  G+Y +++ +    T+  S+  LY  F    +S  G  VC ++L +    F+GP +      +S    K +     +   +   G  S    + +S   L      + + P+   PL + + +   ++    IN   E    + +      I+  S     +     + +L   ++    S L   N AY+ +S      T   + RI   +C ++ +++ CL      CGW+     C     D   +  W ++   +C  +   ID   S WS  ++C  ++ Q    C C+    +  C+N +P+           ++TNCT   + G W EW AWS CS       KIR+R C +     G        T V S  S+ Y    P       +K  + D G                      W  W +WS+C++Q     + R   C++ +      +CP  +   + C +
Sbjct:  190 QLFVGTATDFSGSDVAILRT------GVESNKRFLRTKQYNNNWLSGAQFVGSFEAGHFVYFLLRESAAEH----MSC-----GKVIY-SRVARVCKNDVGGGGQLLRDNWTSFLKARLNCSL-PGEYPYYFDEIQGMTYAESESILYATFRTSGSSIFGSAVCAYNLSSINAAFDGPFKQ---QEHSDAAWKTVNT---NQRSQFQCGTSSIGHWLESSRYQL----MDEAVQPIGAEPLYHSKLEQFGRLALDIINTKTEQVHVLFVASSGNHIKKLSVKYDGDGVQTCLVELWQADDTGTSSLL---NMAYLKVSDSLYLGTDLALTRIPAQHCSRHVSQSSCLNSMDPYCGWNELVERCMPQPQDSSVLQHWHQAPQITCPVLNAPIDGGWSTWSPWAVCQQHE-QPDSNCQCR----QRSCNNPQPQHGGATCEGISTQVTNCT---QHGGWTEWSAWSPCSQTCGIAVKIRRRTCGNPRPAFGGR------TCVGSEQSEMYCRHLPPCP---VAKPQSVDGG----------------------WGPWGEWSECSAQCGGGFRMRRRECNDPAPLNGGMECPGCRLDYEECNM 720          
BLAST of SMED30025076 vs. Ensembl Fly
Match: Sema1b (gene:FBgn0016059 transcript:FBtr0086891)

HSP 1 Score: 60.4622 bits (145), Expect = 6.858e-9
Identity = 71/305 (23.28%), Postives = 137/305 (44.92%), Query Frame = 3
Query: 1038 NRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYS--KAVSA---TWTNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQ-----ILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYR---TQKIVPVVKT-PLINFQNKDITQITAFSINPEDPSSVLIIHYDM------------FIEIFSHTESNELCN------IGIYKLVPKENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSL 1856
             + VY +R+ R+CK D GG   H + ++ +  KA + C +  G++ F++   +A+S    + + S +Y +F    N+  G  VC F++      F+G  +S     +SQ     +  + +P P P  C + S          T +S+++N +      ++ VP V   PL+   N    ++TA +++P+   S+   +YD+            FI I S T  N   +      I   +++P     +   ++T  N+ +++S    ++ + +++C        CL     IC WD +T  C +L
Sbjct:  255 GKAVY-SRVARVCKNDRGGPYSHGK-SWTSFLKARLNCSV-PGEFPFYFDEIQAISPIVESGSKSLIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKS---QKDSQSHWLPVEREQVPKPRPGQCVEDSR---------TLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNLH-HRLTAIAVHPQ-VKSLSGAYYDVIYSGTDDGKVTKFINILS-THPNSTVDRLKTVVISEMQVLPLGTPIRELVISTSKNSLVVVSDGS-LVSVPLHHCSHIVDCLGCLSLQDPICAWDLQTHECKNL 540          
BLAST of SMED30025076 vs. Ensembl Fly
Match: Sema1b (gene:FBgn0016059 transcript:FBtr0302161)

HSP 1 Score: 60.4622 bits (145), Expect = 6.858e-9
Identity = 71/305 (23.28%), Postives = 137/305 (44.92%), Query Frame = 3
Query: 1038 NRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYS--KAVSA---TWTNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQ-----ILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYR---TQKIVPVVKT-PLINFQNKDITQITAFSINPEDPSSVLIIHYDM------------FIEIFSHTESNELCN------IGIYKLVPKENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSL 1856
             + VY +R+ R+CK D GG   H + ++ +  KA + C +  G++ F++   +A+S    + + S +Y +F    N+  G  VC F++      F+G  +S     +SQ     +  + +P P P  C + S          T +S+++N +      ++ VP V   PL+   N    ++TA +++P+   S+   +YD+            FI I S T  N   +      I   +++P     +   ++T  N+ +++S    ++ + +++C        CL     IC WD +T  C +L
Sbjct:  255 GKAVY-SRVARVCKNDRGGPYSHGK-SWTSFLKARLNCSV-PGEFPFYFDEIQAISPIVESGSKSLIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKS---QKDSQSHWLPVEREQVPKPRPGQCVEDSR---------TLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNLH-HRLTAIAVHPQ-VKSLSGAYYDVIYSGTDDGKVTKFINILS-THPNSTVDRLKTVVISEMQVLPLGTPIRELVISTSKNSLVVVSDGS-LVSVPLHHCSHIVDCLGCLSLQDPICAWDLQTHECKNL 540          
BLAST of SMED30025076 vs. Ensembl Fly
Match: Sema1b (gene:FBgn0016059 transcript:FBtr0086890)

HSP 1 Score: 60.4622 bits (145), Expect = 6.858e-9
Identity = 71/305 (23.28%), Postives = 137/305 (44.92%), Query Frame = 3
Query: 1038 NRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYS--KAVSA---TWTNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQ-----ILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYR---TQKIVPVVKT-PLINFQNKDITQITAFSINPEDPSSVLIIHYDM------------FIEIFSHTESNELCN------IGIYKLVPKENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSL 1856
             + VY +R+ R+CK D GG   H + ++ +  KA + C +  G++ F++   +A+S    + + S +Y +F    N+  G  VC F++      F+G  +S     +SQ     +  + +P P P  C + S          T +S+++N +      ++ VP V   PL+   N    ++TA +++P+   S+   +YD+            FI I S T  N   +      I   +++P     +   ++T  N+ +++S    ++ + +++C        CL     IC WD +T  C +L
Sbjct:  255 GKAVY-SRVARVCKNDRGGPYSHGK-SWTSFLKARLNCSV-PGEFPFYFDEIQAISPIVESGSKSLIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKS---QKDSQSHWLPVEREQVPKPRPGQCVEDSR---------TLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNLH-HRLTAIAVHPQ-VKSLSGAYYDVIYSGTDDGKVTKFINILS-THPNSTVDRLKTVVISEMQVLPLGTPIRELVISTSKNSLVVVSDGS-LVSVPLHHCSHIVDCLGCLSLQDPICAWDLQTHECKNL 540          
BLAST of SMED30025076 vs. Ensembl Zebrafish
Match: sema5ba (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Ba [Source:ZFIN;Acc:ZDB-GENE-070912-187])

HSP 1 Score: 122.094 bits (305), Expect = 1.057e-27
Identity = 135/564 (23.94%), Postives = 236/564 (41.84%), Query Frame = 3
Query:  765 QHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSLS-LNGLYRTQKIV-PVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFI---------EIFSHTESNELCNIGIYKLVP---KENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERSSCKNIIDNSV-------WSIPSICFVNDSQISLKCIC--KYCTN-EIMCSNK----PKIEITNCTGAIEVGEWNEWGAWSTCSP--EKKTKIRKRECSSKFS------CIGQTEETKICTTVRSV-----WSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCEN 2321
            +H + +V+T+   ++    +D S      + P I   +  +  L T   N  +     FI  ++     +F + E     +    DC      + VY +R+ R+CK D GG     E  + T  KA + C   +G+  F+Y++  S  +   +  +Y +F    NS     VC ++L A    FNGP RS     N +      PNP+P+  C  +   +   NE++T  SL     L+    +V PV   PL+   +   +++    +  +D      +H+ M+I          + +  +S + C +   +L P   ++ +  +  L  D    + +  +D++++I +  C  Y T   CL      CGWDR+   CT++ D  ++++W ++     + N         W+    C  +D + +  C+C  + C +    C  K    P IE++NC+     G W  W +W  CS   E   ++R+R C++         C+GQ+ E + C    S      WS W          S  SKCS D  G    +  R   CEN
Sbjct:  125 RHNSTAVVTESGELYAATVIDFS-----GRDPVIYRSLGGMPPLRTAQYNSKWLNEPHFISAYDVGLFTFFFLRE-----NAVEHDC-----GKTVY-SRVARVCKNDIGGRFLL-EDTWTTFTKARLNCSR-SGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAYNLSAITQAFNGPFRS---QENPRSTWLPTPNPIPNFQCGTID--EEGPNERLTERSLQDAQRLFLMNDVVQPVSVDPLVWQDDVRFSKLVVDIVQGQD-----SLHHVMYIGTEYGTILKALATTNKSLQGCYLEEMQLFPPGLQQPILSLQILHGDRT--LFVGLNDKVLKIPLARCSSYKTELMCLDARDPYCGWDRKQRRCTTIEDSSNMSQWFQNITACPLRNQTTDGAYGPWAPWQPCSHDDGEGTSTCLCRSRVCNSPPPRCGGKNCQGPTIEVSNCS---RNGGWTPWSSWGQCSTSCEIGFEVRQRSCNNPSPRHGGRVCVGQSREQRFCNEKVSCPQPIFWSSW----------SPWSKCSADCGG---GVHSRSRNCEN 642          
BLAST of SMED30025076 vs. Ensembl Zebrafish
Match: sema5ba (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Ba [Source:ZFIN;Acc:ZDB-GENE-070912-187])

HSP 1 Score: 122.094 bits (305), Expect = 1.272e-27
Identity = 135/564 (23.94%), Postives = 236/564 (41.84%), Query Frame = 3
Query:  765 QHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSLS-LNGLYRTQKIV-PVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFI---------EIFSHTESNELCNIGIYKLVP---KENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERSSCKNIIDNSV-------WSIPSICFVNDSQISLKCIC--KYC-TNEIMCSNK----PKIEITNCTGAIEVGEWNEWGAWSTCSP--EKKTKIRKRECSSKFS------CIGQTEETKICTTVRSV-----WSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCEN 2321
            +H + +V+T+   ++    +D S      + P I   +  +  L T   N  +     FI  ++     +F + E     +    DC      + VY +R+ R+CK D GG     E  + T  KA + C   +G+  F+Y++  S  +   +  +Y +F    NS     VC ++L A    FNGP RS     N +      PNP+P+  C  +   +   NE++T  SL     L+    +V PV   PL+   +   +++    +  +D      +H+ M+I          + +  +S + C +   +L P   ++ +  +  L  D    + +  +D++++I +  C  Y T   CL      CGWDR+   CT++ D  ++++W ++     + N         W+    C  +D + +  C+C  + C +    C  K    P IE++NC+     G W  W +W  CS   E   ++R+R C++         C+GQ+ E + C    S      WS W          S  SKCS D  G    +  R   CEN
Sbjct:  188 RHNSTAVVTESGELYAATVIDFS-----GRDPVIYRSLGGMPPLRTAQYNSKWLNEPHFISAYDVGLFTFFFLRE-----NAVEHDC-----GKTVY-SRVARVCKNDIGGRFLL-EDTWTTFTKARLNC-SRSGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAYNLSAITQAFNGPFRS---QENPRSTWLPTPNPIPNFQCGTID--EEGPNERLTERSLQDAQRLFLMNDVVQPVSVDPLVWQDDVRFSKLVVDIVQGQD-----SLHHVMYIGTEYGTILKALATTNKSLQGCYLEEMQLFPPGLQQPILSLQILHGDRT--LFVGLNDKVLKIPLARCSSYKTELMCLDARDPYCGWDRKQRRCTTIEDSSNMSQWFQNITACPLRNQTTDGAYGPWAPWQPCSHDDGEGTSTCLCRSRVCNSPPPRCGGKNCQGPTIEVSNCS---RNGGWTPWSSWGQCSTSCEIGFEVRQRSCNNPSPRHGGRVCVGQSREQRFCNEKVSCPQPIFWSSW----------SPWSKCSADCGG---GVHSRSRNCEN 705          
BLAST of SMED30025076 vs. Ensembl Zebrafish
Match: sema5ba (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Ba [Source:ZFIN;Acc:ZDB-GENE-070912-187])

HSP 1 Score: 122.094 bits (305), Expect = 1.272e-27
Identity = 135/564 (23.94%), Postives = 236/564 (41.84%), Query Frame = 3
Query:  765 QHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSLS-LNGLYRTQKIV-PVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFI---------EIFSHTESNELCNIGIYKLVP---KENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERSSCKNIIDNSV-------WSIPSICFVNDSQISLKCIC--KYC-TNEIMCSNK----PKIEITNCTGAIEVGEWNEWGAWSTCSP--EKKTKIRKRECSSKFS------CIGQTEETKICTTVRSV-----WSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCEN 2321
            +H + +V+T+   ++    +D S      + P I   +  +  L T   N  +     FI  ++     +F + E     +    DC      + VY +R+ R+CK D GG     E  + T  KA + C   +G+  F+Y++  S  +   +  +Y +F    NS     VC ++L A    FNGP RS     N +      PNP+P+  C  +   +   NE++T  SL     L+    +V PV   PL+   +   +++    +  +D      +H+ M+I          + +  +S + C +   +L P   ++ +  +  L  D    + +  +D++++I +  C  Y T   CL      CGWDR+   CT++ D  ++++W ++     + N         W+    C  +D + +  C+C  + C +    C  K    P IE++NC+     G W  W +W  CS   E   ++R+R C++         C+GQ+ E + C    S      WS W          S  SKCS D  G    +  R   CEN
Sbjct:  188 RHNSTAVVTESGELYAATVIDFS-----GRDPVIYRSLGGMPPLRTAQYNSKWLNEPHFISAYDVGLFTFFFLRE-----NAVEHDC-----GKTVY-SRVARVCKNDIGGRFLL-EDTWTTFTKARLNC-SRSGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAYNLSAITQAFNGPFRS---QENPRSTWLPTPNPIPNFQCGTID--EEGPNERLTERSLQDAQRLFLMNDVVQPVSVDPLVWQDDVRFSKLVVDIVQGQD-----SLHHVMYIGTEYGTILKALATTNKSLQGCYLEEMQLFPPGLQQPILSLQILHGDRT--LFVGLNDKVLKIPLARCSSYKTELMCLDARDPYCGWDRKQRRCTTIEDSSNMSQWFQNITACPLRNQTTDGAYGPWAPWQPCSHDDGEGTSTCLCRSRVCNSPPPRCGGKNCQGPTIEVSNCS---RNGGWTPWSSWGQCSTSCEIGFEVRQRSCNNPSPRHGGRVCVGQSREQRFCNEKVSCPQPIFWSSW----------SPWSKCSADCGG---GVHSRSRNCEN 705          
BLAST of SMED30025076 vs. Ensembl Zebrafish
Match: sema5ba (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Ba [Source:ZFIN;Acc:ZDB-GENE-070912-187])

HSP 1 Score: 122.094 bits (305), Expect = 1.272e-27
Identity = 135/564 (23.94%), Postives = 236/564 (41.84%), Query Frame = 3
Query:  765 QHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSLS-LNGLYRTQKIV-PVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFI---------EIFSHTESNELCNIGIYKLVP---KENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERSSCKNIIDNSV-------WSIPSICFVNDSQISLKCIC--KYC-TNEIMCSNK----PKIEITNCTGAIEVGEWNEWGAWSTCSP--EKKTKIRKRECSSKFS------CIGQTEETKICTTVRSV-----WSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCEN 2321
            +H + +V+T+   ++    +D S      + P I   +  +  L T   N  +     FI  ++     +F + E     +    DC      + VY +R+ R+CK D GG     E  + T  KA + C   +G+  F+Y++  S  +   +  +Y +F    NS     VC ++L A    FNGP RS     N +      PNP+P+  C  +   +   NE++T  SL     L+    +V PV   PL+   +   +++    +  +D      +H+ M+I          + +  +S + C +   +L P   ++ +  +  L  D    + +  +D++++I +  C  Y T   CL      CGWDR+   CT++ D  ++++W ++     + N         W+    C  +D + +  C+C  + C +    C  K    P IE++NC+     G W  W +W  CS   E   ++R+R C++         C+GQ+ E + C    S      WS W          S  SKCS D  G    +  R   CEN
Sbjct:  188 RHNSTAVVTESGELYAATVIDFS-----GRDPVIYRSLGGMPPLRTAQYNSKWLNEPHFISAYDVGLFTFFFLRE-----NAVEHDC-----GKTVY-SRVARVCKNDIGGRFLL-EDTWTTFTKARLNC-SRSGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAYNLSAITQAFNGPFRS---QENPRSTWLPTPNPIPNFQCGTID--EEGPNERLTERSLQDAQRLFLMNDVVQPVSVDPLVWQDDVRFSKLVVDIVQGQD-----SLHHVMYIGTEYGTILKALATTNKSLQGCYLEEMQLFPPGLQQPILSLQILHGDRT--LFVGLNDKVLKIPLARCSSYKTELMCLDARDPYCGWDRKQRRCTTIEDSSNMSQWFQNITACPLRNQTTDGAYGPWAPWQPCSHDDGEGTSTCLCRSRVCNSPPPRCGGKNCQGPTIEVSNCS---RNGGWTPWSSWGQCSTSCEIGFEVRQRSCNNPSPRHGGRVCVGQSREQRFCNEKVSCPQPIFWSSW----------SPWSKCSADCGG---GVHSRSRNCEN 705          
BLAST of SMED30025076 vs. Ensembl Zebrafish
Match: sema5ba (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Ba [Source:ZFIN;Acc:ZDB-GENE-070912-187])

HSP 1 Score: 120.553 bits (301), Expect = 3.211e-27
Identity = 135/564 (23.94%), Postives = 236/564 (41.84%), Query Frame = 3
Query:  765 QHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSLS-LNGLYRTQKIV-PVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFI---------EIFSHTESNELCNIGIYKLVP---KENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERSSCKNIIDNSV-------WSIPSICFVNDSQISLKCIC--KYC-TNEIMCSNK----PKIEITNCTGAIEVGEWNEWGAWSTCSP--EKKTKIRKRECSSKFS------CIGQTEETKICTTVRSV-----WSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCEN 2321
            +H + +V+T+   ++    +D S      + P I   +  +  L T   N  +     FI  ++     +F + E     +    DC      + VY +R+ R+CK D GG     E  + T  KA + C   +G+  F+Y++  S  +   +  +Y +F    NS     VC ++L A    FNGP RS     N +      PNP+P+  C  +   +   NE++T  SL     L+    +V PV   PL+   +   +++    +  +D      +H+ M+I          + +  +S + C +   +L P   ++ +  +  L  D    + +  +D++++I +  C  Y T   CL      CGWDR+   CT++ D  ++++W ++     + N         W+    C  +D + +  C+C  + C +    C  K    P IE++NC+     G W  W +W  CS   E   ++R+R C++         C+GQ+ E + C    S      WS W          S  SKCS D  G    +  R   CEN
Sbjct:  188 RHNSTAVVTESGELYAATVIDFS-----GRDPVIYRSLGGMPPLRTAQYNSKWLNEPHFISAYDVGLFTFFFLRE-----NAVEHDC-----GKTVY-SRVARVCKNDIGGRF-LLEDTWTTFTKARLNCSR-SGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAYNLSAITQAFNGPFRS---QENPRSTWLPTPNPIPNFQCGTID--EEGPNERLTERSLQDAQRLFLMNDVVQPVSVDPLVWQDDVRFSKLVVDIVQGQD-----SLHHVMYIGTEYGTILKALATTNKSLQGCYLEEMQLFPPGLQQPILSLQILHGDRT--LFVGLNDKVLKIPLARCSSYKTELMCLDARDPYCGWDRKQRRCTTIEDSSNMSQWFQNITACPLRNQTTDGAYGPWAPWQPCSHDDGEGTSTCLCRSRVCNSPPPRCGGKNCQGPTIEVSNCS---RNGGWTPWSSWGQCSTSCEIGFEVRQRSCNNPSPRHGGRVCVGQSREQRFCNEKVSCPQPIFWSSW----------SPWSKCSADCGG---GVHSRSRNCEN 705          
BLAST of SMED30025076 vs. Ensembl Xenopus
Match: SEMA3E (semaphorin 3E [Source:NCBI gene;Acc:100494277])

HSP 1 Score: 56.225 bits (134), Expect = 2.655e-7
Identity = 88/386 (22.80%), Postives = 151/386 (39.12%), Query Frame = 3
Query:  780 SVLTKEHIFIGAFVD---NSLLIQRT--KLPDILGKIDSIKDLVTP--MANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPI-GTGKYEFFYSKAVSATW------TNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPM---RSPLIYLNSQILEKNLPNPLPDVCEKLSNG---QLSKNEKVTASSLSLNGLYRTQKIVPVVKTP-LINFQNK-DITQITAFSINPEDPS-SVLIIHYDMFIEIFSHTESNELCNIGIYKLVPKENVFQ-----ISGLTTDNNAYILISTSDRIIRIKINNCEKYTTR-AKCLVEAPNICGWDRRTMSCT 1850
            S LT   +F+G + D       I RT   LP I  + D  + L  P  + ++    N       + ++++YF   E        V         + +Y +R+ R+C  D GG        + T  K  ++C + G    + F+ +             N +++ LF    N   G  +C + + + +  FNGP      P  + +  I E  +P P P +C    NG     +K+    A   + +     + + P  K P LI    K ++ QI    +  ED    V+ I  D  I +   T  N+        ++ +  VF+     IS   +     + I ++  I++IK + CE Y T  A C +     C WD   +SC+
Sbjct:  173 STLTGGELFVGLYNDFWGRDATIFRTTGHLPPIRTEHDDDRILTEPKFVGSYMIPDNED-----KDDNKMYFFYTEKAIEGDKGV---------QAIY-SRVGRVCANDIGGQRMMVN-KWTTFLKTRLICSVPGPNGIDTFFDELEDVFLLHTRDNKNPEIFALFSTTSNIFKGYAICVYHMASIREAFNGPFAHKEGPEYHWS--IYEGKIPYPRPGLCASKVNGGHYGTTKDYPDEALRFARSHPLMYESVKPTHKKPILIKADGKYNLKQIAVDRVEAEDGQYHVVFIGTDNGIVLKVITIYNQETETMEEVILEELQVFKVPDPIISMEISAKRQQLYIGSASSIVQIKTHQCEMYGTACADCCLARDPYCAWD--GISCS 538          
BLAST of SMED30025076 vs. Ensembl Xenopus
Match: SEMA3E (semaphorin 3E [Source:NCBI gene;Acc:100494277])

HSP 1 Score: 56.225 bits (134), Expect = 2.659e-7
Identity = 76/347 (21.90%), Postives = 134/347 (38.62%), Query Frame = 3
Query:  924 KNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYV----------------TRLIRICKKDEGGATDHNEFNFGTIAKADIVCPI-GTGKYEFFYSKAVSATW------TNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPM---RSPLIYLNSQILEKNLPNPLPDVCEKLSNG---QLSKNEKVTASSLSLNGLYRTQKIVPVVKTP-LINFQNK-DITQITAFSINPEDPS-SVLIIHYDMFIEIFSHTESNELCNIGIYKLVPKENVFQ-----ISGLTTDNNAYILISTSDRIIRIKINNCEKYTTR-AKCLVEAPNICGWDRRTMSCT 1850
            + +  +    TE +   ++ EP    SY + D     +N+M +                 +R+ R+C  D GG        + T  K  ++C + G    + F+ +             N +++ LF    N   G  +C + + + +  FNGP      P  + +  I E  +P P P +C    NG     +K+    A   + +     + + P  K P LI    K ++ QI    +  ED    V+ I  D  I +   T  N+        ++ +  VF+     IS   +     + I ++  I++IK + CE Y T  A C +     C WD   +SC+
Sbjct:  177 RTTGHLPPIRTEHDDDRILTEPKFVGSYMIPDNEDKDDNKMYFFYTEKAIEGDKGVQAIYSRVGRVCANDIGGQRMMVN-KWTTFLKTRLICSVPGPNGIDTFFDELEDVFLLHTRDNKNPEIFALFSTTSNIFKGYAICVYHMASIREAFNGPFAHKEGPEYHWS--IYEGKIPYPRPGLCASKVNGGHYGTTKDYPDEALRFARSHPLMYESVKPTHKKPILIKADGKYNLKQIAVDRVEAEDGQYHVVFIGTDNGIVLKVITIYNQETETMEEVILEELQVFKVPDPIISMEISAKRQQLYIGSASSIVQIKTHQCEMYGTACADCCLARDPYCAWD--GISCS 518          
BLAST of SMED30025076 vs. Ensembl Xenopus
Match: SEMA3E (semaphorin 3E [Source:NCBI gene;Acc:100494277])

HSP 1 Score: 56.225 bits (134), Expect = 2.881e-7
Identity = 88/386 (22.80%), Postives = 151/386 (39.12%), Query Frame = 3
Query:  780 SVLTKEHIFIGAFVD---NSLLIQRT--KLPDILGKIDSIKDLVTP--MANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPI-GTGKYEFFYSKAVSATW------TNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPM---RSPLIYLNSQILEKNLPNPLPDVCEKLSNG---QLSKNEKVTASSLSLNGLYRTQKIVPVVKTP-LINFQNK-DITQITAFSINPEDPS-SVLIIHYDMFIEIFSHTESNELCNIGIYKLVPKENVFQ-----ISGLTTDNNAYILISTSDRIIRIKINNCEKYTTR-AKCLVEAPNICGWDRRTMSCT 1850
            S LT   +F+G + D       I RT   LP I  + D  + L  P  + ++    N       + ++++YF   E        V         + +Y +R+ R+C  D GG        + T  K  ++C + G    + F+ +             N +++ LF    N   G  +C + + + +  FNGP      P  + +  I E  +P P P +C    NG     +K+    A   + +     + + P  K P LI    K ++ QI    +  ED    V+ I  D  I +   T  N+        ++ +  VF+     IS   +     + I ++  I++IK + CE Y T  A C +     C WD   +SC+
Sbjct:  183 STLTGGELFVGLYNDFWGRDATIFRTTGHLPPIRTEHDDDRILTEPKFVGSYMIPDNED-----KDDNKMYFFYTEKAIEGDKGV---------QAIY-SRVGRVCANDIGGQRMMVN-KWTTFLKTRLICSVPGPNGIDTFFDELEDVFLLHTRDNKNPEIFALFSTTSNIFKGYAICVYHMASIREAFNGPFAHKEGPEYHWS--IYEGKIPYPRPGLCASKVNGGHYGTTKDYPDEALRFARSHPLMYESVKPTHKKPILIKADGKYNLKQIAVDRVEAEDGQYHVVFIGTDNGIVLKVITIYNQETETMEEVILEELQVFKVPDPIISMEISAKRQQLYIGSASSIVQIKTHQCEMYGTACADCCLARDPYCAWD--GISCS 548          
BLAST of SMED30025076 vs. Ensembl Xenopus
Match: SEMA3E (semaphorin 3E [Source:NCBI gene;Acc:100494277])

HSP 1 Score: 55.4546 bits (132), Expect = 3.977e-7
Identity = 88/386 (22.80%), Postives = 151/386 (39.12%), Query Frame = 3
Query:  780 SVLTKEHIFIGAFVD---NSLLIQRT--KLPDILGKIDSIKDLVTP--MANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPI-GTGKYEFFYSKAVSATW------TNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPM---RSPLIYLNSQILEKNLPNPLPDVCEKLSNG---QLSKNEKVTASSLSLNGLYRTQKIVPVVKTP-LINFQNK-DITQITAFSINPEDPS-SVLIIHYDMFIEIFSHTESNELCNIGIYKLVPKENVFQ-----ISGLTTDNNAYILISTSDRIIRIKINNCEKYTTR-AKCLVEAPNICGWDRRTMSCT 1850
            S LT   +F+G + D       I RT   LP I  + D  + L  P  + ++    N       + ++++YF   E        V         + +Y +R+ R+C  D GG        + T  K  ++C + G    + F+ +             N +++ LF    N   G  +C + + + +  FNGP      P  + +  I E  +P P P +C    NG     +K+    A   + +     + + P  K P LI    K ++ QI    +  ED    V+ I  D  I +   T  N+        ++ +  VF+     IS   +     + I ++  I++IK + CE Y T  A C +     C WD   +SC+
Sbjct:  144 STLTGGELFVGLYNDFWGRDATIFRTTGHLPPIRTEHDDDRILTEPKFVGSYMIPDNED-----KDDNKMYFFYTEKAIEGDKGV---------QAIY-SRVGRVCANDIGGQRMMVN-KWTTFLKTRLICSVPGPNGIDTFFDELEDVFLLHTRDNKNPEIFALFSTTSNIFKGYAICVYHMASIREAFNGPFAHKEGPEYHWS--IYEGKIPYPRPGLCASKVNGGHYGTTKDYPDEALRFARSHPLMYESVKPTHKKPILIKADGKYNLKQIAVDRVEAEDGQYHVVFIGTDNGIVLKVITIYNQETETMEEVILEELQVFKVPDPIISMEISAKRQQLYIGSASSIVQIKTHQCEMYGTACADCCLARDPYCAWD--GISCS 509          
BLAST of SMED30025076 vs. Ensembl Xenopus
Match: SEMA3E (semaphorin 3E [Source:NCBI gene;Acc:100494277])

HSP 1 Score: 55.4546 bits (132), Expect = 4.174e-7
Identity = 76/339 (22.42%), Postives = 131/339 (38.64%), Query Frame = 3
Query:  948 FETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYV----------------TRLIRICKKDEGGATDHNEFNFGTIAKADIVCPI-GTGKYEFFYSKAVSATW------TNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPM---RSPLIYLNSQILEKNLPNPLPDVCEKLSNG---QLSKNEKVTASSLSLNGLYRTQKIVPVVKTP-LINFQNK-DITQITAFSINPEDPS-SVLIIHYDMFIEIFSHTESNELCNIGIYKLVPKENVFQ-----ISGLTTDNNAYILISTSDRIIRIKINNCEKYTTR-AKCLVEAPNICGWDRRTMSCT 1850
            F+  S +   + EP    SY + D     +N+M +                 +R+ R+C  D GG        + T  K  ++C + G    + F+ +             N +++ LF    N   G  +C + + + +  FNGP      P  + +  I E  +P P P +C    NG     +K+    A   + +     + + P  K P LI    K ++ QI    +  ED    V+ I  D  I +   T  N+        ++ +  VF+     IS   +     + I ++  I++IK + CE Y T  A C +     C WD   +SC+
Sbjct:  112 FDPNSSVISTLTEPKFVGSYMIPDNEDKDDNKMYFFYTEKAIEGDKGVQAIYSRVGRVCANDIGGQRMMVN-KWTTFLKTRLICSVPGPNGIDTFFDELEDVFLLHTRDNKNPEIFALFSTTSNIFKGYAICVYHMASIREAFNGPFAHKEGPEYHWS--IYEGKIPYPRPGLCASKVNGGHYGTTKDYPDEALRFARSHPLMYESVKPTHKKPILIKADGKYNLKQIAVDRVEAEDGQYHVVFIGTDNGIVLKVITIYNQETETMEEVILEELQVFKVPDPIISMEISAKRQQLYIGSASSIVQIKTHQCEMYGTACADCCLARDPYCAWD--GISCS 445          
BLAST of SMED30025076 vs. Ensembl Mouse
Match: Sema5b (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B [Source:MGI Symbol;Acc:MGI:107555])

HSP 1 Score: 116.701 bits (291), Expect = 5.293e-26
Identity = 159/752 (21.14%), Postives = 287/752 (38.16%), Query Frame = 3
Query:  351 HQQQLIEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKI-------SNNYTIIACSLMMMPCEERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTNCMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSL--SLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHT---------ESNELCNIGIYKLVPKENVFQISGLTTDNNAYIL-ISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER--SSC--KNIIDN---SVWSIPSICFVNDSQISLKCICKY--C-TNEIMCSN----KPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENT-CQENLFKWYKWSKWSDCT---SQNVQYRLYNCSELSQCPANQTQIQNC 2459
             +  ++ F+     V +FT+   +DF+Q  +  + N     +V   N +  + L  + +       S+  T  +C       EE     +   + ++  + ++ C     +N ++   ++  +  N + T + K           +H + +V++ +  ++    +D S      + P I   + S   L T   N  +     F+  F+     YF + E     +    DC      R VY +R+ R+CK D GG     E  + T  KA + C    G+  F+Y++  SA     +  +Y +F    NS     VC F+L A    FNGP R      N +     + NP+P+  C  L   +   NE +T  SL  +      ++ + PV   P +   +   + +    +  +D      +++ ++I   S T          S   C +    ++P   +  +  L   ++A  L +  SDR++R+ +  C  Y ++  CL      CGWD +   C++L D  +++ W +  ++C  +N+  +     WS    C   D   S  C+C+   C +    C       P I I NC+     G W  W +W+ CS       ++R+R CS+         C+G++ E + C                                            ENT C   +F W  W  WS C+      VQ R  +C   + CP    + + C
Sbjct:   43 REHPIVAFEDLKPWVFNFTYPGVRDFSQLALDPSRNQ---LIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEE---CQNYVRVLIVSGRKVFMC----GTNAFSPVCSSRQV-GNLSRTIE-KINGVARCPYDPRHNSTAVISSQGELYAATVIDFS-----GRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAFDIGLFAYFFLRE-----NAVEHDC-----GRTVY-SRVARVCKNDVGGRFLL-EDTWTTFMKARLNCSR-PGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISKAFNGPFR---YQENPRAAWLPIANPIPNFQCGTLP--ETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKD-----TLYHVLYIGTESGTILKALSTASRSLRGCYLEELHVLPPGRLEPLRSLRILHSARALFVGLSDRVLRVPLERCSAYHSQGACLGARDPYCGWDGKRQLCSTLEDSSNMSLWIQNITTCPVRNVTRDGGFGPWSPWKPCEHLDGDNSGSCLCRARSCDSPRPRCGGLECLGPSIHIANCS---RNGAWTAWSSWAQCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCN-------------------------------------------ENTPCPVPIF-WASWGSWSKCSNNCGGGVQSRRRSCENGNSCPGCGVEFKTC 707          

HSP 2 Score: 60.077 bits (144), Expect = 1.735e-8
Identity = 48/160 (30.00%), Postives = 61/160 (38.12%), Query Frame = 3
Query: 2061 GEWNEWGAWSTCSP--EKKTKIRKRECS------SKFSCIGQTEETKICTT----VRSVWSQWYITS------NPKIYNSFRSKCSTDDSGPSSTI----EIREMVCE-NTCQENLFKWYKWSKWSDCTSQNVQYRLYNCSEL----SQCPANQTQIQNC 2459
            G W  WG WS+CS   E   ++RKR C+          C+G   E + C      VR  WS W   S          Y   RS C++    P   I       E +C    C E    W  WS+W  CT    Q R  +C EL      C  N +Q + C
Sbjct:  796 GGWATWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPVRGAWSCWTAWSQCSASCGGGHYQRTRS-CTSPAPSPGEDICLGLHTEEALCSTQACPEG---WSLWSEWGVCTEDGAQSRSRSCEELLPGPGACVGNSSQSRPC 951          
BLAST of SMED30025076 vs. Ensembl Mouse
Match: Sema5b (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B [Source:MGI Symbol;Acc:MGI:107555])

HSP 1 Score: 116.316 bits (290), Expect = 8.661e-26
Identity = 154/707 (21.78%), Postives = 280/707 (39.60%), Query Frame = 3
Query:  351 HQQQLIEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKI-------SNNYTIIACSLMMMPCEERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTNCMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSL--SLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHT---------ESNELCNIGIYKLVPKENVFQISGLTTDNNAYIL-ISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER--SSC--KNIIDN---SVWSIPSICFVNDSQISLKCICKY--C-TNEIMCSN----KPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICT-----TVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCEN 2321
             +  ++ F+     V +FT+   +DF+Q  +  + N     +V   N +  + L  + +       S+  T  +C       EE     +   + ++  + ++ C     +N ++   ++  +  N + T + K           +H + +V++ +  ++    +D S      + P I   + S   L T   N  +     F+  F+     YF + E     +    DC      R VY +R+ R+CK D GG     E  + T  KA + C    G+  F+Y++  SA     +  +Y +F    NS     VC F+L A    FNGP R      N +     + NP+P+  C  L   +   NE +T  SL  +      ++ + PV   P +   +   + +    +  +D      +++ ++I   S T          S   C +    ++P   +  +  L   ++A  L +  SDR++R+ +  C  Y ++  CL      CGWD +   C++L D  +++ W +  ++C  +N+  +     WS    C   D   S  C+C+   C +    C       P I I NC+     G W  W +W+ CS       ++R+R CS+         C+G++ E + C       V   W+ W             SKCS +  G    ++ R   CEN
Sbjct:   43 REHPIVAFEDLKPWVFNFTYPGVRDFSQLALDPSRNQ---LIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEE---CQNYVRVLIVSGRKVFMC----GTNAFSPVCSSRQV-GNLSRTIE-KINGVARCPYDPRHNSTAVISSQGELYAATVIDFS-----GRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAFDIGLFAYFFLRE-----NAVEHDC-----GRTVY-SRVARVCKNDVGGRFLL-EDTWTTFMKARLNCSR-PGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISKAFNGPFR---YQENPRAAWLPIANPIPNFQCGTLP--ETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKD-----TLYHVLYIGTESGTILKALSTASRSLRGCYLEELHVLPPGRLEPLRSLRILHSARALFVGLSDRVLRVPLERCSAYHSQGACLGARDPYCGWDGKRQLCSTLEDSSNMSLWIQNITTCPVRNVTRDGGFGPWSPWKPCEHLDGDNSGSCLCRARSCDSPRPRCGGLECLGPSIHIANCS---RNGAWTAWSSWAQCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIFWASW----------GSWSKCSNNCGG---GVQSRRRSCEN 693          

HSP 2 Score: 60.077 bits (144), Expect = 1.450e-8
Identity = 48/160 (30.00%), Postives = 61/160 (38.12%), Query Frame = 3
Query: 2061 GEWNEWGAWSTCSP--EKKTKIRKRECS------SKFSCIGQTEETKICTT----VRSVWSQWYITS------NPKIYNSFRSKCSTDDSGPSSTI----EIREMVCE-NTCQENLFKWYKWSKWSDCTSQNVQYRLYNCSEL----SQCPANQTQIQNC 2459
            G W  WG WS+CS   E   ++RKR C+          C+G   E + C      VR  WS W   S          Y   RS C++    P   I       E +C    C E    W  WS+W  CT    Q R  +C EL      C  N +Q + C
Sbjct:  825 GGWATWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPVRGAWSCWTAWSQCSASCGGGHYQRTRS-CTSPAPSPGEDICLGLHTEEALCSTQACPEG---WSLWSEWGVCTEDGAQSRSRSCEELLPGPGACVGNSSQSRPC 980          
BLAST of SMED30025076 vs. Ensembl Mouse
Match: Sema5a (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A [Source:MGI Symbol;Acc:MGI:107556])

HSP 1 Score: 106.686 bits (265), Expect = 7.206e-23
Identity = 142/602 (23.59%), Postives = 236/602 (39.20%), Query Frame = 3
Query:  759 SDQHKTFSVLTKEHIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSKL---YVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIV-------PVVKTPLINFQNKDITQITAFSINPEDPSSVLIIH----YDMFIEIFSH-TESNELCNIGIYKLVPKENVFQISGLTTDNNAYIL-ISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERS--SC--KNI-IDNSV--WSIPSICFVNDSQISLKCIC--KYCTNEI-MCSN----KPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICT-----TVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQNVQYRLYN---CSELSQ 2426
            S QH + ++LT      G     + +    + P I   + ++  L T   N  +     F+  ++  +  YF   E     +    DC      + V+ +R  R+CK D GG     E  + T  KA + C    G+  F+Y++ +  T+   +L   Y +F    NS     VC F+L A    FNGP +      NS+      PNP P       N Q    ++    +L+   L   QK +       PV   P     N   + +    +   + + V II+    Y    ++ +  ++S+  C +   +L P+     I  L   ++  +L +   + + +I +  C  + TR+ C+      CGWD     CTSL + + + +W++S  +C  +N+ +D S   WS  + C   D      C+C  + C +    C       P++EITNC+     G W  W +WS CS       ++R+R CS+         C+GQ  E + C           W+ W              +C+    G    I+ R   CEN                DC   NV+Y+  N   C EL +
Sbjct:  164 SPQHNSTALLTAS----GELYAATAMDFPGRDPAIYRSLGTLPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRE-----NAVEHDC-----GKTVF-SRAARVCKNDIGGRFLL-EDTWTTFMKARLNCSR-PGEVPFYYNE-LQGTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAISQAFNGPFK---YQENSRSAWLPYPNPNP-------NFQCGTMDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHLAVDVVQGRE-TLVHIIYLATDYGTIKKVRAPLSQSSGSCLLEEIELFPERRSEPIRSLQILHSQSVLFVGLQEHVAKIPLKRCHFHQTRSACIGAQDPYCGWDAVMKKCTSLEESLSMTQWDQSIPTCPTRNLTVDGSFGPWSPWTPCTHTDGTAVGSCLCRSRSCDSPAPQCGGWQCEGPRMEITNCS---RNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHVFWTGW----------GPWERCTAQCGG---GIQARRRTCENG--------------PDCAGCNVEYQPCNTNACPELKK 706          
BLAST of SMED30025076 vs. Ensembl Mouse
Match: Sema4c (sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4C [Source:MGI Symbol;Acc:MGI:109252])

HSP 1 Score: 55.8398 bits (133), Expect = 2.844e-7
Identity = 67/292 (22.95%), Postives = 119/292 (40.75%), Query Frame = 3
Query: 1053 VTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAV----SATWTNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEK------NLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQK-------IVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHTESNEL---CNIGIY-KLVPKENVFQ---ISGLTTDNNAYILISTS-DRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTS 1853
            V R+ R+CK D GGA    +  + T  KA +VC     K  F   KAV     A+W N+  + +F+ +        VC + L   + VF GP +       S+  +K       +P+P P  C    N     N   ++  L  N L   +K       + P +  PL+  +N + T + A  +   D ++  ++        F  T    L    ++G +  +V +  VF    +  L    +  +L + S  +++++ + +C KY     C++     C W+  T  C +
Sbjct:  254 VARVARVCKGDMGGARTLQK-KWTTFLKARLVCSAPDWKVYFNQLKAVHTLRGASWHNTTFFGVFQARWGDMDLSAVCEYQLEQIQQVFEGPYKE-----YSEQAQKWARYTDPVPSPRPGSC---INNWHRDNGYTSSLELPDNTLNFIKKHPLMEDQVKPRLGRPLLVKKNTNFTHVVADRVPGLDGATYTVL--------FIGTGDGWLLKAVSLGPWIHMVEELQVFDQEPVESLVLSQSKKVLFAGSRSQLVQLSLADCTKYRFCVDCVLARDPYCAWNVNTSRCVA 528          
BLAST of SMED30025076 vs. Ensembl Mouse
Match: Sema4c (sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4C [Source:MGI Symbol;Acc:MGI:109252])

HSP 1 Score: 55.8398 bits (133), Expect = 2.844e-7
Identity = 67/292 (22.95%), Postives = 119/292 (40.75%), Query Frame = 3
Query: 1053 VTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAV----SATWTNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEK------NLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQK-------IVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHTESNEL---CNIGIY-KLVPKENVFQ---ISGLTTDNNAYILISTS-DRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTS 1853
            V R+ R+CK D GGA    +  + T  KA +VC     K  F   KAV     A+W N+  + +F+ +        VC + L   + VF GP +       S+  +K       +P+P P  C    N     N   ++  L  N L   +K       + P +  PL+  +N + T + A  +   D ++  ++        F  T    L    ++G +  +V +  VF    +  L    +  +L + S  +++++ + +C KY     C++     C W+  T  C +
Sbjct:  254 VARVARVCKGDMGGARTLQK-KWTTFLKARLVCSAPDWKVYFNQLKAVHTLRGASWHNTTFFGVFQARWGDMDLSAVCEYQLEQIQQVFEGPYKE-----YSEQAQKWARYTDPVPSPRPGSC---INNWHRDNGYTSSLELPDNTLNFIKKHPLMEDQVKPRLGRPLLVKKNTNFTHVVADRVPGLDGATYTVL--------FIGTGDGWLLKAVSLGPWIHMVEELQVFDQEPVESLVLSQSKKVLFAGSRSQLVQLSLADCTKYRFCVDCVLARDPYCAWNVNTSRCVA 528          
BLAST of SMED30025076 vs. UniProt/SwissProt
Match: sp|Q60519|SEM5B_MOUSE (Semaphorin-5B OS=Mus musculus OX=10090 GN=Sema5b PE=2 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 3.702e-25
Identity = 159/752 (21.14%), Postives = 287/752 (38.16%), Query Frame = 3
Query:  351 HQQQLIEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKI-------SNNYTIIACSLMMMPCEERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTNCMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSL--SLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHT---------ESNELCNIGIYKLVPKENVFQISGLTTDNNAYIL-ISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER--SSC--KNIIDN---SVWSIPSICFVNDSQISLKCICKY--C-TNEIMCSN----KPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENT-CQENLFKWYKWSKWSDCT---SQNVQYRLYNCSELSQCPANQTQIQNC 2459
             +  ++ F+     V +FT+   +DF+Q  +  + N     +V   N +  + L  + +       S+  T  +C       EE     +   + ++  + ++ C     +N ++   ++  +  N + T + K           +H + +V++ +  ++    +D S      + P I   + S   L T   N  +     F+  F+     YF + E     +    DC      R VY +R+ R+CK D GG     E  + T  KA + C    G+  F+Y++  SA     +  +Y +F    NS     VC F+L A    FNGP R      N +     + NP+P+  C  L   +   NE +T  SL  +      ++ + PV   P +   +   + +    +  +D      +++ ++I   S T          S   C +    ++P   +  +  L   ++A  L +  SDR++R+ +  C  Y ++  CL      CGWD +   C++L D  +++ W +  ++C  +N+  +     WS    C   D   S  C+C+   C +    C       P I I NC+     G W  W +W+ CS       ++R+R CS+         C+G++ E + C                                            ENT C   +F W  W  WS C+      VQ R  +C   + CP    + + C
Sbjct:   43 REHPIVAFEDLKPWVFNFTYPGVRDFSQLALDPSRNQ---LIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEE---CQNYVRVLIVSGRKVFMC----GTNAFSPVCSSRQV-GNLSRTIE-KINGVARCPYDPRHNSTAVISSQGELYAATVIDFS-----GRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAFDIGLFAYFFLRE-----NAVEHDC-----GRTVY-SRVARVCKNDVGGRFLL-EDTWTTFMKARLNCSR-PGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISKAFNGPFR---YQENPRAAWLPIANPIPNFQCGTLP--ETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKD-----TLYHVLYIGTESGTILKALSTASRSLRGCYLEELHVLPPGRLEPLRSLRILHSARALFVGLSDRVLRVPLERCSAYHSQGACLGARDPYCGWDGKRQLCSTLEDSSNMSLWIQNITTCPVRNVTRDGGFGPWSPWKPCEHLDGDNSGSCLCRARSCDSPRPRCGGLECLGPSIHIANCS---RNGAWTAWSSWAQCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCN-------------------------------------------ENTPCPVPIF-WASWGSWSKCSNNCGGGVQSRRRSCENGNSCPGCGVEFKTC 707          

HSP 2 Score: 60.077 bits (144), Expect = 1.214e-7
Identity = 48/160 (30.00%), Postives = 61/160 (38.12%), Query Frame = 3
Query: 2061 GEWNEWGAWSTCSP--EKKTKIRKRECS------SKFSCIGQTEETKICTT----VRSVWSQWYITS------NPKIYNSFRSKCSTDDSGPSSTI----EIREMVCE-NTCQENLFKWYKWSKWSDCTSQNVQYRLYNCSEL----SQCPANQTQIQNC 2459
            G W  WG WS+CS   E   ++RKR C+          C+G   E + C      VR  WS W   S          Y   RS C++    P   I       E +C    C E    W  WS+W  CT    Q R  +C EL      C  N +Q + C
Sbjct:  796 GGWATWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPVRGAWSCWTAWSQCSASCGGGHYQRTRS-CTSPAPSPGEDICLGLHTEEALCSTQACPEG---WSLWSEWGVCTEDGAQSRSRSCEELLPGPGACVGNSSQSRPC 951          
BLAST of SMED30025076 vs. UniProt/SwissProt
Match: sp|Q9P283|SEM5B_HUMAN (Semaphorin-5B OS=Homo sapiens OX=9606 GN=SEMA5B PE=2 SV=4)

HSP 1 Score: 113.62 bits (283), Expect = 3.724e-24
Identity = 157/723 (21.72%), Postives = 283/723 (39.14%), Query Frame = 3
Query:  321 SSKNVYHIQTHQQQL--------IEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCE-----ERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTNCMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSL--SLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHT---------ESNELCNIGIYKLVPKENVFQISGLTTDNNAYIL-ISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER--SSC--KNIIDN---SVWSIPSICFVNDSQISLKCICKY--C-TNEIMCSN----KPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICT-----TVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCEN 2321
            SS++V    + +QQL        + F+     V +FT+   +DF+Q  +  + N     +V   N +  + L  + +       +       C+     E    N++  + V   K+      +  +N ++   T+  +  N + T + K           +H + +V++ +  ++    +D S      + P I   + S   L T   N  +     F+  ++     YF + E     +    DC      R VY +R+ R+CK D GG     E  + T  KA + C    G+  F+Y++  SA     +  +Y +F    NS     VC F+L A    FNGP R      N +     + NP+P+  C  L   +   NE +T  SL  +      ++ + PV   P +   +   + +    +  +D      +++ ++I   S T          S   C +    ++P      +  L   ++A  L +   D ++R+ +  C  Y ++  CL      CGWD +   C++L D  +++ W +  ++C  +N+  +     WS    C   D   S  C+C+   C +    C       P I I NC+     G W  W +W+ CS       ++R+R CS+         C+G++ E + C       V   W+ W             SKCS++  G    ++ R   CEN
Sbjct:   83 SSQDVSSEPSSEQQLCALSKHPTVAFEDLQPWVSNFTYPGARDFSQLALDPSGNQ---LIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNYVRVLIVAGRKVF-----MCGTNAFSPMCTSRQV-GNLSRTIE-KINGVARCPYDPRHNSTAVISSQGELYAATVIDFS-----GRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAYDIGLFAYFFLRE-----NAVEHDC-----GRTVY-SRVARVCKNDVGGRFLL-EDTWTTFMKARLNCSR-PGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFR---YQENPRAAWLPIANPIPNFQCGTLP--ETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKD-----TLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVLPPGRREPLRSLRILHSARALFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCS---RNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIFWASW----------GSWSKCSSNCGG---GMQSRRRACEN 751          

HSP 2 Score: 65.855 bits (159), Expect = 2.074e-9
Identity = 49/160 (30.63%), Postives = 63/160 (39.38%), Query Frame = 3
Query: 2061 GEWNEWGAWSTCSP--EKKTKIRKRECS------SKFSCIGQTEETKICTT----VRSVWSQWY------ITSNPKIYNSFRSKCSTDDSGPSSTI----EIREMVCE-NTCQENLFKWYKWSKWSDCTSQNVQYRLYNCSEL----SQCPANQTQIQNC 2459
            G W  WG WS+CS   E   ++RKR C+          C+G   E + C      VR  WS W        +     Y   RS C++    P   I       E +C    C E    W  WS+WS CT    Q R  +C EL    S C  N +Q + C
Sbjct:  854 GGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPVRGAWSCWTSWSPCSASCGGGHYQRTRS-CTSPAPSPGEDICLGLHTEEALCATQACPEG---WSPWSEWSKCTDDGAQSRSRHCEELLPGSSACAGNSSQSRPC 1009          
BLAST of SMED30025076 vs. UniProt/SwissProt
Match: sp|D3ZTD8|SEM5A_RAT (Semaphorin-5A OS=Rattus norvegicus OX=10116 GN=Sema5a PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 3.265e-23
Identity = 142/601 (23.63%), Postives = 234/601 (38.94%), Query Frame = 3
Query:  759 SDQHKTFSVLTKEHIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIV-------PVVKTPLINFQNKDITQITAFSINPEDPSSVLIIH----YDMFIEIFSH-TESNELCNIGIYKLVPKENVFQISGLTTDNNAYIL-ISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERS--SC--KNI-IDNSV--WSIPSICFVNDSQISLKCIC--KYCTNEI-MCSN----KPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICT-----TVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQNVQYRLYN---CSELSQ 2426
            S QH + ++LT      G     + +    + P I   + ++  L T   N  +     F+  ++  +  YF   E     +    DC      + V+ +R  R+CK D GG     E  + T  KA + C    G+  F+Y++  S  +      +Y +F    NS     VC F+L A    FNGP +      NS+      PNP P       N Q    ++    +L+   L   QK +       PV   P     N   + +    +   D + V II+    Y    ++ +  ++S+  C +   +L P+     I  L   ++  +L +   + +++I +  C  + TR  C+      CGWD     CTSL + + + +W++S  +C  +N+ +D S   WS  + C   D      C+C  + C +    C       P++EITNC+     G W  W +WS CS       ++R+R CS+         C+GQ  E + C           W+ W              +C+    G    I+ R   CEN                DC   NV+Y+  N   C EL +
Sbjct:  164 SPQHNSTALLTAS----GELYAATAMDFPGRDPAIYRSLGTLPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRE-----NAVEHDC-----GKTVF-SRAARVCKNDIGGRFLL-EDTWTTFMKARLNCSR-PGEVPFYYNELQSTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAISQAFNGPFK---YQENSRSAWLPYPNPNP-------NFQCGTMDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGRD-TLVHIIYLATDYGTIKKVRAPLSQSSGSCLLEEIELFPERKSEPIRSLKILHSQSVLFVGLQEHVVKIPLKRCHFHQTRGACIGAQDPYCGWDAVMKKCTSLEESLSMTQWDQSVPTCPTRNLTVDGSFGPWSPWTPCTHTDGTAVGSCLCRSRSCDSPAPQCGGWQCEGPRMEITNCS---RNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHVFWTGW----------GPWERCTAQCGG---GIQARRRTCENG--------------PDCAGCNVEYQPCNTNACPELKK 706          
BLAST of SMED30025076 vs. UniProt/SwissProt
Match: sp|Q62217|SEM5A_MOUSE (Semaphorin-5A OS=Mus musculus OX=10090 GN=Sema5a PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 6.044e-22
Identity = 142/602 (23.59%), Postives = 234/602 (38.87%), Query Frame = 3
Query:  759 SDQHKTFSVLTKEHIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSKL---YVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIV-------PVVKTPLINFQNKDITQITAFSINPEDPSSVLIIH----YDMFIEIFSH-TESNELCNIGIYKLVPKENVFQISGLTTDNNAYIL-ISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERS--SC--KNI-IDNSV--WSIPSICFVNDSQISLKCIC--KYCTNEI-MCSN----KPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICT-----TVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQNVQYRLYN---CSELSQ 2426
            S QH + ++LT      G     + +    + P I   + ++  L T   N  +     F+  ++  +  YF   E     +    DC      + V+ +R  R+CK D GG     E  + T  KA + C    G+  F+Y++ +  T+   +L   Y +F    NS     VC F+L A    FNGP +      NS+      PNP P       N Q    ++    +L+   L   QK +       PV   P     N   + +    +   + + V II+    Y    ++ +  ++S+  C +   +L P+     I  L   ++  +L +   + + +I +  C  + TR+ C+      CGWD     CTSL + + + +W++S  +C  +N+ +D S   WS  + C   D      C+C  + C      C       P++EITNC+     G W  W +WS CS       ++R+R CS+         C+GQ  E + C           W+ W              +C+    G    I+ R   CEN                DC   NV+Y   N   C EL +
Sbjct:  164 SPQHNSTALLTAS----GELYAATAMDFPGRDPAIYRSLGTLPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRE-----NAVEHDC-----GKTVF-SRPARVCKNDIGGRFLL-EDTWTTFMKARLNCSR-PGEVPFYYNE-LQGTFFLPELDLIYGIFTTNVNSIASSAVCVFNLSAISQAFNGPFK---YQENSRSAWLPYPNPNP-------NFQCGTMDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHLAVDVVQGRE-TLVHIIYLGTDYGTIKKVRAPLSQSSGSCLLEEIELFPERRSEPIRSLQILHSQSVLFVGLQEHVAKIPLKRCHFHQTRSACIGAQDPYCGWDAVMKKCTSLEESLSMTQWDQSIPTCPTRNLTVDGSFGPWSPWTPCTHTDGTAVGSCLCRSRSCDRPAPQCGGWQCEGPRMEITNCS---RNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHVFWTGW----------GPWERCTAQCGG---GIQARRRTCENG--------------PDCAGSNVEYHPCNTNACPELKK 706          
BLAST of SMED30025076 vs. UniProt/SwissProt
Match: sp|Q13591|SEM5A_HUMAN (Semaphorin-5A OS=Homo sapiens OX=9606 GN=SEMA5A PE=1 SV=3)

HSP 1 Score: 103.99 bits (258), Expect = 3.693e-21
Identity = 139/601 (23.13%), Postives = 230/601 (38.27%), Query Frame = 3
Query:  759 SDQHKTFSVLTKEHIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIV-------PVVKTPLINFQNKDITQITAFSINPEDPSSVLIIH----YDMFIEI-FSHTESNELCNIGIYKLVPKENVFQISGLTTDNNAYIL-ISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER--SSC--KNI-IDN--SVWSIPSICFVNDSQISLKCICKY--CTNEI-MCSN----KPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICT-----TVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQNVQYRLYN---CSELSQ 2426
            S QH + ++LT      G     + +    + P I   +  +  L T   N  +     F+  ++  +  YF   E          DC      + V+ +R  R+CK D GG     E  + T  KA + C    G+  F+Y++  S  +      +Y +F    NS     VC F+L A    F+GP +      NS+      PNP P         Q    ++    +L+   L   QK +       PV   P     N   + +    +   + + V II+    Y    ++     +++  C +   +L P+     I  L   ++  +L +   + +++I +  C+ Y TR+ C+      CGWD     CTSL + + + +WE+  S+C  +N+ +D    VWS  + C   D      C+C+   C +    C       P +EI NC+     G W  W +WS CS       ++R+R CS+         C+GQ  E + C           W+ W              +C+    G    I+ R  +CEN                DC   NV+Y+  N   C EL +
Sbjct:  164 SPQHNSTALLTAG----GELYAATAMDFPGRDPAIYRSLGILPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEH-----DC-----GKTVF-SRAARVCKNDIGGRFLL-EDTWTTFMKARLNCSR-PGEVPFYYNELQSTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFK---YQENSRSAWLPYPNPNPHF-------QCGTVDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGRE-ALVHIIYLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLREHVVKIPLKRCQFYRTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISACPTRNLTVDGHFGVWSPWTPCTHTDGSAVGSCLCRTRSCDSPAPQCGGWQCEGPGMEIANCS---RNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHMFWTGW----------GPWERCTAQCGG---GIQARRRICENG--------------PDCAGCNVEYQSCNTNPCPELKK 706          
BLAST of SMED30025076 vs. TrEMBL
Match: A0A0R3T5N2 (Sema domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS2369 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 2.045e-37
Identity = 169/741 (22.81%), Postives = 293/741 (39.54%), Query Frame = 3
Query:  378 GEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCEERIFINHLSEIQVLDSKMLWFCYVLLNSNNYN-------VALTNCMILKNKAVTTD--VKWQKYGYTSNSDQHKTFSVLTKEHI----------------FIGAFVDNSLLIQRTKLPDILGKIDSIKD--LVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVC-------PIGTGKYEFFYSKAVSATWTNS--KLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSP--LIYLNSQI--LEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPS----SVLIIHYDMFIEIFSHTES---NELCNIGIYKLVPKENVFQISGLTTDNNAYILI-------------------STSDRIIRIKINNC-----------------------------------------EKYTTRAKCLVEAPNICGWDRRTMSCTSL--------NDKVDINRWERSSCKNIIDNSV------WSIPSICFVN----------DSQISLKCICKYCTNEIMCSNKPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKTKIRKRECSSKF--------SCIGQTEETKIC 2183
            G A +   F+H++++     ++  +   +SLY V+   T+L++D  ++K+S+++ +      +  C+E        +I VL ++   F   L  S++Y          + +  ++ N A  T+  ++W    Y S++D H+   VL+   I                ++     +SL I R ++PD   + D   D  L TP +NF F + +  +  FET   +YF++ E   ++S           NR + ++R+IR+C+ D GG T   E  FGT+AKAD++C       P    +  F +    SA W ++  +LY +F   +  P G  +C +DL + +  F GP+ +   ++  NS +   +   PNP P+VCE+L+ G L+  E +T   +  N  YR + I P+    ++   +    ++  + + P   S    SVL I  D  +  F+  ES   +E   I       +    +I G   D N  IL+                      +RI+R  +  C                                           YT    C       CGW  +  SC S            + +N      CK     S       WS    C +             ++   C+C+ C ++ +C N  + +++ C  A   G W+ W +WS C  E K + R R C +           CIG   E  +C
Sbjct:  216 GIAQTFDDFSHSNYRKL--LFLPES---KSLYAVADAATLLKLDGQSLKLSSSHAVPHFRQGIRNCDESKGCRERVDITVL-TRTPQFPLALFCSSHYEERSRGIIREIASACVVPNPADITESLMQWDN-KYYSSADAHRPPVVLSPREIGPEYAAVGSTNVEPFIYVAGVSADSLRISRLQMPD-WSRFDIKWDGVLFTPKSNFLFNEPATIVMSFETTRAVYFLLREASKSRS----------GNRQI-ISRVIRVCRGDRGGVTGIGERYFGTMAKADLICQTESTTSPANGERAHFIFDFVQSAHWDSNAERLYTVFSTGEAGPRGSAICIYDLQSIEKAFQGPISNSNGILRSNSNMHKFDSPRPNPFPNVCERLAAGNLTLKE-LTLVRMGTNFYYRFEPITPLFGHAVVMSPSTKWNEVIGYQLPPVTSSNYSTSVLWISSDTHLTQFALHESHYRDEEVEISFLLSTCEVRRLRI-GSGDDANESILLKLREGPSFEWLPHTNEKNKPAKERILRFLVEACLELIVRFAIPSPFVTYNISLQGEFVYLGTTHSIFRFQTDSCASYTNEKTCTTSGDPHCGWSSQKFSCISRLSTLKSAGGLALAVNENSPPKCKTPNRTSFRKQDTGWSPWHPCSLTKDLHPKPLEMSPELQRSCLCRICLSDTLC-NFGEQQVSQCKFA---GVWSPWSSWSRC--EDKLRFRTRTCFNPLLGTAIPSSECIGDDREETLC 929          
BLAST of SMED30025076 vs. TrEMBL
Match: A0A3P6HSD0 (Sema domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7661 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 3.193e-35
Identity = 149/675 (22.07%), Postives = 278/675 (41.19%), Query Frame = 3
Query:  456 NHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCEERIFINHLSEIQVL----DSKMLWFCYVLLNSNNY---NVALTNCMILKNKAVTTDV-KWQKYGYTSNSDQHKTFSVLT---------------KEHIFIGAFVDNSLLIQRTKLPD-ILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVC------PIGTGKYEFF-YSKAVSATWTNS--KLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKN--LPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSI----NPEDPSSVL-IIHYDMFIEI-FSHTESN----------ELCNIGIYKLVPKENV---FQISGLTTDNNAYIL---------------------------ISTSDRI------------------IRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLN-------------------------------DKVDINRWERSSCKNIIDNSVWSIPSICFVNDSQISLKCICKYCTNEIMCSNKPKIEITNCTGAIEVGEWNEWGAWS 2090
            + +SLY V++  T++++D  T+ + +++T+ +     + C++        EI VL    D   +++C +    +       ALT+C++     +  ++  W    YTS +D H+   +L                +  I++     N L I R  +PD   G I+    L +P  + + ++ +  +  FETE+ +YF++ E  S   YSV       + ++V  +RL+R+C+ D GG     E  FGT+AKAD+VC      P+G G+   F +  A SA W     +LYV F   + +P G  VC +DL + + VF GP+ +   Y    +  +     NP P++CE+  N  L+ +E+++   +  N +YR + I P+    +        T +  + +    N    +S+L ++  D   +I F  T  +            C +   ++ P+ ++   F++ G   +N+A+                             +  ++RI                   R   +NC  YTT+  CL      CGW  +   C S+                                 +   ++W++ +  N   +  +S       +D Q S  C+C+ C  E +C N  + ++++C      G W++W  WS
Sbjct:  235 SEKSLYAVAKEATLVKLDGKTLSLIDSHTVASQPQASIYCQQSAGCRQRKEINVLAKTPDKSFIYYCTLHYEDHPRLLSRRALTSCVVPNPHDLAENLLMWDNVYYTS-TDPHRPPVILAPKKKTSLKSADRAANQSFIYVAGVNSNFLHIGRLPMPDWASGDINWEGALFSPKRSVFIQEPATIVISFETETAVYFLLREKPS--RYSVPSSCFQQQRQVV--SRLVRVCQGDRGGLRGIAEHYFGTMAKADLVCQSEVVSPLGGGRRSHFSFDHAQSAYWDEDAKRLYVTFTAGEAAPRGSAVCVYDLQSIERVFKGPIATFDSYQQRTLKNQGSLRSNPFPNICERFINKNLT-DEELSLGQIGANFMYRAEYIRPLFGHAVAMSSTSTWTAVIGYQLLLLTNSLYVTSILWLVSDDQLTQIAFYETRGSGAAFKPPALISTCVLRSLRVGPEHDLLGRFRVGGQFPENHAFTAQHPGSPPKYLPFDIDDPWKIELPSPSELPNTERINSILREGDSIFLGTTHAIFRFPTDNCASYTTKEACLESKDPHCGWSSQINQCLSIRGYSQASNLLVASINTRPQCPSSNQSRSTFATSQSGWSKWQQCNLTNTFQSDGFSRNLKEIASDQQYS--CLCRICLGETLC-NFGEQQVSHCKVP---GIWSQWSEWS 897          
BLAST of SMED30025076 vs. TrEMBL
Match: A0A0V0JC17 (Sema domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR165512 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 8.795e-35
Identity = 121/430 (28.14%), Postives = 206/430 (47.91%), Query Frame = 3
Query:  342 IQTHQQQLIEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSL------MMMPCEERIFINHLSEIQVLDSKMLWFCYV----LLNSNN-YNVALTNCMILKNKAVTTDV-KWQKYGYTSNSDQHKTFSVLTKEHIF--IGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAK--SYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVC---PIGTG-----KYEFFYSKAVSATWTN--SKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSI 1553
            + T  ++LI   G A+    F       F Q   +N+   ++LYVV+   T+L++++D++ I ++YT+ + S         M CE+   IN L+++   D   +WFC +      N ++ Y  ++T C + K   ++ ++ +W+   +TS    H    VL  +  F  I     + L I R  +PD  GKI+    L +P  + Y E+ +  +  FETE+ IYFV+ E  S +   +   +    P   +  VTRL+RICK D GG    +E  FGT+AKAD+VC    I  G        F ++ A +A W     +LY +F     +P G  VC +D+ + +  F GP+  P    +++   +   NP P++CEK S+  L++ E     + ++  L R   + P+    +     K  T IT + +
Sbjct:  249 LMTGIEELISSGGAAV----FKDRKHHGFKQMQYLNH--DRALYVVASGATLLKLNVDSLAILDSYTVPSQSKENPYCNPSMGCEQVKEINLLAKVPSTD--FVWFCALHYERYPNGHSFYQQSVTGCAVPKPNDLSENLLQWENPHFTSLEPNHPPV-VLNSQDTFTYIAGVSPDYLRILRAHMPDWDGKINWEGTLFSPKKSAYIEEPATILLGFETETAIYFVLRERPSRQDAGHCRSETGGVPITEVDDVTRLVRICKGDRGGLPRISEHFFGTLAKADLVCQSKAITEGFRVRTTRRFTFTHATAAQWDTQAQRLYAVFATDTPAPKGSAVCVYDVTSLEHAFKGPV-IPTFSSSAKSRPEPRENPFPNICEKFSSNNLTEEELSMGRTEAIY-LRRHIPVFPIFGHAVAMVSGKSWTSITGYQV 667          
BLAST of SMED30025076 vs. TrEMBL
Match: A0A564XUM6 (Sema domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS98 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.265e-34
Identity = 152/680 (22.35%), Postives = 282/680 (41.47%), Query Frame = 3
Query:  378 GEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMP-------CEERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNV--ALTNCMILKNKAVTTD--VKWQKYGYTSNSDQHKTFSVLTKEH----------------IFIGAFVDNSLLIQRTKLPDILGKIDSIKD--LVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVC----PIGTGKYE---FFYSKAVSATWTN--SKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPM--RSPLIYLNSQILE--KNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPS----SVLIIHYDMFIEIFSHTESNE------------LCNIGIYKLV------------------PKENVFQISGLTTD---------NNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSC----------TSLNDKVDINRWERSSCKN----IIDNSVWSIPSIC-FVND---------SQISLKCICKYCTNEIMCSNKPKIEITNCTGAIEVGEWNEWGAWS 2090
            G A +   F+H++++   +   ++  N  SLY V+   T+L++D  ++K S+++ +++     +P       C ERI I  L+    L   + +FC       +  +   + +  I+ N A   D  ++W    Y+S +D H+   VL+ +                 I++     NSL I R ++PD   + D   D  L +P +NF F + +     FET++ +YF++ E   ++S        +P+     ++R++R+C+ D GG     E  FGT+AKAD++C    P      E   F ++   SA W +   +LY +F   +  P G  +C +DL + +  F GP+   + ++  NS++ E     PNP P+VCE+L+   L+  E +T   +  N  +R + I P+    +    +    ++  + + P   S    SVL +  D  +   +  E+ +             C I   ++                   PK       G   +            ++ + T+  I R + ++C  Y+    C+      CGW  +   C          +SL   VD     +    N       ++ WS    C   ND          ++   C+C+ C ++ +C N  + +++ C  A   G W+ W +WS
Sbjct:   24 GIAQTFDDFSHSNYR---KLLFLSESN--SLYAVADAATLLKLDGQSLKFSSSH-VVSPFQQGLPNCDESKGCRERIDITVLTRTPQL--PLAFFCSSHFEERSRGIIREVASVCIVPNPADIADPLMQWDNKQYSS-ADAHRPPIVLSPKETGPEKAAVGATHVEPFIYVAGVSANSLRISRLQMPD-WSRFDIKWDGVLFSPKSNFLFNEPATIFMSFETKTAVYFLLREASKSRS-------GNPQ----MISRVVRVCRGDRGGVMGIGERYFGTMAKADLICQSESPTSRANGERAHFIFNFVQSAYWDSDAERLYTVFSAGEAGPRGSAICIYDLLSIEKAFQGPISNSNAILRSNSKMHEFDSARPNPFPNVCERLAADNLTLQE-LTLGRMGTNFYHRFEPITPLFGYAVAMSPSTKWNEVIGYRLPPIASSNYSTSVLWVSSDTHLTQLALHETRDWDEEVEISFLLSTCEIRRLRVTGGGGVDESILTRLREGPPPKWITHADKGSKPEKEKILHFLVEGEFVYLGTTQSIFRFQTDSCASYSNEKTCISSGDPHCGWSSQKFRCVSRLNPLKSTSSLTLAVDGKSPPKCRTPNRSPFRTQDTGWSPWHPCSLTNDPHPKPLEMSPELQRSCLCRICLSDTLC-NFGEQQVSQCKVA---GVWSPWSSWS 677          
BLAST of SMED30025076 vs. TrEMBL
Match: A0A564XVS5 (Sema domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS98 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 5.824e-34
Identity = 152/680 (22.35%), Postives = 282/680 (41.47%), Query Frame = 3
Query:  378 GEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMP-------CEERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNV--ALTNCMILKNKAVTTD--VKWQKYGYTSNSDQHKTFSVLTKEH----------------IFIGAFVDNSLLIQRTKLPDILGKIDSIKD--LVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVC----PIGTGKYE---FFYSKAVSATWTN--SKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPM--RSPLIYLNSQILE--KNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPS----SVLIIHYDMFIEIFSHTESNE------------LCNIGIYKLV------------------PKENVFQISGLTTD---------NNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSC----------TSLNDKVDINRWERSSCKN----IIDNSVWSIPSIC-FVND---------SQISLKCICKYCTNEIMCSNKPKIEITNCTGAIEVGEWNEWGAWS 2090
            G A +   F+H++++   +   ++  N  SLY V+   T+L++D  ++K S+++ +++     +P       C ERI I  L+    L   + +FC       +  +   + +  I+ N A   D  ++W    Y+S +D H+   VL+ +                 I++     NSL I R ++PD   + D   D  L +P +NF F + +     FET++ +YF++ E   ++S        +P+     ++R++R+C+ D GG     E  FGT+AKAD++C    P      E   F ++   SA W +   +LY +F   +  P G  +C +DL + +  F GP+   + ++  NS++ E     PNP P+VCE+L+   L+  E +T   +  N  +R + I P+    +    +    ++  + + P   S    SVL +  D  +   +  E+ +             C I   ++                   PK       G   +            ++ + T+  I R + ++C  Y+    C+      CGW  +   C          +SL   VD     +    N       ++ WS    C   ND          ++   C+C+ C ++ +C N  + +++ C  A   G W+ W +WS
Sbjct:  214 GIAQTFDDFSHSNYR---KLLFLSESN--SLYAVADAATLLKLDGQSLKFSSSH-VVSPFQQGLPNCDESKGCRERIDITVLTRTPQL--PLAFFCSSHFEERSRGIIREVASVCIVPNPADIADPLMQWDNKQYSS-ADAHRPPIVLSPKETGPEKAAVGATHVEPFIYVAGVSANSLRISRLQMPD-WSRFDIKWDGVLFSPKSNFLFNEPATIFMSFETKTAVYFLLREASKSRS-------GNPQ----MISRVVRVCRGDRGGVMGIGERYFGTMAKADLICQSESPTSRANGERAHFIFNFVQSAYWDSDAERLYTVFSAGEAGPRGSAICIYDLLSIEKAFQGPISNSNAILRSNSKMHEFDSARPNPFPNVCERLAADNLTLQE-LTLGRMGTNFYHRFEPITPLFGYAVAMSPSTKWNEVIGYRLPPIASSNYSTSVLWVSSDTHLTQLALHETRDWDEEVEISFLLSTCEIRRLRVTGGGGVDESILTRLREGPPPKWITHADKGSKPEKEKILHFLVEGEFVYLGTTQSIFRFQTDSCASYSNEKTCISSGDPHCGWSSQKFRCVSRLNPLKSTSSLTLAVDGKSPPKCRTPNRSPFRTQDTGWSPWHPCSLTNDPHPKPLEMSPELQRSCLCRICLSDTLC-NFGEQQVSQCKVA---GVWSPWSSWS 867          
BLAST of SMED30025076 vs. Ensembl Cavefish
Match: sema5ba (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Ba [Source:ZFIN;Acc:ZDB-GENE-070912-187])

HSP 1 Score: 128.642 bits (322), Expect = 8.313e-30
Identity = 144/610 (23.61%), Postives = 248/610 (40.66%), Query Frame = 3
Query:  765 QHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSLS-LNGLYRTQKIV-PVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHT---------ESNELCNIGIYKLVP---KENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER--SSCK---NIIDNS--VWSIPSICFVNDSQISLKCICKY--CTNEI-MCSNK----PKIEITNCTGAIEVGEWNEWGAWSTCSP--EKKTKIRKRECSSKFS------CIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQ---NVQYRLYNCSELSQCPANQTQIQNCEL 2465
            +H + +V+T+   ++    +D S      + P I   +  +  L T   N  +    +FI  ++     +F + E     +    DC      + VY +R+ R+CK D GG     E  + T  KA + C   +G+  F+Y++  S  +   +  +Y +F    NS     VC ++L A    FNGP RS     N +      PNP+P+  C  + +     N+ +T  SL     LY    +V PV   PL+   +   +++    +  +D      +H+ M+I   S T         +S + C +   +L P   +E +  +  L  D    + +  +DR+++I +  C  Y T   CL      CGWDR+   CT++ D  ++++W +  ++C      +D +   W+    C  +D   +  C+C+   C +    C  K    P IE+ NC+     G W  W +W  CS   E   ++R+R C++         C+GQ  E + C              N K+                            +C + +F W  WS WS C+++    V  R  NC   + CP    + Q C L
Sbjct:  122 RHNSTAVVTESGELYAATVIDFS-----GRDPVIYRSLGGMPPLRTAQYNSKWLNEPQFISAYDIGLFTFFFLRE-----NAVEHDC-----GKTVY-SRVARVCKNDIGGRF-LLEDTWTTFTKARLNCSR-SGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAYNLSAITRAFNGPFRS---QENPRSTWLPTPNPIPNFQCGTIED--KGPNDGLTERSLQDAQRLYLMNDVVQPVSVDPLVWQDSMRFSKLVVDIVQGQD-----TLHHVMYIGTESGTILKALATSNKSLQGCYLEEMQLHPPDTREPILSLQILHGDRT--LFVGLNDRVLKIPLARCSSYQTEQMCLDARDPYCGWDRKQRRCTTIEDSSNMSQWFQNITACPLRNQTMDGAYGPWAPWQPCNHDDGDGTSACLCRSRKCDSPAPQCGGKSCEGPTIEVANCS---RNGGWTPWSSWGQCSTSCEIGFEVRQRSCNNPSPRHGGRVCVGQAREQRFC--------------NEKV----------------------------SCPQPIF-WSSWSPWSKCSAECGGGVHSRSRNCENGNSCPGCALEYQACNL 655          
BLAST of SMED30025076 vs. Ensembl Cavefish
Match: sema5ba (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Ba [Source:ZFIN;Acc:ZDB-GENE-070912-187])

HSP 1 Score: 127.872 bits (320), Expect = 1.595e-29
Identity = 144/610 (23.61%), Postives = 248/610 (40.66%), Query Frame = 3
Query:  765 QHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSLS-LNGLYRTQKIV-PVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHT---------ESNELCNIGIYKLVP---KENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER--SSCK---NIIDNS--VWSIPSICFVNDSQISLKCICKY--CTNEI-MCSNK----PKIEITNCTGAIEVGEWNEWGAWSTCSP--EKKTKIRKRECSSKFS------CIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQ---NVQYRLYNCSELSQCPANQTQIQNCEL 2465
            +H + +V+T+   ++    +D S      + P I   +  +  L T   N  +    +FI  ++     +F + E     +    DC      + VY +R+ R+CK D GG     E  + T  KA + C   +G+  F+Y++  S  +   +  +Y +F    NS     VC ++L A    FNGP RS     N +      PNP+P+  C  + +     N+ +T  SL     LY    +V PV   PL+   +   +++    +  +D      +H+ M+I   S T         +S + C +   +L P   +E +  +  L  D    + +  +DR+++I +  C  Y T   CL      CGWDR+   CT++ D  ++++W +  ++C      +D +   W+    C  +D   +  C+C+   C +    C  K    P IE+ NC+     G W  W +W  CS   E   ++R+R C++         C+GQ  E + C              N K+                            +C + +F W  WS WS C+++    V  R  NC   + CP    + Q C L
Sbjct:  187 RHNSTAVVTESGELYAATVIDFS-----GRDPVIYRSLGGMPPLRTAQYNSKWLNEPQFISAYDIGLFTFFFLRE-----NAVEHDC-----GKTVY-SRVARVCKNDIGGRF-LLEDTWTTFTKARLNCSR-SGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAYNLSAITRAFNGPFRS---QENPRSTWLPTPNPIPNFQCGTIED--KGPNDGLTERSLQDAQRLYLMNDVVQPVSVDPLVWQDSMRFSKLVVDIVQGQD-----TLHHVMYIGTESGTILKALATSNKSLQGCYLEEMQLHPPDTREPILSLQILHGDRT--LFVGLNDRVLKIPLARCSSYQTEQMCLDARDPYCGWDRKQRRCTTIEDSSNMSQWFQNITACPLRNQTMDGAYGPWAPWQPCNHDDGDGTSACLCRSRKCDSPAPQCGGKSCEGPTIEVANCS---RNGGWTPWSSWGQCSTSCEIGFEVRQRSCNNPSPRHGGRVCVGQAREQRFC--------------NEKV----------------------------SCPQPIF-WSSWSPWSKCSAECGGGVHSRSRNCENGNSCPGCALEYQACNL 720          
BLAST of SMED30025076 vs. Ensembl Cavefish
Match: sema5ba (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Ba [Source:ZFIN;Acc:ZDB-GENE-070912-187])

HSP 1 Score: 127.872 bits (320), Expect = 1.635e-29
Identity = 144/610 (23.61%), Postives = 248/610 (40.66%), Query Frame = 3
Query:  765 QHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSLS-LNGLYRTQKIV-PVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHT---------ESNELCNIGIYKLVP---KENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER--SSCK---NIIDNS--VWSIPSICFVNDSQISLKCICKY--CTNEI-MCSNK----PKIEITNCTGAIEVGEWNEWGAWSTCSP--EKKTKIRKRECSSKFS------CIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQ---NVQYRLYNCSELSQCPANQTQIQNCEL 2465
            +H + +V+T+   ++    +D S      + P I   +  +  L T   N  +    +FI  ++     +F + E     +    DC      + VY +R+ R+CK D GG     E  + T  KA + C   +G+  F+Y++  S  +   +  +Y +F    NS     VC ++L A    FNGP RS     N +      PNP+P+  C  + +     N+ +T  SL     LY    +V PV   PL+   +   +++    +  +D      +H+ M+I   S T         +S + C +   +L P   +E +  +  L  D    + +  +DR+++I +  C  Y T   CL      CGWDR+   CT++ D  ++++W +  ++C      +D +   W+    C  +D   +  C+C+   C +    C  K    P IE+ NC+     G W  W +W  CS   E   ++R+R C++         C+GQ  E + C              N K+                            +C + +F W  WS WS C+++    V  R  NC   + CP    + Q C L
Sbjct:  187 RHNSTAVVTESGELYAATVIDFS-----GRDPVIYRSLGGMPPLRTAQYNSKWLNEPQFISAYDIGLFTFFFLRE-----NAVEHDC-----GKTVY-SRVARVCKNDIGGRF-LLEDTWTTFTKARLNCSR-SGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAYNLSAITRAFNGPFRS---QENPRSTWLPTPNPIPNFQCGTIED--KGPNDGLTERSLQDAQRLYLMNDVVQPVSVDPLVWQDSMRFSKLVVDIVQGQD-----TLHHVMYIGTESGTILKALATSNKSLQGCYLEEMQLHPPDTREPILSLQILHGDRT--LFVGLNDRVLKIPLARCSSYQTEQMCLDARDPYCGWDRKQRRCTTIEDSSNMSQWFQNITACPLRNQTMDGAYGPWAPWQPCNHDDGDGTSACLCRSRKCDSPAPQCGGKSCEGPTIEVANCS---RNGGWTPWSSWGQCSTSCEIGFEVRQRSCNNPSPRHGGRVCVGQAREQRFC--------------NEKV----------------------------SCPQPIF-WSSWSPWSKCSAECGGGVHSRSRNCENGNSCPGCALEYQACNL 720          
BLAST of SMED30025076 vs. Ensembl Cavefish
Match: sema5bb (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Bb [Source:ZFIN;Acc:ZDB-GENE-130530-778])

HSP 1 Score: 112.464 bits (280), Expect = 7.694e-25
Identity = 137/561 (24.42%), Postives = 236/561 (42.07%), Query Frame = 3
Query:  765 QHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSLS-LNGLYRTQKIV-PVVKTPLINFQNKDITQITAFSINPEDPSSVLI---IHYDMFIEIFSHTESNEL--CNIGIYKLVPK---ENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER--SSC--KNIIDNSV---WSIPSICFVNDSQ---ISLKCICKYCTNEI-MCSN----KPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICT-----TVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCEN 2321
            +H + ++LT    ++    +D S      + P I   + ++  L T   N  +     F+  +E     YF + E    +     DC      + VY +R+ R+C+ D GG     E  + T  KA + C   +G   F+Y +  S  +   +  +Y +F    NS     VC F+L A    FNGP R      N +    + PNP+P+  C  + +G    N  +T  SL     L+    +V P+   PLI+  N   +++    +   D    +I     Y   I+  S T +N L  C +   KL+P+   E +  +  L +D + ++ +++  ++++I +  C  Y T++ CL      CGWDR+   C+++ +  ++++W +  + C  +N+  +     WS    C  ND      + +C  + C +    C        KIE+ NC+     G W  W +WS CS       ++R+R C++         C+GQ  E ++C       +   W  W          S  SKCS    G    I+ R   CEN
Sbjct:  108 KHNSTAMLTDSGELYAATVIDFS-----GRDPVIYRSLGTLPPLRTAQYNSKWLNEPHFVSAYEVGRFTYFFLRETAVEQ-----DC-----GKAVY-SRVARVCQNDVGGRFLL-EDTWTTFMKARLNCSR-SGDVPFYYHELQSTFYLPEQDIIYGVFTTNVNSIAASAVCAFNLSAITQAFNGPFR---YQENPRTSWLSTPNPIPNFQCGTVGDGGPGGN--LTERSLQDAQRLFLMNDVVQPISVNPLISQDNIRFSKVAVDIVQGRDRLYHVIYIGTEYGTVIKALS-TSNNSLRGCYLEEMKLLPEDEWEPILNLQILQSDRSLFVGLNS--KVLKIPLERCSNYQTQSDCLDARDPYCGWDRKQKRCSTIEESSNMSQWIQNITHCPERNLTQDGAFGSWSPWQSCNHNDGGENTSACQCRSRSCDSPAPQCGGLECVGAKIEVANCS---RNGGWTPWSSWSPCSTSCGVGFEVRQRSCNNPAPRHGGRVCVGQAREERLCNENTPCPLPVSWVPW----------SSWSKCSAPCGG---GIQSRVRTCEN 626          
BLAST of SMED30025076 vs. Ensembl Cavefish
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:103027847])

HSP 1 Score: 103.99 bits (258), Expect = 3.749e-22
Identity = 131/574 (22.82%), Postives = 205/574 (35.71%), Query Frame = 3
Query:  855 PDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIV-------PVVKTPLINFQNKDITQITAFSINPEDPSSVLI---IHYDMFIEIFSH-TESNELCNIGIYKLVPKENVFQI-SGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERSSCKNIIDN-------SVWSIPSICFVNDSQISLKCICKYCTNEIMCSNKPKIEITNCTG-AIEV------GEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCT---SQNVQYRLYNCSELSQCPANQTQIQNC 2459
            P I   +  +  L T   N  +     F+  ++  +  YF   E          DC      R V+ +R  R+CK D GG     E  + T  KA + C    G+  F Y++     +      LY +F    NS     VC F+L A   VF+GP +      NS+      PNP PD        Q    +  +  +L+   L   QK +       P+V  P     N   + +    +  +D    +I     Y    ++ S   ++   C +   +L P      I S L   + + + +   D++I+I +  C  + +R  C+      CGWD     C  L D V +++WE+S  K  + N        +WS    C  +D      C C+        S  P+     C G ++EV      G W  W AW+ CS       ++R+R CS+         C+GQ  E + C          ++   P IY                                   W  WS W  CT      +Q R   C   ++CP    + Q+C
Sbjct:  186 PAIYRSLGGLPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEH-----DC-----GRTVF-SRAARVCKNDIGGRFLL-EDTWTTFMKARLNCSR-PGEIPFSYNELQGTFFLPELELLYGIFTTNVNSIAASAVCAFNLSAITQVFSGPFK---YQENSRSAWLPYPNPNPDF-------QCGTIDYGSYVNLTERNLQDAQKFILMHEVIQPIVPVPYFMEDNVRFSHVAVDVVQGKDMLYHIIYLATDYGTIKKVLSPLNQTTGSCLLDEIELFPPRRRQPILSLLILHSRSELFVGVRDQVIKIPLIRCNFHKSREACVGARDPYCGWDLVLKKCVMLEDSVSMSQWEQSITKCPVRNVTVDGHFGLWSSWRPCSHSDGGSVGLCQCR---TRACNSPSPQCGGQQCQGTSVEVANCSRNGAWTPWTAWAPCSTSCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNE--------HLPCPPHIY-----------------------------------WSAWSPWERCTVPCGGGIQSRRRTCENGNECPGCSVEYQSC 690          

HSP 2 Score: 59.3066 bits (142), Expect = 2.289e-8
Identity = 51/166 (30.72%), Postives = 69/166 (41.57%), Query Frame = 3
Query: 2043 TGAIEVGEWNEWGAWSTCSPEKKTKIR--KRECS------SKFSCIGQTEETKICTTVR-------SVWSQWY---ITSNPKIYNSFRSKCSTDDSGPSSTI----EIREMVCE-NTCQENLFKWYKWSKWSDCTSQNVQYRLYNCSEL----SQCPANQTQIQNC 2459
            TG    G W+ W +WS CS +  + IR  KR C+         SC+G  +E + C T         S WS W    +T     Y   R+ CS         I       E +C    C E+   W  WS+WS C S  VQ RL +C  L    +QC  N ++ + C
Sbjct:  770 TGLTVNGGWSAWSSWSQCSRDCSSGIRSRKRTCTNPKPKYGGTSCLGPAQEYQECNTTPCPVDGSWSCWSPWSKCSVTCGGGHYIRTRT-CSNPPPAYGGDICLGLHTEEALCNTQPCPES---WSDWSEWSHCDSAGVQVRLRHCDVLFPTGNQCAGNSSESRAC 931          
BLAST of SMED30025076 vs. Ensembl Sea Lamprey
Match: sema5a (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A [Source:ZFIN;Acc:ZDB-GENE-030131-8969])

HSP 1 Score: 79.7221 bits (195), Expect = 1.752e-15
Identity = 77/372 (20.70%), Postives = 148/372 (39.78%), Query Frame = 3
Query: 1221 LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSLSLNGLYRTQKIV----PVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHT----ESNELCNIGIYKL---VPKENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERS----SCKNI-IDNSV--WSIPSICFVNDSQ--ISLKCIC--KYCTNEI-MCSNKP----KIEITNCTGAIEVGEWNEWGAWSTCSP--EKKTKIRKRECS------SKFSCIGQTEETKICT-----TVRSVWSQW 2213
            LY +F    + P    VC +++   +  FNGP +   +  + +      PNP P+  C+ + +G        + ++L++  L   Q+++    PV          +  ++ T  +I+        ++H  +F      T     +   C I   +L     ++ V  +     D   Y+   T   ++++ +  C  + T + C+      CGWD     CT+L +       +      + +N+ +D ++  WS+   C  +D     S  C+C  + C   +  C+ +P     +++ NC+     G W  W AWS C+       ++R+R CS          C+GQ  E + C       V + WS W
Sbjct:  274 LYGVFTTAGSGPVASAVCVYNMSDVRETFNGPFK---VQESPRTAWLPHPNPNPNFQCDTVPDG--------STANLTVRSLVDAQRLLLMAEPVTPGGGRALLARHGSRFTRLAIDSSARGRGGVVHRMLFEATDEGTVQKVAAASGCVIDEMELPWPAARQRVRALHASPGDGALYV--GTDGAVLKLPLERCSAFRTESTCVGSRDPFCGWDLTLRRCTTLRESSGSGTSDSGGTAWNVRNLTVDGALGPWSVWETCQHSDGGETGSSSCLCRRRACDTPLPQCAGRPCDGATVQVANCS---RNGGWTPWSAWSVCTTTCSMGFQVRQRSCSNPSPRHGGRVCVGQNREERFCNEHTRCPVPATWSPW 629          
BLAST of SMED30025076 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003660.1 (pep scaffold:Pmarinus_7.0:GL476490:248188:267683:1 gene:ENSPMAG00000003345.1 transcript:ENSPMAT00000003660.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 3.814e-12
Identity = 83/396 (20.96%), Postives = 158/396 (39.90%), Query Frame = 3
Query:  762 DQHKTFSVLTKEHIFIGA----FVDNSLLIQRTKLPDILGKIDSIK-DLVTPMANFYFEKNSKFIEK-----FETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAV-----SATWTNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILE-----KNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIV-----PVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHTESNELCNIGI--------YKLVPKENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCT 1850
            D  + ++ L  +  F  A    F+   ++I R      LG   ++K D V+   N      S FI++     F  + +IYF   E  +AK Y  +   +        V+R+ R+CK D GG     +  + T  KA IVC     ++ F   + +     + +W ++  + +F +Q +   G  VC + +   + VF GP +      N    +      +LP+P P  C    + Q   N  +     +L    R   ++     P+   PL   +  + TQ+    +      +     +D+F     +   ++  + G          ++ P+    Q   L+ + N   + S S  ++++ + NC +Y +   CL+     CGWD+   +C+
Sbjct:  141 DPEQGYTALIADGDFYAATTNNFLGTEMVISRN-----LGSRQALKSDYVSTWLNEPIFVGSSFIQESVNSTFGDDDKIYFFFTE--TAKEYEFYSKPI--------VSRIARVCKDDAGGKRILQK-RWTTYLKAQIVCAQPEIQFHFNVIRDIFVLQPADSWEDTVFFGVFTSQWSESAGSAVCSYSIKDAQKVFMGPFKE----FNEATQKWGTHTGSLPSPRPGECITAQHRQAGYNSTLDLPDQTLT-FAREHHLMDELLQPLGARPLFFKRGINYTQLAVVRV------TTAFGDHDVFFLGTGNGRLHKAVSFGKMDTHIIEELQIFPRAEPVQNLLLSKEKNLLYVGSISS-VLQLPLANCSRYRSCLDCLLARDPFCGWDKAAGACS 508          
BLAST of SMED30025076 vs. Ensembl Sea Lamprey
Match: sema5a (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A [Source:ZFIN;Acc:ZDB-GENE-030131-8969])

HSP 1 Score: 60.077 bits (144), Expect = 2.197e-9
Identity = 64/308 (20.78%), Postives = 121/308 (39.29%), Query Frame = 3
Query: 1221 LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNG-QLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPS--SVLIIHYDMFIEIFSHT----ESNELCNIGIYKLVPKENVFQISGLTTDNNAYIL-ISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINR-WER--SSC--KNI-IDN--SVWSIPSICFVNDSQISL--------KCICKYCTNEI-MCSNK----PKIEITNCTGAI 2054
            LY LF    + P    VC +++ +    FNG  +       + ++    PNP P+  C ++S G  ++  E+  A +  L  L  ++ + P+   P+I      ++ +   S+     S      + + +++     T     +   C I   +L+P      I  L  D     L +     ++R+ +  C  + T + CL      CGWD    SC  L +  D  R W +  +SC  +N+ +D     WS    C   D  +          +C  + C + +  C  +    P +++ NC+  +
Sbjct:  218 LYGLFSTSGSGPQASAVCAYNISSIAGAFNGAFKYQEGPRAAWMVH---PNPNPNFQCGRVSEGPNVNLTERSLADAQRL--LLMSEAVAPLGGRPVIAQPEVRLSHVAVHSMAAAAASSSGRTAVQHILYLATERGTVQKVAAATGCVIDEMELLPAVQQQPIRALRVDPGGEALFVGVDGGVLRLPLERCSTHGTESACLRARDPYCGWDGILRSCIRLRENWDARRSWRQDLTSCPVRNLTVDGGPGPWSAWEPCQHWDGDVGGSSAGGSSCQCRRRACDSPVPGCGGRPCPGPSVQVANCSRGL 520          
BLAST of SMED30025076 vs. Ensembl Sea Lamprey
Match: SEMA6A (semaphorin 6A [Source:HGNC Symbol;Acc:HGNC:10738])

HSP 1 Score: 58.5362 bits (140), Expect = 4.847e-9
Identity = 82/346 (23.70%), Postives = 134/346 (38.73%), Query Frame = 3
Query:  924 KNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSAT---WTNSKLYVL--FENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLN--SQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKT-PLINFQNKDITQITAF----------------SINPEDPSSVLIIHYDM--FIEIFSHTESN-----------------ELCNIGIYKLVPKENVFQISGLTTDNNAYIL-ISTSDRIIRIKINNCEKYTT-RAKCLVEAPNICGW 1826
            K   F+   E    +YF   E   A  YSVF          V V+R+ R+CK D GG+    + ++ +  KA + C +  G   F++++  + T     N +  VL  F    NS  G  VC FD+     VF G  +      +  + + E  LP P P  C     G    +E  ++S    + L         +KT PL+      IT+   F                S  P    +VL +  +M   +++ S                      +LCN G      KE+  +I G+  D  ++ L ++ S  ++R+ ++ CE++   R  C+      CGW
Sbjct:  146 KEPHFVHAVEYGEHVYFFFRE--IAVEYSVFG--------KVVVSRVARVCKDDAGGSQRVLDKHWTSFVKARLNCSV-PGDTHFYFNELQALTDIITINGRDVVLGVFTTPANSIPGSAVCAFDMEELLSVFRGRFKEQKSSDSGWTTVPEDKLPKPRPGCCA----GSDFADEYKSSSDFPDDTL-------AFIKTHPLMEDAVGSITEQPWFIRTLVRYRVTRLAVDPSAGPHGRHTVLFLGSEMGLVLKVLSWPPPGPDSPGSLLLEQIDVYNPKLCNRG-----DKEDR-RILGIQLDVESHTLFVAFSACVVRLPLSRCERHARCRKNCIAARDPYCGW 463          
BLAST of SMED30025076 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010795.1 (pep scaffold:Pmarinus_7.0:GL476346:537839:550578:1 gene:ENSPMAG00000009776.1 transcript:ENSPMAT00000010795.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 1.280e-6
Identity = 62/303 (20.46%), Postives = 115/303 (37.95%), Query Frame = 3
Query: 1047 VYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWT---NSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNS-QILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQI---TAFSINPEDPSSVLIIHYDMFIEIFSHTESNELCNIGIYKLVPKENVFQI-----SGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRW----ERSSCKNI 1907
            V V+R+ R+CK D GG T   +  + +  KA + C +      F   + V    T    +  Y +F  +    +   VC + +   +  F G  +              ++P P P  C +   GQ S +      S + +     Q + PV + PL+   N   TQ+   T  S+   D       H  M++   + T    +   G   L+ +  +F       S L  +    + +++S  ++++ + +C  Y T   C++     C WD R+  C    +    + W    ER+    +
Sbjct:  256 VVVSRIARVCKGDMGG-TRMLQRMWTSFQKAQLECSLPERNIHFNLIQDVFTLRTAPGQTTFYAVFIVEVGGTNVSAVCAYSMDDVRQTFQGRFKEQKGPDQRWATFTGDIPEPRPGSCLR---GQSSLDLPDRTVSFARDHPLVDQTVEPVGQRPLLVAANARYTQLAVQTVRSLGGAD-------HRVMYMATDAGTLHKAININGDMHLIEEMQLFSEPQSINSLLLLETKGLLYVASSSSVLQVPVADCGAYATCGDCVLARDPHCAWDARSERCRDTQEAEPASAWIQDIERADASGL 547          
BLAST of SMED30025076 vs. Ensembl Nematostella
Match: EDO48914 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHU3])

HSP 1 Score: 75.8702 bits (185), Expect = 5.444e-14
Identity = 109/530 (20.57%), Postives = 198/530 (37.36%), Query Frame = 3
Query: 1119 FGTIAKADIVCPIGTGKYEFFYS--KAVSATWTNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVP--VVKTPLIN---FQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHTESNELCN-IG-----IYKLVPKEN-----VFQISGLTTDNNA--------------YILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERSSCKNIIDN---SVWSIPSICFVNDSQISLKC---ICKYCTNEIMCSNKPKIEITNCT---------------GAIEVGEWNEWGAWSTCSPEKKT--KIRKREC------SSKFSCIGQTEETKICTTVRSVWSQWY--------ITSNPKIYNSFRSKCSTDD-SGPSSTIEIREM----------VCENTCQENLFKWYKWSKWSDCTSQNVQYRLYNCSELSQ-CPANQTQIQNCEL 2465
            F T  KA + C   TG+Y  +Y   + V         Y +F  Q N   G  +C + L     VFNG  +    Y + +  E ++           +N     N  V  +S         +K+VP  ++ TPL     F +    Q+ A ++ P   ++  IIH   F  +  H  +N L   +G     + KL   E      V +   L+T   +               + ++T  +++++++  C ++T R  C+      CGW +   +CT   D      WE+   +  +     S WS   +C   D+ +  +C   +C++  +   C  + + ++  CT               G I  G W  W AWS CS  + +  ++R R C      +    C+G +EE   C+    +  +          +     +    R  C     S  + T+E+ +           +C    +  +  W  WS W+ C    +Q R   CS+  + C     +++ C++
Sbjct:  275 FVTFNKARLNCST-TGEYPAYYDLIQDVFLDSNRGVFYAVFTTQPNGVAGSAICAYSLDEINRVFNGDYK----YGDDKTGEWSVQ----------TNEHHFANCTVKNTSHVPISPEWKRKLVPEGMMSTPLFTKPAFDDSKRYQLMAEAVQPATQAAHYIIHGTRFSSVAVHVINNALVTYVGTESGSVLKLFTPEGHESACVIEEIRLSTQKGSSEPVTSLRLDVAMNAVYVATQSKLVKLRLARCSQHTDRRSCMDAHDPYCGWKKEASACTPW-DSSSKGSWEQELNRCPVAKAKWSSWSAWGVCTQPDNNV-CQCRTRVCRHACDPSECRGE-QAQLKECTVDKSSWADEATWLREGVIH-GGWTNWAAWSQCSVTQGSGFRVRTRACVNPPPRNGGRKCLGNSEEVDSCSVTVPLEEKRLDLTSELLGVVGKDDMAMRHRYTCKVKGYSLQNMTLELTKTESIDCMYNAEICNLPTEAPVGVWALWSVWTKCRFVGMQRRERVCSDTDKPCQGLDHEVRECQV 785          
BLAST of SMED30025076 vs. Ensembl Medaka
Match: sema5ba (semaphorin 5B [Source:NCBI gene;Acc:101159709])

HSP 1 Score: 112.849 bits (281), Expect = 6.533e-25
Identity = 143/612 (23.37%), Postives = 245/612 (40.03%), Query Frame = 3
Query:  765 QHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSLS-------LNGLYRTQKIVPVVKTPLINFQN--KDITQI--TAFSINPEDPSSVLIIHYDMFIEIFSHTESN-ELCNIGIYKLVP---KENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERS----SCKNIIDN---SVWSIPSICFVNDSQISL-KCICKYCTNEIMCSNKPKIEITNCTG-AIEV------GEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQ---NVQYRLYNCSELSQCPANQTQIQNCEL 2465
            +H + SV+T+   ++    +D S      + P I   +  +  L T   N  +     FI  +E     +F + E     +    DC      + VY +R+ R+CK D GG     E  + T  KA + C   +G+  F+Y++  S  +   +  +Y +F    NS     VC F+L A    FNGP RS     N +      PNP+ D  C  +S+     NE +T  SL        +N + + + + P+V    + F N   DI Q   T + +        +   Y   ++  +    N + C +   +L+P   +E +  +  L +D + ++ +S  DR+++I +  C  Y T + CL      CGWD R   CT+L D  ++++W+++      +N   N     W+    C  +D    +  C+C+  + +   S  P+    NC G  IEV      G W  W +W  CS    T  ++R+R C++         C+G + + + C                                        E V    C + +F W  WS W+ C++     V  R+  C   + CP    + + C L
Sbjct:  185 RHNSTSVVTESGELYAATVIDFS-----GRDPVIYRSLGGMPPLRTAQYNSKWLNEPHFISAYEIGLFTFFFLRE-----NAVEHDC-----GKTVY-SRVARVCKNDIGGRFLL-EDTWTTFMKARLNCSR-SGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAFNLSAITQAFNGPFRS---QENPRSTWLPTPNPIRDFQCGTISD--HGPNEGLTERSLQDAQRLYLMNDVVQPESVDPLVMQDDVRFSNLVVDIVQGMDTLYHV------MYISTEYGTILKALATPNKNLQGCYLEEMELLPPGVQEPILSLQILHSDRSLFVGLS--DRVMKIPLERCGTYKTESMCLEARDPYCGWDFRKRRCTTLEDSSNMSQWKQNITICPLRNQTTNGGFGPWAQWQPCNNDDPVDGVSSCLCRSRSCD---SPLPRCGGKNCVGTTIEVSNCSRNGGWTPWSSWGQCSTTCGTGFELRQRSCNNPSPRHGGRVCVGPSRDERFCN---------------------------------------EGV---PCPQPIF-WTPWSSWTKCSTACGGGVHSRVRTCENGNSCPGCALEYKACNL 719          
BLAST of SMED30025076 vs. Ensembl Medaka
Match: sema5ba (semaphorin 5B [Source:NCBI gene;Acc:101159709])

HSP 1 Score: 112.849 bits (281), Expect = 6.779e-25
Identity = 143/612 (23.37%), Postives = 245/612 (40.03%), Query Frame = 3
Query:  765 QHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSLS-------LNGLYRTQKIVPVVKTPLINFQN--KDITQI--TAFSINPEDPSSVLIIHYDMFIEIFSHTESN-ELCNIGIYKLVP---KENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERS----SCKNIIDN---SVWSIPSICFVNDSQISL-KCICKYCTNEIMCSNKPKIEITNCTG-AIEV------GEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQ---NVQYRLYNCSELSQCPANQTQIQNCEL 2465
            +H + SV+T+   ++    +D S      + P I   +  +  L T   N  +     FI  +E     +F + E     +    DC      + VY +R+ R+CK D GG     E  + T  KA + C   +G+  F+Y++  S  +   +  +Y +F    NS     VC F+L A    FNGP RS     N +      PNP+ D  C  +S+     NE +T  SL        +N + + + + P+V    + F N   DI Q   T + +        +   Y   ++  +    N + C +   +L+P   +E +  +  L +D + ++ +S  DR+++I +  C  Y T + CL      CGWD R   CT+L D  ++++W+++      +N   N     W+    C  +D    +  C+C+  + +   S  P+    NC G  IEV      G W  W +W  CS    T  ++R+R C++         C+G + + + C                                        E V    C + +F W  WS W+ C++     V  R+  C   + CP    + + C L
Sbjct:  185 RHNSTSVVTESGELYAATVIDFS-----GRDPVIYRSLGGMPPLRTAQYNSKWLNEPHFISAYEIGLFTFFFLRE-----NAVEHDC-----GKTVY-SRVARVCKNDIGGRFLL-EDTWTTFMKARLNCSR-SGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAFNLSAITQAFNGPFRS---QENPRSTWLPTPNPIRDFQCGTISD--HGPNEGLTERSLQDAQRLYLMNDVVQPESVDPLVMQDDVRFSNLVVDIVQGMDTLYHV------MYISTEYGTILKALATPNKNLQGCYLEEMELLPPGVQEPILSLQILHSDRSLFVGLS--DRVMKIPLERCGTYKTESMCLEARDPYCGWDFRKRRCTTLEDSSNMSQWKQNITICPLRNQTTNGGFGPWAQWQPCNNDDPVDGVSSCLCRSRSCD---SPLPRCGGKNCVGTTIEVSNCSRNGGWTPWSSWGQCSTTCGTGFELRQRSCNNPSPRHGGRVCVGPSRDERFCN---------------------------------------EGV---PCPQPIF-WTPWSSWTKCSTACGGGVHSRVRTCENGNSCPGCALEYKACNL 719          
BLAST of SMED30025076 vs. Ensembl Medaka
Match: sema5ba (semaphorin 5B [Source:NCBI gene;Acc:101159709])

HSP 1 Score: 112.849 bits (281), Expect = 7.502e-25
Identity = 143/612 (23.37%), Postives = 245/612 (40.03%), Query Frame = 3
Query:  765 QHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSLS-------LNGLYRTQKIVPVVKTPLINFQN--KDITQI--TAFSINPEDPSSVLIIHYDMFIEIFSHTESN-ELCNIGIYKLVP---KENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERS----SCKNIIDN---SVWSIPSICFVNDSQISL-KCICKYCTNEIMCSNKPKIEITNCTG-AIEV------GEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQ---NVQYRLYNCSELSQCPANQTQIQNCEL 2465
            +H + SV+T+   ++    +D S      + P I   +  +  L T   N  +     FI  +E     +F + E     +    DC      + VY +R+ R+CK D GG     E  + T  KA + C   +G+  F+Y++  S  +   +  +Y +F    NS     VC F+L A    FNGP RS     N +      PNP+ D  C  +S+     NE +T  SL        +N + + + + P+V    + F N   DI Q   T + +        +   Y   ++  +    N + C +   +L+P   +E +  +  L +D + ++ +S  DR+++I +  C  Y T + CL      CGWD R   CT+L D  ++++W+++      +N   N     W+    C  +D    +  C+C+  + +   S  P+    NC G  IEV      G W  W +W  CS    T  ++R+R C++         C+G + + + C                                        E V    C + +F W  WS W+ C++     V  R+  C   + CP    + + C L
Sbjct:  185 RHNSTSVVTESGELYAATVIDFS-----GRDPVIYRSLGGMPPLRTAQYNSKWLNEPHFISAYEIGLFTFFFLRE-----NAVEHDC-----GKTVY-SRVARVCKNDIGGRFLL-EDTWTTFMKARLNCSR-SGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAFNLSAITQAFNGPFRS---QENPRSTWLPTPNPIRDFQCGTISD--HGPNEGLTERSLQDAQRLYLMNDVVQPESVDPLVMQDDVRFSNLVVDIVQGMDTLYHV------MYISTEYGTILKALATPNKNLQGCYLEEMELLPPGVQEPILSLQILHSDRSLFVGLS--DRVMKIPLERCGTYKTESMCLEARDPYCGWDFRKRRCTTLEDSSNMSQWKQNITICPLRNQTTNGGFGPWAQWQPCNNDDPVDGVSSCLCRSRSCD---SPLPRCGGKNCVGTTIEVSNCSRNGGWTPWSSWGQCSTTCGTGFELRQRSCNNPSPRHGGRVCVGPSRDERFCN---------------------------------------EGV---PCPQPIF-WTPWSSWTKCSTACGGGVHSRVRTCENGNSCPGCALEYKACNL 719          
BLAST of SMED30025076 vs. Ensembl Medaka
Match: sema5ba (semaphorin 5B [Source:NCBI gene;Acc:101159709])

HSP 1 Score: 111.694 bits (278), Expect = 1.597e-24
Identity = 144/613 (23.49%), Postives = 245/613 (39.97%), Query Frame = 3
Query:  765 QHKTFSVLTKE-HIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSLS-------LNGLYRTQKIVPVVKTPLINFQN--KDITQI--TAFSINPEDPSSVLIIHYDMFIEIFSHTESN-ELCNIGIYKLVP---KENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER--SSC---KNIIDN---SVWSIPSICFVNDSQISL-KCICKYCTNEIMCSNKPKIEITNCTG-AIEV------GEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQ---NVQYRLYNCSELSQCPANQTQIQNCEL 2465
            +H + SV+T+   ++    +D S      + P I   +  +  L T   N  +     FI  +E     +F + E     +    DC      + VY +R+ R+CK D GG     E  + T  KA + C   +G+  F+Y++  S  +   +  +Y +F    NS     VC F+L A    FNGP RS     N +      PNP+ D  C  +S+     NE +T  SL        +N + + + + P+V    + F N   DI Q   T + +        +   Y   ++  +    N + C +   +L+P   +E +  +  L +D +  + +  SDR+++I +  C  Y T + CL      CGWD R   CT+L D  ++++W++  + C   +N   N     W+    C  +D    +  C+C+  + +   S  P+    NC G  IEV      G W  W +W  CS    T  ++R+R C++         C+G + + + C                                        E V    C + +F W  WS W+ C++     V  R+  C   + CP    + + C L
Sbjct:  144 RHNSTSVVTESGELYAATVIDFS-----GRDPVIYRSLGGMPPLRTAQYNSKWLNEPHFISAYEIGLFTFFFLRE-----NAVEHDC-----GKTVY-SRVARVCKNDIGGRFLL-EDTWTTFMKARLNCSR-SGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAFNLSAITQAFNGPFRS---QENPRSTWLPTPNPIRDFQCGTISD--HGPNEGLTERSLQDAQRLYLMNDVVQPESVDPLVMQDDVRFSNLVVDIVQGMDTLYHV------MYISTEYGTILKALATPNKNLQGCYLEEMELLPPGVQEPILSLQILHSDRS--LFVGLSDRVMKIPLERCGTYKTESMCLEARDPYCGWDFRKRRCTTLEDSSNMSQWKQNITICPVRQNQTTNGGFGPWAQWQPCNNDDPVDGVSSCLCRSRSCD---SPLPRCGGKNCVGTTIEVSNCSRNGGWTPWSSWGQCSTTCGTGFELRQRSCNNPSPRHGGRVCVGPSRDERFCN---------------------------------------EGV---PCPQPIF-WTPWSSWTKCSTACGGGVHSRVRTCENGNSCPGCALEYKACNL 679          
BLAST of SMED30025076 vs. Ensembl Medaka
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:101171867])

HSP 1 Score: 108.612 bits (270), Expect = 1.451e-23
Identity = 148/651 (22.73%), Postives = 240/651 (36.87%), Query Frame = 3
Query:  648 VLLNSNNYNVALTNCM--ILKNKAVT--TDVKWQKYGYTS---NSDQHKTFSVLTKEHIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSK--LYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDV-CEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPV----VKTPLINFQNKDITQITAFSINPEDPSSVLI------IHYDMFIEIFSH-TESNELCNIGIYKLVPKENVFQI-SGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERSSCKNIIDN-------SVWSIPSICFVNDSQISLKCIC--KYCTNEI-MCSNKP----KIEITNCTGAIEVGEWNEWGAWSTCSPEKKT--KIRKRECSSKFS------CIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCT---SQNVQYRLYNCSELSQCPANQTQIQNC 2459
            +L+N N      TN    I  N+ +T  T++  Q  G      N   + T  + +   ++    +D S      + P I   +  +  L T   N  +     F+  ++  +  YF   E          DC      R V+ +R+ R+CK D GG     E  + T  KA + C    G+  F Y++     +      LY +F    NS     VC F+L A   VFNGP +      NS+      PNP PD  C  +++G        T  +L+   L   QK + +         + +  +D  + T  +++      +L+        Y    ++ S   +S   C +   +L P      I S L   + + + +   D++I+I +  C  + TR  C+      CGWD     CT+L + V +++WE+S  K  + N         WS  S C  ND   +  C+C  + C N    C  +       E+ NC+     G W  W +WS CS       ++R+R CS+         C+GQ  E + C          ++   P +Y                                   W  WS W  C       +Q R   C   + CP    + Q+C
Sbjct:   71 LLVNGNRLFTCGTNAFTPICTNRTLTNLTEIHDQISGMARCPYNPLHNSTALITSSGELYAATAMDFS-----GRDPAIYRSLGGLPPLRTAQYNSKWLNEPNFVSSYDIANFTYFFFRENAVEH-----DC-----GRTVF-SRVGRVCKNDIGGRFLL-EDTWTTFMKARMNCSR-PGEIPFNYNELQGTFYLPELELLYGIFTTNVNSIAASAVCAFNLSAISQVFNGPFK---YQENSRSAWLPYPNPNPDFKCGTINSG--------TYVNLTQRNLQDAQKFLLMHDVVQPVVPVPYFMEDNVRFTHVAVDVVQGKDMLLHIIYLATDYGTIRKVLSPLNQSTGSCLLEEIELFPPRKRQPIRSLLILHSRSELYVGVRDQVIKIPLKRCSYHKTREACVGARDPYCGWDLLLKKCTTLEESVRMSQWEQSITKCPVRNVTVDGGFGAWSGWSTCSHNDGGSAGSCLCRTRACDNPAPQCGGQTCFGISAEVANCS---RNGAWTPWTSWSPCSTSCGIGFQVRQRSCSNPSPRHGGRVCVGQNREERYCNE--------HLPCPPHVY-----------------------------------WSAWSAWDRCNVPCGGGIQSRRRTCENGNDCPGCGQEYQSC 646          
BLAST of SMED30025076 vs. Planmine SMEST
Match: SMESG000010166.1 (SMESG000010166.1)

HSP 1 Score: 1657.88 bits (4292), Expect = 0.000e+0
Identity = 859/867 (99.08%), Postives = 863/867 (99.54%), Query Frame = 3
Query:  240 MNHXXXXXXXXXXXXXMNFICHFQFVISSKNVYHIQTHQQQLIEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCEERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTNCMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKEHIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHTESNELCNIGIYKLVPKENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERSSCKNIIDNSVWSIPSICFVNDSQISLKCICKYCTNEIMCSNKPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKTKIRKRECSSKFSCIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQNVQYRLYNCSELSQCPANQTQIQNCELVXXXXXXXXXXXSYGTLHIWLAILTSSXXXXXXXXXXXXXXXXXXXXXXXXXXXVPRTLYRDRPMFMKRQFSETSNDYISSDIKSTNYDLDYMPFSHNENLPSTSKNIASQIPLVTEQNAFMASI 2840
            MNHISKLKLISYLILIMNFICHFQFVISSKNVYHIQTHQQQLIEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCEERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTNCMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKEHIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGK EFFYSKAVSATWTNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHTESNELCNIG YKLVPKENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERSSCKNIIDNSVWSIPSICFVNDSQISLKCICKYCTNEIMCSNKPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKTKIRKRECSSKFSCIGQTEETKICTTVRSVWSQWY TSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQNVQYRLYNCS+LSQCPANQTQIQNCELVKTKKNKTNNENSYGTL+IWLAILTSSIIWVFI+IIIMLFKLKL+TNQKTKTSKVPRTLYRDR MFMKRQFSETSNDYISSDIKSTNYDLDYMPFSHNENLPSTSKNIASQIPLVTEQNAFMASI
Sbjct:    1 MNHISKLKLISYLILIMNFICHFQFVISSKNVYHIQTHQQQLIEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCEERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTNCMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKEHIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKDEFFYSKAVSATWTNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHTESNELCNIGTYKLVPKENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERSSCKNIIDNSVWSIPSICFVNDSQISLKCICKYCTNEIMCSNKPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKTKIRKRECSSKFSCIGQTEETKICTTVRSVWSQWYTTSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQNVQYRLYNCSKLSQCPANQTQIQNCELVKTKKNKTNNENSYGTLYIWLAILTSSIIWVFIIIIIMLFKLKLSTNQKTKTSKVPRTLYRDRLMFMKRQFSETSNDYISSDIKSTNYDLDYMPFSHNENLPSTSKNIASQIPLVTEQNAFMASI 867          
BLAST of SMED30025076 vs. Planmine SMEST
Match: SMESG000010166.1 (SMESG000010166.1)

HSP 1 Score: 1654.03 bits (4282), Expect = 0.000e+0
Identity = 843/851 (99.06%), Postives = 847/851 (99.53%), Query Frame = 3
Query:  288 MNFICHFQFVISSKNVYHIQTHQQQLIEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCEERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTNCMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKEHIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKYEFFYSKAVSATWTNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHTESNELCNIGIYKLVPKENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERSSCKNIIDNSVWSIPSICFVNDSQISLKCICKYCTNEIMCSNKPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKTKIRKRECSSKFSCIGQTEETKICTTVRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQNVQYRLYNCSELSQCPANQTQIQNCELVXXXXXXXXXXXSYGTLHIWLAILTSSXXXXXXXXXXXXXXXXXXXXXXXXXXXVPRTLYRDRPMFMKRQFSETSNDYISSDIKSTNYDLDYMPFSHNENLPSTSKNIASQIPLVTEQNAFMASI 2840
            MNFICHFQFVISSKNVYHIQTHQQQLIEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCEERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTNCMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKEHIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGK EFFYSKAVSATWTNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHTESNELCNIG YKLVPKENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERSSCKNIIDNSVWSIPSICFVNDSQISLKCICKYCTNEIMCSNKPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKTKIRKRECSSKFSCIGQTEETKICTTVRSVWSQWY TSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQNVQYRLYNCS+LSQCPANQTQIQNCELVKTKKNKTNNENSYGTL+IWLAILTSSIIWVFI+IIIMLFKLKL+TNQKTKTSKVPRTLYRDR MFMKRQFSETSNDYISSDIKSTNYDLDYMPFSHNENLPSTSKNIASQIPLVTEQNAFMASI
Sbjct:    1 MNFICHFQFVISSKNVYHIQTHQQQLIEFKGEAMSVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCEERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTNCMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKEHIFIGAFVDNSLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCPIGTGKDEFFYSKAVSATWTNSKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHTESNELCNIGTYKLVPKENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWERSSCKNIIDNSVWSIPSICFVNDSQISLKCICKYCTNEIMCSNKPKIEITNCTGAIEVGEWNEWGAWSTCSPEKKTKIRKRECSSKFSCIGQTEETKICTTVRSVWSQWYTTSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENLFKWYKWSKWSDCTSQNVQYRLYNCSKLSQCPANQTQIQNCELVKTKKNKTNNENSYGTLYIWLAILTSSIIWVFIIIIIMLFKLKLSTNQKTKTSKVPRTLYRDRLMFMKRQFSETSNDYISSDIKSTNYDLDYMPFSHNENLPSTSKNIASQIPLVTEQNAFMASI 851          
BLAST of SMED30025076 vs. Planmine SMEST
Match: SMESG000033853.1 (SMESG000033853.1)

HSP 1 Score: 96.2857 bits (238), Expect = 6.177e-20
Identity = 167/750 (22.27%), Postives = 294/750 (39.20%), Query Frame = 3
Query:  363 LIEFKGEAMSVMSFTHNSFKDFTQFYIIN--NYNHQS-------LYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCEERIFINHLSEIQVLDSKMLWFCY-VLLNSNNYNVALTNCMILKNKAVTTD--VKWQKYGYTSNSDQHKTFSVLTKEHIFIGAFVDN--SLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCP-IGTGKY--EFFYSKAVSATWTN--SKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHTESNELCNIGIYKLVPK----------ENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSL----------------------NDKVDINRWERSSCKNIIDNSVWSIPSICFVND-SQISL-KCICKYCT--NEIMCSNKPKIEITNCTGAIEVGEWNEWGAWSTCSPE--KKTKIRKREC------SSKFSCIGQTEETKICT----------TVRSVWSQWYITSNPKIYNSF----RSKCSTDDSGPSSTIEIREM---VCENTCQENLFKWY-KWSKWS 2369
            LI      +++ SF H  F++  Q+ + +  N+ H S       +YVVS  N I+ + L+ +   + YT+         CE +I I+ +   +  DSK+LW C+  +L SN   +    C  LK + + +D   +W    + S+  +H+T    T ++ + G ++ +   L+I +  L      + ++  +  P +    +     I  F+    +YF+  E       + F C    EN  V VTRLIR+C+ D+G  ++     F    K ++ C  + + +    F Y  A +  W +   +L V F +         +C + + + +  FN  ++      + +       N   ++C+  + G    N         L  L    K  P+ +  + +      T+   F I  E+ S       ++ + +F  T++  + ++    L PK          EN+  +  +   +  Y+ + TS RI++I ++ C    T  +C   AP  C WD  T  C  +                      N    +N+W +   K+I             VND SQI + KC  +  T  NEI  +  P+ ++         G+W  + +WS CS      T++R R C      +    C G   E +IC             R  +SQW   S       F    RS+    +    S  EI+     +CE       FK Y +WS WS
Sbjct:   24 LINLHYPVLNMTSFIH--FQNLHQYAMADYGNFKHLSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKK-QCTSEQCE-KIIIDVVQFAK--DSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRS--VIKAPGDIITSFQHNKSVYFLYTE-------TDFLC-GCKEN--VLVTRLIRLCENDKGLTSEQ----FSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKF------NEYKNICQLFTTGNQDSN--------FLTNLQTLCKTYPLHRDIVTSQAILYETRTKFFEIASEESS----WSNNLRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQC--SAP-FCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSI-------------VNDLSQIGMCKCNIERNTDLNEIKLTISPECKVD--------GDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCE-------FKIYSQWSSWS 702          
BLAST of SMED30025076 vs. Planmine SMEST
Match: SMESG000033853.1 (SMESG000033853.1)

HSP 1 Score: 93.5893 bits (231), Expect = 4.130e-19
Identity = 163/723 (22.54%), Postives = 284/723 (39.28%), Query Frame = 3
Query:  417 FKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCEERIFINHLSEIQVLDSKMLWFCY-VLLNSNNYNVALTNCMILKNKAVTTD--VKWQKYGYTSNSDQHKTFSVLTKEHIFIGAFVDN--SLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCP-IGTGKY--EFFYSKAVSATWTN--SKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHTESNELCNIGIYKLVPK----------ENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSC--------------------TSL--NDKVDINRWERSSCKNIIDNSVWSIPSICFVND-SQISL-KCICKYCT--NEIMCSNKPKIEITNCTGAIEVGEWNEWGAWSTCSPE--KKTKIRKREC------SSKFSCIGQTEETKICT----------TVRSVWSQWYITSNPKIYNSF----RSKCSTDDSGPSSTIEIREM---VCENTCQENLFKWY-KWSKWS 2369
            + +F     I N +H  +YVVS  N I+ + L+ +   + YT+         CE +I I+ +   +  DSK+LW C+  +L SN   +    C  LK + + +D   +W    + S+  +H+T    T ++ + G ++ +   L+I +  L      + ++  +  P +    +     I  F+    +YF+  E       + F C    EN  V VTRLIR+C+ D+G  ++     F    K ++ C  + + +    F Y  A +  W +   +L V F +         +C + + + +  FN  ++      + +       N   ++C+  + G    N         L  L    K  P+ +  + +      T+   F I  E+ S       ++ + +F  T++  + ++    L PK          EN+  +  +   +  Y+ + TS RI++I ++ C    T  +C   AP  C WD  T  C                    +SL  N    +N+W +   K+I             VND SQI + KC  +  T  NEI  +  P+ ++         G+W  + +WS CS      T++R R C      +    C G   E +IC             R  +SQW   S       F    RS+    +    S  EI+     +CE       FK Y +WS WS
Sbjct:   18 YGNFKHLSYIPNSDH--IYVVSNENEIVRLKLNNLNFDSKYTLKK-QCTSEQCE-KIIIDVVQFAK--DSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRS--VIKAPGDIITSFQHNKSVYFLYTE-------TDFLC-GCKEN--VLVTRLIRLCENDKGLTSEQ----FSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKF------NEYKNICQLFTTGNQDSN--------FLTNLQTLCKTYPLHRDIVTSQAILYETRTKFFEIASEESS----WSNNLRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQC--SAP-FCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSI-------------VNDLSQIGMCKCNIERNTDLNEIKLTISPECKVD--------GDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCE-------FKIYSQWSSWS 669          
BLAST of SMED30025076 vs. Planmine SMEST
Match: SMESG000033853.1 (SMESG000033853.1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.937e-19
Identity = 163/723 (22.54%), Postives = 284/723 (39.28%), Query Frame = 3
Query:  417 FKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNYTIIACSLMMMPCEERIFINHLSEIQVLDSKMLWFCY-VLLNSNNYNVALTNCMILKNKAVTTD--VKWQKYGYTSNSDQHKTFSVLTKEHIFIGAFVDN--SLLIQRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEPVSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKADIVCP-IGTGKY--EFFYSKAVSATWTN--SKLYVLFENQKNSPHGKVVCYFDLYAFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTASSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIHYDMFIEIFSHTESNELCNIGIYKLVPK----------ENVFQISGLTTDNNAYILISTSDRIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSC--------------------TSL--NDKVDINRWERSSCKNIIDNSVWSIPSICFVND-SQISL-KCICKYCT--NEIMCSNKPKIEITNCTGAIEVGEWNEWGAWSTCSPE--KKTKIRKREC------SSKFSCIGQTEETKICT----------TVRSVWSQWYITSNPKIYNSF----RSKCSTDDSGPSSTIEIREM---VCENTCQENLFKWY-KWSKWS 2369
            + +F     I N +H  +YVVS  N I+ + L+ +   + YT+         CE +I I+ +   +  DSK+LW C+  +L SN   +    C  LK + + +D   +W    + S+  +H+T    T ++ + G ++ +   L+I +  L      + ++  +  P +    +     I  F+    +YF+  E       + F C    EN  V VTRLIR+C+ D+G  ++     F    K ++ C  + + +    F Y  A +  W +   +L V F +         +C + + + +  FN  ++      + +       N   ++C+  + G    N         L  L    K  P+ +  + +      T+   F I  E+ S       ++ + +F  T++  + ++    L PK          EN+  +  +   +  Y+ + TS RI++I ++ C    T  +C   AP  C WD  T  C                    +SL  N    +N+W +   K+I             VND SQI + KC  +  T  NEI  +  P+ ++         G+W  + +WS CS      T++R R C      +    C G   E +IC             R  +SQW   S       F    RS+    +    S  EI+     +CE       FK Y +WS WS
Sbjct:    4 YGNFKHLSYIPNSDH--IYVVSNENEIVRLKLNNLNFDSKYTLKK-QCTSEQCE-KIIIDVVQFAK--DSKILWICFNYMLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDLEHRTVHSATSDYTYAGLYMKSYKELMIFKNPLVFTHDNLSNVNKINLPRS--VIKAPGDIITSFQHNKSVYFLYTE-------TDFLC-GCKEN--VLVTRLIRLCENDKGLTSEQ----FSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSELKKSSEKTSYKF------NEYKNICQLFTTGNQDSN--------FLTNLQTLCKTYPLHRDIVTSQAILYETRTKFFEIASEESS----WSNNLRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETDKIYLFVGTSHRIVKIPLDMCYLQATDTQC--SAP-FCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSI-------------VNDLSQIGMCKCNIERNTDLNEIKLTISPECKVD--------GDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQICVNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKSCNLPLCE-------FKIYSQWSSWS 655          
The following BLAST results are available for this feature:
BLAST of SMED30025076 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEMA5B7.587e-2521.72semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737][more]
SEMA5B7.755e-2521.72semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737][more]
SEMA5B7.755e-2521.72semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737][more]
SEMA5B8.253e-2521.72semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737][more]
SEMA5B1.039e-2421.72semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737][more]
back to top
BLAST of SMED30025076 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smp-11.807e-1024.86Semaphorin-1A [Source:UniProtKB/Swiss-Prot;Acc:Q1... [more]
C36B7.51.906e-726.26pep chromosome:WBcel235:X:7089228:7096449:-1 gene:... [more]
C36B7.51.966e-726.26pep chromosome:WBcel235:X:7089228:7096449:-1 gene:... [more]
adt-18.786e-626.09A disintegrin and metalloproteinase with thrombosp... [more]
adt-28.990e-627.07A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of SMED30025076 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sema5c1.085e-1621.67gene:FBgn0284221 transcript:FBtr0076052[more]
Sema5c1.122e-1621.67gene:FBgn0284221 transcript:FBtr0300339[more]
Sema1b6.858e-923.28gene:FBgn0016059 transcript:FBtr0086891[more]
Sema1b6.858e-923.28gene:FBgn0016059 transcript:FBtr0302161[more]
Sema1b6.858e-923.28gene:FBgn0016059 transcript:FBtr0086890[more]
back to top
BLAST of SMED30025076 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema5ba1.057e-2723.94sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5ba1.272e-2723.94sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5ba1.272e-2723.94sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5ba1.272e-2723.94sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5ba3.211e-2723.94sema domain, seven thrombospondin repeats (type 1 ... [more]
back to top
BLAST of SMED30025076 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEMA3E2.655e-722.80semaphorin 3E [Source:NCBI gene;Acc:100494277][more]
SEMA3E2.659e-721.90semaphorin 3E [Source:NCBI gene;Acc:100494277][more]
SEMA3E2.881e-722.80semaphorin 3E [Source:NCBI gene;Acc:100494277][more]
SEMA3E3.977e-722.80semaphorin 3E [Source:NCBI gene;Acc:100494277][more]
SEMA3E4.174e-722.42semaphorin 3E [Source:NCBI gene;Acc:100494277][more]
back to top
BLAST of SMED30025076 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sema5b5.293e-2621.14sema domain, seven thrombospondin repeats (type 1 ... [more]
Sema5b8.661e-2621.78sema domain, seven thrombospondin repeats (type 1 ... [more]
Sema5a7.206e-2323.59sema domain, seven thrombospondin repeats (type 1 ... [more]
Sema4c2.844e-722.95sema domain, immunoglobulin domain (Ig), transmemb... [more]
Sema4c2.844e-722.95sema domain, immunoglobulin domain (Ig), transmemb... [more]
back to top
BLAST of SMED30025076 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60519|SEM5B_MOUSE3.702e-2521.14Semaphorin-5B OS=Mus musculus OX=10090 GN=Sema5b P... [more]
sp|Q9P283|SEM5B_HUMAN3.724e-2421.72Semaphorin-5B OS=Homo sapiens OX=9606 GN=SEMA5B PE... [more]
sp|D3ZTD8|SEM5A_RAT3.265e-2323.63Semaphorin-5A OS=Rattus norvegicus OX=10116 GN=Sem... [more]
sp|Q62217|SEM5A_MOUSE6.044e-2223.59Semaphorin-5A OS=Mus musculus OX=10090 GN=Sema5a P... [more]
sp|Q13591|SEM5A_HUMAN3.693e-2123.13Semaphorin-5A OS=Homo sapiens OX=9606 GN=SEMA5A PE... [more]
back to top
BLAST of SMED30025076 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3T5N22.045e-3722.81Sema domain-containing protein OS=Rodentolepis nan... [more]
A0A3P6HSD03.193e-3522.07Sema domain-containing protein OS=Mesocestoides co... [more]
A0A0V0JC178.795e-3528.14Sema domain-containing protein (Fragment) OS=Schis... [more]
A0A564XUM62.265e-3422.35Sema domain-containing protein OS=Hymenolepis dimi... [more]
A0A564XVS55.824e-3422.35Sema domain-containing protein OS=Hymenolepis dimi... [more]
back to top
BLAST of SMED30025076 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema5ba8.313e-3023.61sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5ba1.595e-2923.61sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5ba1.635e-2923.61sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5bb7.694e-2524.42sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5a3.749e-2222.82semaphorin 5A [Source:NCBI gene;Acc:103027847][more]
back to top
BLAST of SMED30025076 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema5a1.752e-1520.70sema domain, seven thrombospondin repeats (type 1 ... [more]
ENSPMAT00000003660.13.814e-1220.96pep scaffold:Pmarinus_7.0:GL476490:248188:267683:1... [more]
sema5a2.197e-920.78sema domain, seven thrombospondin repeats (type 1 ... [more]
SEMA6A4.847e-923.70semaphorin 6A [Source:HGNC Symbol;Acc:HGNC:10738][more]
ENSPMAT00000010795.11.280e-620.46pep scaffold:Pmarinus_7.0:GL476346:537839:550578:1... [more]
back to top
BLAST of SMED30025076 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025076 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO489145.444e-1420.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30025076 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema5ba6.533e-2523.37semaphorin 5B [Source:NCBI gene;Acc:101159709][more]
sema5ba6.779e-2523.37semaphorin 5B [Source:NCBI gene;Acc:101159709][more]
sema5ba7.502e-2523.37semaphorin 5B [Source:NCBI gene;Acc:101159709][more]
sema5ba1.597e-2423.49semaphorin 5B [Source:NCBI gene;Acc:101159709][more]
sema5a1.451e-2322.73semaphorin 5A [Source:NCBI gene;Acc:101171867][more]
back to top
BLAST of SMED30025076 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010166.10.000e+099.08SMESG000010166.1[more]
SMESG000010166.10.000e+099.06SMESG000010166.1[more]
SMESG000033853.16.177e-2022.27SMESG000033853.1[more]
SMESG000033853.14.130e-1922.54SMESG000033853.1[more]
SMESG000033853.14.937e-1922.54SMESG000033853.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025076 ID=SMED30025076|Name=SMED30025076|organism=Schmidtea mediterranea sexual|type=transcript|length=2947bp
TAAAATACTCTGGTAGAGATGCTGTCTAAAACTAGCGTTTTGTGTGAGAC
CAGCTTTATTGGTTGTAGCTGTGATCGTAGATAAAATACTGATACGTATT
GACGTAGTGCATCATAGCTATGAACTGCTAACGTTTATTAAACATTTTAC
GTTCTTATCGAATTTTGTAGAAACTACTACTTTACGATTCAATCTCTAGA
AGATATGAGACGACTTATTGGTAATTTATTCAAATTGATATGAATCACAT
TTCCAAATTGAAATTAATATCATATTTAATTTTAATAATGAACTTCATTT
GTCATTTCCAATTTGTCATTTCATCAAAAAATGTATATCATATACAAACT
CATCAGCAACAATTGATAGAATTTAAAGGTGAAGCCATGTCTGTCATGTC
ATTTACTCATAACAGTTTTAAAGATTTTACTCAATTTTACATTATTAACA
ATTATAATCATCAGTCATTATATGTTGTATCTCAGAACAATACGATTCTA
GAAATAGATCTAGATACGATGAAAATCAGTAACAATTACACAATTATCGC
ATGCTCATTAATGATGATGCCTTGCGAAGAACGCATTTTTATAAACCACT
TATCTGAAATTCAAGTGCTTGACAGTAAAATGTTATGGTTTTGTTATGTA
TTACTTAATTCGAACAATTATAATGTTGCTTTAACAAATTGTATGATTTT
AAAAAATAAAGCTGTAACAACGGACGTAAAGTGGCAAAAATACGGTTACA
CTTCTAATTCTGATCAGCACAAAACTTTCTCAGTTTTAACGAAAGAACAC
ATTTTTATTGGCGCATTCGTCGATAATTCCTTGCTCATTCAAAGAACAAA
ACTTCCGGATATTCTAGGAAAAATTGATTCAATCAAAGATTTAGTGACAC
CGATGGCCAATTTTTATTTTGAAAAAAATTCAAAGTTTATTGAAAAATTT
GAGACAGAATCAGAAATTTATTTTGTCGTAGTTGAACCTGTGTCTGCAAA
GAGTTACAGTGTTTTTGATTGCCTGATGTCACCTGAAAACAGAATGGTTT
ATGTAACAAGGCTCATCAGAATTTGTAAAAAAGATGAAGGTGGAGCAACA
GATCACAATGAGTTCAATTTTGGCACAATTGCCAAAGCAGATATTGTATG
CCCCATAGGCACGGGCAAATATGAATTTTTTTATAGCAAGGCAGTCAGTG
CTACTTGGACAAATTCCAAACTCTATGTGCTGTTTGAAAACCAAAAAAAT
TCGCCACATGGAAAGGTGGTTTGCTATTTTGATCTTTATGCATTTAAAAT
TGTTTTCAATGGACCGATGCGATCTCCATTGATCTATTTAAATTCTCAAA
TTTTGGAAAAAAATCTCCCAAATCCCTTACCAGATGTGTGTGAGAAACTC
AGCAACGGACAATTAAGTAAAAATGAAAAAGTAACAGCTTCCTCACTGTC
TTTAAATGGGCTGTATAGAACTCAGAAAATAGTTCCGGTTGTTAAAACTC
CTCTCATAAACTTCCAAAACAAAGATATTACACAAATAACAGCGTTTTCA
ATTAATCCCGAAGACCCGTCCTCGGTGTTGATCATACATTATGATATGTT
TATCGAGATTTTTAGTCATACTGAAAGCAATGAGCTATGTAATATCGGGA
TATACAAATTGGTTCCAAAAGAAAATGTTTTCCAAATTTCAGGGTTAACA
ACGGATAATAATGCATATATTCTTATCTCAACAAGCGATCGAATAATTAG
AATAAAGATAAACAATTGTGAAAAGTATACTACGAGAGCAAAATGTTTAG
TTGAAGCTCCAAATATTTGTGGCTGGGATCGGAGAACCATGAGCTGTACC
TCATTGAACGATAAAGTCGACATAAATCGTTGGGAACGTAGCTCTTGCAA
AAACATTATAGACAATTCAGTTTGGAGCATTCCTAGTATTTGTTTTGTAA
ATGATTCGCAAATTTCGTTGAAATGCATCTGTAAATATTGCACAAATGAA
ATTATGTGTTCAAACAAGCCAAAAATAGAAATTACGAATTGTACAGGAGC
TATAGAAGTCGGCGAATGGAACGAATGGGGGGCATGGTCTACTTGTTCAC
CTGAAAAGAAGACGAAAATTAGGAAACGGGAATGTTCATCAAAATTCTCG
TGCATTGGGCAGACCGAAGAAACAAAGATTTGCACCACCGTGCGTTCCGT
ATGGTCACAGTGGTACATAACTTCAAATCCGAAAATTTATAACAGTTTCC
GATCAAAGTGCTCCACTGACGATTCCGGCCCGTCTTCGACAATTGAAATC
AGAGAGATGGTTTGTGAAAACACTTGTCAAGAGAATTTATTCAAGTGGTA
TAAATGGTCAAAATGGTCCGATTGTACGTCGCAAAATGTACAATATCGTT
TGTATAACTGCTCAGAATTGTCGCAGTGTCCAGCAAACCAAACTCAGATT
CAAAATTGTGAATTGGTTAAGACAAAGAAAAATAAAACAAATAATGAAAA
CAGTTATGGTACACTCCATATCTGGCTGGCCATTTTAACCAGCTCTATCA
TTTGGGTGTTTATTATGATCATCATTATGCTCTTTAAATTGAAATTGAAC
ACGAACCAGAAAACGAAAACTTCGAAGGTACCACGCACTTTATATCGTGA
CAGACCGATGTTTATGAAACGACAATTTTCTGAAACATCTAACGACTATA
TTAGTTCTGATATCAAATCTACAAATTACGATTTAGATTACATGCCATTT
TCTCATAATGAAAACCTTCCATCAACATCGAAAAATATAGCTTCCCAAAT
TCCGCTAGTTACCGAACAAAATGCTTTCATGGCATCCATTTAACACAACA
AAATTTCTACATTATTTCGAAAATTTTATTACCAACGACTCATTAAAATT
TATTCATAATTTTTTATTAAATTTATAATATTTTTTCCAAAATGGCG
back to top

protein sequence of SMED30025076-orf-1

>SMED30025076-orf-1 ID=SMED30025076-orf-1|Name=SMED30025076-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=868bp
MNHISKLKLISYLILIMNFICHFQFVISSKNVYHIQTHQQQLIEFKGEAM
SVMSFTHNSFKDFTQFYIINNYNHQSLYVVSQNNTILEIDLDTMKISNNY
TIIACSLMMMPCEERIFINHLSEIQVLDSKMLWFCYVLLNSNNYNVALTN
CMILKNKAVTTDVKWQKYGYTSNSDQHKTFSVLTKEHIFIGAFVDNSLLI
QRTKLPDILGKIDSIKDLVTPMANFYFEKNSKFIEKFETESEIYFVVVEP
VSAKSYSVFDCLMSPENRMVYVTRLIRICKKDEGGATDHNEFNFGTIAKA
DIVCPIGTGKYEFFYSKAVSATWTNSKLYVLFENQKNSPHGKVVCYFDLY
AFKIVFNGPMRSPLIYLNSQILEKNLPNPLPDVCEKLSNGQLSKNEKVTA
SSLSLNGLYRTQKIVPVVKTPLINFQNKDITQITAFSINPEDPSSVLIIH
YDMFIEIFSHTESNELCNIGIYKLVPKENVFQISGLTTDNNAYILISTSD
RIIRIKINNCEKYTTRAKCLVEAPNICGWDRRTMSCTSLNDKVDINRWER
SSCKNIIDNSVWSIPSICFVNDSQISLKCICKYCTNEIMCSNKPKIEITN
CTGAIEVGEWNEWGAWSTCSPEKKTKIRKRECSSKFSCIGQTEETKICTT
VRSVWSQWYITSNPKIYNSFRSKCSTDDSGPSSTIEIREMVCENTCQENL
FKWYKWSKWSDCTSQNVQYRLYNCSELSQCPANQTQIQNCELVKTKKNKT
NNENSYGTLHIWLAILTSSIIWVFIMIIIMLFKLKLNTNQKTKTSKVPRT
LYRDRPMFMKRQFSETSNDYISSDIKSTNYDLDYMPFSHNENLPSTSKNI
ASQIPLVTEQNAFMASI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR027231Semaphorin
IPR036352Semap_dom_sf
IPR016201PSI
IPR001627Semap_dom
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR000884TSP1_rpt
IPR001810F-box_dom
Vocabulary: molecular function
TermDefinition
GO:0030215semaphorin receptor binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001627Sema domainSMARTSM00630semacoord: 72..490
e-value: 8.7E-5
score: -92.9
IPR001627Sema domainPFAMPF01403Semacoord: 166..445
e-value: 1.1E-22
score: 80.5
IPR001627Sema domainPROSITEPS51004SEMAcoord: 34..507
score: 14.956
IPR016201PSI domainSMARTSM00423psinew7coord: 509..554
e-value: 0.0064
score: 25.7
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 38..513
e-value: 1.3E-35
score: 124.8
IPR027231SemaphorinPANTHERPTHR11036SEMAPHORINcoord: 167..783
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 607..652
score: 8.66
IPR036352Sema domain superfamilySUPERFAMILYSSF101912Sema domaincoord: 58..449
NoneNo IPR availableTMHMMTMhelixcoord: 7..26
NoneNo IPR availableTMHMMTMhelixcoord: 760..782