Lrr and pyd domains-containing protein 3-like protein

Overview
NameLrr and pyd domains-containing protein 3-like protein
Smed IDSMED30025072
Length (bp)1723
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lrr and pyd domains-containing protein 3-like protein (SMED30025072) t-SNE clustered cells

Violin plots show distribution of expression levels for Lrr and pyd domains-containing protein 3-like protein (SMED30025072) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lrr and pyd domains-containing protein 3-like protein (SMED30025072) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lrr and pyd domains-containing protein 3-like protein (SMED30025072) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. TrEMBL
Match: A0A3C1P7M4 (Uncharacterized protein OS=Planktothrix sp. UBA8402 OX=2055759 GN=DCQ63_02390 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.668e-16
Identity = 59/193 (30.57%), Postives = 99/193 (51.30%), Query Frame = 2
Query:  770 SVFSFCDNLFLTNLIDLYDYIVYNCPHIFTSL----QIKNKIFTFSIYDNITKIVFDKNLVSSLGL-----------EKQTYNVKQFESIYKA----KLYDHHQQMFIYSNIIEPVIVGDSLVPLLKAVWIKKYE----QDEVVQIVLDNPMYLSLSTSCINNIEINIRDDGGKLINFPKNSKTHLTLHFRKL 1279
            S F F ++        L+ Y+  NC  +F  +       NK   F++ + + +I F+  L   LG            + +TYN     S Y+A    +L    + ++IY++   PV VG + VPLLK +++   +    Q  V  + + NPMY++++ + +N+IEIN+R+D G +I FPK + T LTLHF+K 
Sbjct:  181 SEFKFPNDQTFKTPALLFTYLQENCKAVFNEITATTAASNKRMIFTMGNKVFRIKFNGGLNFVLGFYESEFKMVNPDQLKTYNANANPSTYQADLPPQLNRGVKNIYIYASCCAPVYVGHTRVPLLKNIFVDASQDANIQGHVRNLSIQNPMYVNVAATTLNSIEINMRNDAGNIIGFPKGAITVLTLHFKKF 373          
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. TrEMBL
Match: A0A3C1P802 (Uncharacterized protein OS=Planktothrix sp. UBA8402 OX=2055759 GN=DCQ63_02380 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 6.292e-13
Identity = 32/70 (45.71%), Postives = 46/70 (65.71%), Query Frame = 3
Query:   96 VIKDGENNE-VSGKFYEQELQVIPP--PTVFRIEKILKTKMVNKDKQYYIKWLGYQNP--SWISSKDLVK 290
            V+KD   +E + GKFY +ELQ +    P V+RIEKI++TK   + KQY++KW G+ +   SWI+   LVK
Sbjct:  297 VLKDVATDELIEGKFYHEELQDVGDSLPNVYRIEKIIRTKGKGEHKQYFVKWYGFNDSRNSWITKDQLVK 366          

HSP 2 Score: 46.2098 bits (108), Expect = 6.292e-13
Identity = 19/27 (70.37%), Postives = 24/27 (88.89%), Query Frame = 1
Query:   10 VRISKISASPFIKNFDNNWSDEVFQIS 90
            VRIS+IS SPF KNFD NWS+E+F+I+
Sbjct:  259 VRISRISTSPFRKNFDQNWSEEIFRIA 285          
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. TrEMBL
Match: A0A0J7JU61 (Lrr and pyd domains-containing protein 3-like protein (Fragment) OS=Lasius niger OX=67767 GN=RF55_26405 PE=4 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.063e-10
Identity = 39/103 (37.86%), Postives = 62/103 (60.19%), Query Frame = 2
Query:  971 NVKQ-FESIYKAKLYDHHQQMFIYSNIIEPVIVGDSLVPLLKAVWIKKYEQDEVVQIVLDNPMYLSLSTSCINNIEINIRDDGGKLINFPKNSKTHLTLHFRK 1276
            NV Q  +  Y A L  H++ + +Y++IIEP IVGD   PLL+ V +   +  E+V    + P YL +S   I+ IE+NIR   G+L+ F +  ++++ LHFR+
Sbjct:    1 NVMQSVQGSYVADLSTHYKVLLLYTDIIEPQIVGDVTAPLLRIVSVSG-QDGELVSAQYERPHYLPVSRKTIDTIEMNIRLHTGELVPFERG-RSYVKLHFRQ 101          
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. TrEMBL
Match: A0A3C1P7P2 (Uncharacterized protein OS=Planktothrix sp. UBA8402 OX=2055759 GN=DCQ63_02395 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.034e-9
Identity = 34/75 (45.33%), Postives = 47/75 (62.67%), Query Frame = 3
Query: 1296 IISMYSGSQSGGELPYFIGKQYGSGWLRTIGRFALPILKR----LGSFGMKTAKIVIMNEQK-ILPSLKSNALSE 1505
            I+  YSG    G LPYF+G+QYG+GWLR I R A P LKR    +G+  + TA  +I +E K +  +L  NA++E
Sbjct:    8 ILQEYSGQNGYGSLPYFVGQQYGTGWLRNIARMAFPFLKRALGVVGNIAVNTAGDLIHDENKSVGQTLLDNAVNE 82          
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. TrEMBL
Match: A0A0R3QAL6 (Uncharacterized protein OS=Brugia timori OX=42155 GN=BTMF_LOCUS2697 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 3.098e-9
Identity = 35/85 (41.18%), Postives = 54/85 (63.53%), Query Frame = 2
Query: 1025 QMFIYSNIIEPVIVGDSLVPLLKAVWIKKYEQDEVVQIVLDNPMYLSLSTSCINNIEINIRDDGGKLINFPKNSKTHLTLHFRKL 1279
             M+IY++IIEP +VGD + PLL+ V ++K   D  +     NP YL +     + IEI++RDD G+LI F  + K ++ LHFR++
Sbjct:  203 HMYIYTDIIEPNLVGDCIAPLLRIVKVQKQTTDTNISTSFSNPYYLPVLKREFDTIEIHLRDDEGQLIPF-ISGKLNVRLHFRRV 286          
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000055500.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001032.1:12601:13692:-1 gene:ENSAMXG00000041341.1 transcript:ENSAMXT00000055500.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 8.172e-7
Identity = 26/67 (38.81%), Postives = 43/67 (64.18%), Query Frame = 3
Query:   99 IKDGENNEVSGKFYEQELQ--VIPPPTVFRIEKILKTKMVNKDKQYYIKWLGYQNP--SWISSKDLV 287
            + D +  E++G FYE ELQ  ++     F+IEKI++ +M N+ K   +KW+G+ +   SWI +KD+V
Sbjct:  292 LHDADGEEITGTFYEPELQKIIVGKDKSFKIEKIIQERMQNRKKMCLVKWVGWPDKFNSWIPAKDIV 358          
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Planmine SMEST
Match: SMESG000076652.1 (SMESG000076652.1)

HSP 1 Score: 351.673 bits (901), Expect = 6.258e-153
Identity = 186/359 (51.81%), Postives = 243/359 (67.69%), Query Frame = 2
Query:  239 VAWISKPIMDILKRSRKMNFYKILPSNSCPTIHPDNQASKFIVNLQNPIYLQGNWEVTLQDFTFVYSTFPFYSKAKIEYKEIVSKSVSSLYXXXXXXXXXXXXXXNEHSYMYITKGVLHIYCNFYPFQISFED-MQSAKRMGVSEPIITSPSESFQIVVPPNTDNVV-----KIKLTYNTVIQSVFSFCDNLFLTNLIDLYDYIVYNCPHIFTSLQ-IKNKIFTFSIYDNITKIVFDKNLVSSLGLEKQTYNVKQFESIYKAKLYDHHQQMFIYSNIIEPVIVGDSLVPLLKAVWIKKYEQDEVVQIVLDNPMYLSLSTSCINNIEINIRDDGGKLINFPKNSKTHLTLHFRKLDGQ*R 1294
            +AWISK +MDI+KR  KM+FY ILPSNSCP IHP+NQASKF+V+LQNPIYL GNWEV LQDFTFVY+TFPFY+  KI YK+ V K+ S ++ I            N   Y +I   +L      +     F+D +  AKRMG  +  I  P   + I      +  V     KI ++Y   ++  F+F + L++  L +L+ YI  NC HIF +++ +K+ I  FS+ +NI ++ FDKNL ++LGL+KQTY    F  + K K+   H+QMFIY+NII+P+IVGDSLVPLLK+VW+ K++QDEVV I +DNPMYL +STSCINNIEINIRDD GK I F K++KTHLTLHFRKLDG  R
Sbjct:    1 MAWISKTLMDIIKRPSKMSFYTILPSNSCPLIHPENQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYNHCKISYKKRVPKTCSGIFSIN-----------NFERYCHIPNQILDENSGMF-----FKDGLNDAKRMGCDKLSIVVPGTDYLIRFKTFDEKSVTIENIKISVSYINEVEETFTFTNELYIETLEELHKYISLNCLHIFKTIEFLKDGICKFSLNNNICEVTFDKNLANTLGLDKQTYRASAF-GVRKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSGKFIEFSKDTKTHLTLHFRKLDGWLR 342          

HSP 2 Score: 140.969 bits (354), Expect = 6.258e-153
Identity = 68/75 (90.67%), Postives = 72/75 (96.00%), Query Frame = 3
Query: 1368 GWLRTIGRFALPILKRLGSFGMKTAKIVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQEPAPAQKRKRYNKH 1592
            GWLRTIGRFALPILKR+GSFGMKTAK VIMNEQKILPSLKSNALSELGKVLPSVAGMFQK E APAQKRKR+++H
Sbjct:  339 GWLRTIGRFALPILKRIGSFGMKTAKDVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKPE-APAQKRKRHHEH 412          

HSP 3 Score: 90.8929 bits (224), Expect = 6.258e-153
Identity = 39/41 (95.12%), Postives = 39/41 (95.12%), Query Frame = 2
Query: 1601 QTNERTWNYISKMICGKSELCLFDRPSPQAVIEMGAFEDVF 1723
            QT ER WNYISKMICGKSELCLFDRPSPQAVIEMGAFEDVF
Sbjct:  414 QTKERAWNYISKMICGKSELCLFDRPSPQAVIEMGAFEDVF 454          
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Planmine SMEST
Match: SMESG000048922.1 (SMESG000048922.1)

HSP 1 Score: 366.696 bits (940), Expect = 1.092e-148
Identity = 187/355 (52.68%), Postives = 252/355 (70.99%), Query Frame = 2
Query:  239 VAWISKPIMDILKRSRKMNFYKILPSNSCPTIHPDNQASKFIVNLQNPIYLQGNWEVTLQDFTFVYSTFPFYSKAKIEYKEIVSKSVSSLYXXXXXXXXXX--XXXXNEHSYMYITKGVLHIYCNFYPFQISFEDMQSAKRMGVSEPIITSPSESFQIVVPPNTDNVV-----KIKLTYNTVIQSVFSFCDNLFLTNLIDLYDYIVYNCPHIFTSLQ-IKNKIFTFSIYDNITKIVFDKNLVSSLGLEKQTYNVKQFESIYKAKLYDHHQQMFIYSNIIEPVIVGDSLVPLLKAVWIKKYEQDEVVQIVLDNPMYLSLSTSCINNIEINIRDDGGKLINFPKNSKTHLTLHFRKL 1279
            +AWISK +MDI+KR  KM+FY ILPSNSCP IHP+NQASKF+V+LQNPIYL GNWEV LQDFTFVY+TFPFYS  KI YK+ V K+ S ++ I   +       +  +E+  M+   G L++ C++ PF I F+ ++ AKRMG  +  I  P   + I      +  V     KI L+Y   ++  F+F ++L++  L +L+ YI +NC HIF +++ +K+ +  FS+ +NI +I FDKNL ++LGL+KQTY    F  ++K K+   H+QMFIY+NII+P+IVGDSLVPLLK+VW+ K++QDEVV I +DNPMYL +STSCINNIEINIRDD GK I F K++KTHLTLHFR L
Sbjct:    1 MAWISKTLMDIIKRPSKMSFYTILPSNSCPLIHPENQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKIGYKKRVPKTCSGIFSINNFERYCHIPNQILDENCGMFFKDG-LNVSCDYSPFTIKFKSIEDAKRMGCDKLSIVVPGTEYLIRFKTFDEKSVTIKNIKISLSYINEVEETFTFTNDLYIETLEELHKYISFNCLHIFKTIEFVKDGLCKFSLNNNICEITFDKNLANTLGLDKQTYRTSAF-GVHKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSGKFIEFSKDTKTHLTLHFRWL 353          

HSP 2 Score: 122.094 bits (305), Expect = 1.092e-148
Identity = 58/60 (96.67%), Postives = 59/60 (98.33%), Query Frame = 3
Query: 1371 WLRTIGRFALPILKRLGSFGMKTAKIVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQ 1550
            WLRTIGRFALPILKRLGSFGMKT+K VIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQ
Sbjct:  352 WLRTIGRFALPILKRLGSFGMKTSKDVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQ 411          

HSP 3 Score: 80.4925 bits (197), Expect = 1.092e-148
Identity = 34/36 (94.44%), Postives = 35/36 (97.22%), Query Frame = 2
Query: 1616 TWNYISKMICGKSELCLFDRPSPQAVIEMGAFEDVF 1723
            TWNYISKMICGKSELCLFDRPSPQAVIEMG FE+VF
Sbjct:  428 TWNYISKMICGKSELCLFDRPSPQAVIEMGVFEEVF 463          
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Planmine SMEST
Match: SMESG000019334.1 (SMESG000019334.1)

HSP 1 Score: 308.531 bits (789), Expect = 1.358e-124
Identity = 168/331 (50.76%), Postives = 229/331 (69.18%), Query Frame = 2
Query:  263 MDILKRSRKMNFYKILPSNSCPTIHPDNQASKFIVNLQNPIYLQGNWEVTLQDFTFVYSTFPFYSKAKIEYKEIVSKSVSSLYXXXXXXX--XXXXXXXNEHSYMYITKGVLHIYCNFYPFQISFEDMQSAKRMGVSEPIITSPSESFQIVVPPNTDNVVKIKLTYNTVIQSVFSFCDNLFLTNLIDLYDYIVYNCPHIFTSLQ-IKNKIFTFSIYDNITKIVFDKNLVSSLGLEKQTYNVKQFESIYKAKLYDHHQQMFIYSNIIEPVIVGDSLVPLLKAVWIKKYEQDEVVQIVLDNPMYLSLSTSCINNIEINIRDDGGKLINFPKNS 1246
            MDI+KR  KM+FY ILPSNSCP IHP+NQASKF+V+LQNPIYL GNWEV LQDFTFVY+TFPFYS  KI +K+ V K+ S +  I   K    +P +  +E+S M+   G L++ C+F PF I+         +  +E +I   +   + V   N    +KI ++Y   ++  F+F + L++  L +L+ YI  NC HIF +++ +K+ I  FS+ +NI ++ FDKNL ++LGL+KQTY    F  + K K+   H+QMFIY+NII+P+IVGDSLVPLLK+VW+ K++QDEVV I +DNPMYL +STSCINNIEINIRDD GKL+N   N+
Sbjct:    5 MDIMKRPSKMSFYTILPSNSCPLIHPENQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKIGFKKRVPKTCSGILSINNFKRYCHIPNQILDENSGMFFKDG-LNVSCDFSPFTINI-------VVPGTEYLIRFKTFDEKSVTIEN----IKISVSYINEVEDTFTFTNELYIETLEELHKYISLNCLHIFKTIEFLKDGICKFSLNNNICEVTFDKNLANTLGLDKQTYRASAF-GVRKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSGKLLNLMANN 322          

HSP 2 Score: 158.688 bits (400), Expect = 1.358e-124
Identity = 75/79 (94.94%), Postives = 76/79 (96.20%), Query Frame = 3
Query: 1269 FVN*MANNDIISMYSGSQSGGELPYFIGKQYGSGWLRTIGRFALPILKRLGSFGMKTAKIVIMNEQKILPSLKSNALSE 1505
             +N MANNDIISMYSGSQSGGELPYFIGKQYGSGWLRTIGRFALPILKRLGSFGMKTAK VIMNEQKILPSLKSNALSE
Sbjct:  315 LLNLMANNDIISMYSGSQSGGELPYFIGKQYGSGWLRTIGRFALPILKRLGSFGMKTAKDVIMNEQKILPSLKSNALSE 393          
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Planmine SMEST
Match: SMESG000017989.1 (SMESG000017989.1)

HSP 1 Score: 359.762 bits (922), Expect = 2.332e-110
Identity = 184/353 (52.12%), Postives = 248/353 (70.25%), Query Frame = 2
Query:  239 VAWISKPIMDILKRSRKMNFYKILPSNSCPTIHPDNQASKFIVNLQNPIYLQGNWEVTLQDFTFVYSTFPFYSKAKIEYKEIVSKSVSSLYXXXXXXXXXX--XXXXNEHSYMYITKGVLHIYCNFYPFQISFEDMQSAKRMGVSEPIITSPSESFQIVVPPNTDNVV-----KIKLTYNTVIQSVFSFCDNLFLTNLIDLYDYIVYNCPHIFTSLQ-IKNKIFTFSIYDNITKIVFDKNLVSSLGLEKQTYNVKQFESIYKAKLYDHHQQMFIYSNIIEPVIVGDSLVPLLKAVWIKKYEQDEVVQIVLDNPMYLSLSTSCINNIEINIRDDGGKLINFPKNSKTHLTLHFR 1273
            +AWISK +MDI+KR  KM+FY ILPSNSCP IHP+NQASKF+V+LQNPIYL GNWEV LQDFTFVY+TFPFYS  KI YK+ V K+ S ++ I   +       +  +E+  M+   G L++ C++ PF I FE ++ AKRMG  +  I  P   + I      +  V     KI ++Y   ++  F+F ++L++  L +L+ YI +NC HIF +++ +K+ I  FS+ +NI ++ FDKNL ++LGL+KQTY    F  + K K+   H+QMFIY+NII+P+IVGDSLVPLLK+VW+  ++QDEVV I +DNPMYL +STSCINNIEINIRDD GK I F K++KTHLTLHF 
Sbjct:    1 MAWISKTLMDIIKRPSKMSFYTILPSNSCPLIHPENQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKISYKKRVPKTCSGIFSINNFERYCHIPNQILDENCGMFFKDG-LNVSCDYSPFTIKFESIEDAKRMGCDKLSIVVPGTEYLIRFKTFDEKSVTIENIKISVSYINEVEDTFTFTNDLYIETLEELHKYISFNCLHIFKTIEFVKDGICKFSLNNNICEVTFDKNLANTLGLDKQTYRASAF-GVRKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDTHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSGKFIEFSKDTKTHLTLHFH 351          
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Planmine SMEST
Match: SMESG000048922.1 (SMESG000048922.1)

HSP 1 Score: 339.347 bits (869), Expect = 4.792e-102
Identity = 174/337 (51.63%), Postives = 237/337 (70.33%), Query Frame = 2
Query:  239 VAWISKPIMDILKRSRKMNFYKILPSNSCPTIHPDNQASKFIVNLQNPIYLQGNWEVTLQDFTFVYSTFPFYSKAKIEYKEIVSKSVSSLYXXXXXXXXXX--XXXXNEHSYMYITKGVLHIYCNFYPFQISFEDMQSAKRMGVSEPIITSPSESFQIVVPPNTDNVV-----KIKLTYNTVIQSVFSFCDNLFLTNLIDLYDYIVYNCPHIFTSLQ-IKNKIFTFSIYDNITKIVFDKNLVSSLGLEKQTYNVKQFESIYKAKLYDHHQQMFIYSNIIEPVIVGDSLVPLLKAVWIKKYEQDEVVQIVLDNPMYLSLSTSCINNIEINIRDDGGKL 1225
            +AWISK +MDI+KR  KM+FY ILPSNSCP IHP+NQASKF+V+LQNPIYL GNWEV LQDFTFVY+TFPFYS  KI YK+ V K+ S ++ I   +       +  +E+  M+   G L++ C++ PF I F+ ++ AKRMG  +  I  P   + I      +  V     KI L+Y   ++  F+F ++L++  L +L+ YI +NC HIF +++ +K+ +  FS+ +NI +I FDKNL ++LGL+KQTY    F  ++K K+   H+QMFIY+NII+P+IVGDSLVPLLK+VW+ K++QDEVV I +DNPMYL +STSCINNIEINIRDD G L
Sbjct:    1 MAWISKTLMDIIKRPSKMSFYTILPSNSCPLIHPENQASKFMVDLQNPIYLHGNWEVALQDFTFVYNTFPFYSHCKIGYKKRVPKTCSGIFSINNFERYCHIPNQILDENCGMFFKDG-LNVSCDYSPFTIKFKSIEDAKRMGCDKLSIVVPGTEYLIRFKTFDEKSVTIKNIKISLSYINEVEETFTFTNDLYIETLEELHKYISFNCLHIFKTIEFVKDGLCKFSLNNNICEITFDKNLANTLGLDKQTYRTSAF-GVHKPKIIKLHRQMFIYTNIIDPIIVGDSLVPLLKSVWVDKHDQDEVVNINIDNPMYLPVSTSCINNIEINIRDDSGWL 335          

HSP 2 Score: 126.331 bits (316), Expect = 1.437e-46
Identity = 60/62 (96.77%), Postives = 61/62 (98.39%), Query Frame = 3
Query: 1365 SGWLRTIGRFALPILKRLGSFGMKTAKIVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQ 1550
            SGWLRTIGRFALPILKRLGSFGMKT+K VIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQ
Sbjct:  332 SGWLRTIGRFALPILKRLGSFGMKTSKDVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQ 393          

HSP 3 Score: 80.4925 bits (197), Expect = 1.437e-46
Identity = 34/36 (94.44%), Postives = 35/36 (97.22%), Query Frame = 2
Query: 1616 TWNYISKMICGKSELCLFDRPSPQAVIEMGAFEDVF 1723
            TWNYISKMICGKSELCLFDRPSPQAVIEMG FE+VF
Sbjct:  410 TWNYISKMICGKSELCLFDRPSPQAVIEMGVFEEVF 445          
The following BLAST results are available for this feature:
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3C1P7M42.668e-1630.57Uncharacterized protein OS=Planktothrix sp. UBA840... [more]
A0A3C1P8026.292e-1345.71Uncharacterized protein OS=Planktothrix sp. UBA840... [more]
A0A0J7JU611.063e-1037.86Lrr and pyd domains-containing protein 3-like prot... [more]
A0A3C1P7P21.034e-945.33Uncharacterized protein OS=Planktothrix sp. UBA840... [more]
A0A0R3QAL63.098e-941.18Uncharacterized protein OS=Brugia timori OX=42155 ... [more]
back to top
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000055500.18.172e-738.81pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lrr and pyd domains-containing protein 3-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076652.16.258e-15351.81SMESG000076652.1[more]
SMESG000048922.11.092e-14852.68SMESG000048922.1[more]
SMESG000019334.11.358e-12450.76SMESG000019334.1[more]
SMESG000017989.12.332e-11052.12SMESG000017989.1[more]
SMESG000048922.14.792e-10251.63SMESG000048922.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025072 ID=SMED30025072|Name=Lrr and pyd domains-containing protein 3-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1723bp
GATGATTATGTAAGAATATCTAAAATATCAGCATCACCATTCATTAAGAA
TTTTGATAACAATTGGAGTGATGAAGTTTTTCAAATCTCAAAGATGTTAT
AAAAGATGGAGAAAATAATGAGGTATCTGGTAAATTCTACGAACAAGAGC
TACAAGTTATTCCTCCACCAACAGTATTTAGAATTGAAAAGATTTTGAAA
ACTAAAATGGTGAATAAAGATAAACAATATTATATCAAGTGGCTTGGATA
TCAAAACCCATCATGGATATCCTCAAAAGATCTCGTAAAATGAATTTCTA
CAAGATTTTACCGAGCAATAGTTGTCCAACAATTCATCCAGACAATCAAG
CCAGTAAATTTATTGTCAATCTTCAAAACCCGATTTATTTACAAGGTAAT
TGGGAAGTAACTTTGCAAGATTTTACATTTGTGTATAGTACGTTCCCATT
CTATAGTAAAGCAAAGATTGAATACAAAGAAATTGTATCAAAATCAGTTA
GCAGTCTTTACTTTATTGAACCGGAAAAAGAAGAAATGCCGATAAAAGAA
TTCAACGAGCATAGTTACATGTACATAACTAAAGGAGTTTTACATATTTA
TTGTAATTTCTACCCATTCCAAATATCATTTGAAGATATGCAAAGTGCAA
AACGAATGGGTGTATCTGAACCAATAATTACAAGTCCCAGTGAGTCATTT
CAAATAGTAGTTCCACCAAATACAGATAATGTAGTAAAAATAAAGTTAAC
ATATAACACTGTAATTCAATCAGTTTTCTCGTTTTGTGATAATTTGTTCT
TGACAAATCTTATAGACTTGTATGATTATATAGTGTACAACTGTCCTCAT
ATTTTTACATCTCTTCAAATAAAAAATAAAATATTCACATTCAGTATTTA
CGATAATATTACAAAGATTGTATTCGATAAAAACTTGGTTAGTTCACTCG
GATTAGAGAAGCAAACATATAATGTGAAACAATTTGAGAGTATTTATAAA
GCAAAGTTATATGATCATCATCAACAAATGTTCATCTATAGTAACATTAT
TGAACCAGTAATTGTTGGCGATTCTTTAGTTCCCTTATTGAAAGCAGTCT
GGATTAAAAAATATGAACAAGATGAAGTTGTACAAATTGTATTGGATAAT
CCGATGTATTTATCGCTTTCCACGTCATGTATAAACAATATAGAAATTAA
TATTCGTGATGATGGTGGGAAACTTATCAACTTTCCAAAAAATTCAAAAA
CACATTTGACATTACATTTTCGTAAATTAGATGGCCAATAACGATATTAT
TAGTATGTATAGTGGTAGCCAAAGTGGTGGCGAATTACCATATTTTATTG
GTAAACAGTATGGATCAGGATGGTTGAGAACAATTGGTAGATTTGCACTT
CCTATTCTTAAACGCCTTGGTAGTTTTGGTATGAAAACCGCTAAAATTGT
GATAATGAATGAGCAGAAAATTTTGCCATCTCTGAAATCAAATGCATTAT
CCGAGTTAGGGAAAGTTCTACCTAGTGTTGCAGGTATGTTTCAAAAACAA
GAACCTGCACCGGCTCAAAAACGTAAAAGATATAATAAACATCATATAAA
CAAACGAATGAAAGGACATGGAACTATATTTCAAAAATGATTTGTGGTAA
ATCTGAATTGTGCTTATTTGATAGACCATCTCCCCAGGCGGTAATTGAAA
TGGGGGCCTTTGAAGATGTATTC
back to top

protein sequence of SMED30025072-orf-1

>SMED30025072-orf-1 ID=SMED30025072-orf-1|Name=SMED30025072-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=343bp
MDILKRSRKMNFYKILPSNSCPTIHPDNQASKFIVNLQNPIYLQGNWEVT
LQDFTFVYSTFPFYSKAKIEYKEIVSKSVSSLYFIEPEKEEMPIKEFNEH
SYMYITKGVLHIYCNFYPFQISFEDMQSAKRMGVSEPIITSPSESFQIVV
PPNTDNVVKIKLTYNTVIQSVFSFCDNLFLTNLIDLYDYIVYNCPHIFTS
LQIKNKIFTFSIYDNITKIVFDKNLVSSLGLEKQTYNVKQFESIYKAKLY
DHHQQMFIYSNIIEPVIVGDSLVPLLKAVWIKKYEQDEVVQIVLDNPMYL
SLSTSCINNIEINIRDDGGKLINFPKNSKTHLTLHFRKLDGQ*
back to top

protein sequence of SMED30025072-orf-2

>SMED30025072-orf-2 ID=SMED30025072-orf-2|Name=SMED30025072-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=120bp
MANNDIISMYSGSQSGGELPYFIGKQYGSGWLRTIGRFALPILKRLGSFG
MKTAKIVIMNEQKILPSLKSNALSELGKVLPSVAGMFQKQEPAPAQKRKR
YNKHHINKRMKGHGTIFQK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR000953Chromo/chromo_shadow_dom
IPR016197Chromo-like_dom_sf