Endoplasmic reticulum chaperone BiP

Overview
NameEndoplasmic reticulum chaperone BiP
Smed IDSMED30025067
Length (bp)2317
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Endoplasmic reticulum chaperone BiP (SMED30025067) t-SNE clustered cells

Violin plots show distribution of expression levels for Endoplasmic reticulum chaperone BiP (SMED30025067) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Endoplasmic reticulum chaperone BiP (SMED30025067) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Endoplasmic reticulum chaperone BiP (SMED30025067) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025067

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 26

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30025067SMESG000062699.1 dd_Smed_v4_511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025067SMESG000062699.1 dd_Smed_v4_511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025067SMESG000062699.1 dd_Smed_v4_511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025067SMESG000062699.1 dd_Smed_v4_511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025067SMESG000062699.1 dd_Smed_v4_511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025067SMESG000062699.1 dd_Smed_v4_511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30025067SMESG000062699.1 dd_Smed_v4_511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025067SMESG000062699.1 dd_Smed_v4_511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30025067SMESG000062699.1 dd_Smed_v4_511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025067SMESG000062699.1 dd_Smed_v4_511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30025067SMESG000062699.1 dd_Smed_v4_511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025067SMESG000062699.1 Contig37881uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025067SMESG000062699.1 Contig37881newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30025067SMESG000062699.1 dd_Smed_v6_511_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
whole organismSMED30025067SMESG000062699.1 Contig50519uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30025067SMESG000062699.1 Contig50519newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30025067SMESG000062699.1 SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v6_320_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30025067SMESG000062699.1 SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v6_320_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025067SMESG000062699.1 SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v6_320_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025067SMESG000062699.1 SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v6_320_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30025067SMESG000062699.1 dd_Smed_v6_511_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025067SMESG000062699.1 dd_Smed_v6_511_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30025067SMESG000062699.1 dd_Smed_v6_511_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30025067SMESG000062699.1 dd_Smed_v6_511_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025067SMESG000062699.1 dd_Smed_v6_511_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30025067SMESG000062699.1 dd_Smed_v6_511_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Match: HSPA5 (heat shock protein family A (Hsp70) member 5 [Source:HGNC Symbol;Acc:HGNC:5238])

HSP 1 Score: 965.681 bits (2495), Expect = 0.000e+0
Identity = 488/612 (79.74%), Postives = 552/612 (90.20%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGN-EVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTV+GIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT EGERLIGDAAKNQLT+NPENTVFD KR+IGR +ND +VQ D+K  PFKV+ K  KP ++V +G  + K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDK+ GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKRALS+ H ARIEIES Y+GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL+D+++KK DI+EIVLVGGSTRIPK+QQLVKEFFNGKEPSRGINPDEAVA+GAAVQAGV+ G ++TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  E+IE+M+ DAE +A++DKK+KE+++ +N+LE YAYSLK Q+ DKEKLG KLS  DKET+ KAV+E I WLE +Q A+ E+FK +KK++E+IV PI++KLY  +G
Sbjct:   28 GTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAG 639          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 395/611 (64.65%), Postives = 488/611 (79.87%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 2061
            G  +GIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFD KR+IGR F+D  VQ DMKH+PF V+N   +P V+V+   E KSF PEE+S+MVL KMK IAEAYLGK VT+AVVTVPAYFND+QRQAT DAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++++FI  +K+K  KDI+++KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T+ PVEK L+DA++ K  I++IVLVGGSTRIPK+Q+L+++FFNGKE ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQP V IQVYEGER MTKDN+ LGKF+LTGIP APRGVPQIEVTF+ID NGIL VSA DK TG +NKI I  D+ RL+ EDIE+M+++AE Y  +D+K ++KV +KN LE YA+++K  V D EKL  K++  DK+ I+   +E I+WL+KNQ AE EEF+ Q+K++E +  PI+TKLYQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVED-EKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 395/611 (64.65%), Postives = 488/611 (79.87%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 2061
            G  +GIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFD KR+IGR F+D  VQ DMKH+PF V+N   +P V+V+   E KSF PEE+S+MVL KMK IAEAYLGK VT+AVVTVPAYFND+QRQAT DAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++++FI  +K+K  KDI+++KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T+ PVEK L+DA++ K  I++IVLVGGSTRIPK+Q+L+++FFNGKE ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQP V IQVYEGER MTKDN+ LGKF+LTGIP APRGVPQIEVTF+ID NGIL VSA DK TG +NKI I  D+ RL+ EDIE+M+++AE Y  +D+K ++KV +KN LE YA+++K  V D EKL  K++  DK+ I+   +E I+WL+KNQ AE EEF+ Q+K++E +  PI+TKLYQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVED-EKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 395/611 (64.65%), Postives = 488/611 (79.87%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 2061
            G  +GIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFD KR+IGR F+D  VQ DMKH+PF V+N   +P V+V+   E KSF PEE+S+MVL KMK IAEAYLGK VT+AVVTVPAYFND+QRQAT DAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++++FI  +K+K  KDI+++KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T+ PVEK L+DA++ K  I++IVLVGGSTRIPK+Q+L+++FFNGKE ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQP V IQVYEGER MTKDN+ LGKF+LTGIP APRGVPQIEVTF+ID NGIL VSA DK TG +NKI I  D+ RL+ EDIE+M+++AE Y  +D+K ++KV +KN LE YA+++K  V D EKL  K++  DK+ I+   +E I+WL+KNQ AE EEF+ Q+K++E +  PI+TKLYQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVED-EKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:HGNC Symbol;Acc:HGNC:5235])

HSP 1 Score: 762.296 bits (1967), Expect = 0.000e+0
Identity = 391/613 (63.78%), Postives = 489/613 (79.77%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKG---GEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXX--XXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 2061
            G  IGIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NT+FD KR+IGR F D TVQ DMKH+PF+V+++  KP V+V+   E K+F PEEIS+MVL KMK IAEAYLG KV  AV+TVPAYFND+QRQAT DAG I GLNVLRIINEPTAAAIAYGLDKKG   GEKN+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++ +  + +K+K  KDI  +KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T++PVEK L+DA++ K  I EIVLVGGSTRIPK+Q+L+++FFNGKE ++ INPDEAVA+GAAVQA ++     E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQ +V +QVYEGER MTKDN+ LGKFDLTGIP APRGVPQIEVTF+ID NGIL V+A DK TG +NKI I  D+ RL+ +DI++M+++AE Y  +D+  +++V AKN LE Y Y++K  V D EKL  K+S  DK  I+    E I+WL++NQ AE +E++ ++K++E +  PI++KLYQ
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVED-EKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 956.051 bits (2470), Expect = 0.000e+0
Identity = 498/645 (77.21%), Postives = 574/645 (88.99%), Query Frame = 1
Query:  142 MKSITII-FISLLICSIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTA-EGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            MK++ ++  I+L   S+Y  +++K EK + + YGT+IGIDLGTTYSCVGV+K GRVEIIANDQGNRITPSYVAF+  +G+RLIGDAAKNQLT NPENT+FD KR+IGR++NDKTVQ D+KH+PFKVI+K+NKPSVEV+VG++ K F PEE+SAMVL KMK IAE+YLGK+V +AVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GE+NILVFDLGGGTFDVS+LTIDNGVFEV+ATNGDTHLGGEDFDQRVM YFIKLYKKK GKD+  DKRAVQKLRREVEKAKRALS  H  ++EIESL+DGEDFSETLTRA+FEELNMDLFR+T+KPV+KVL+D+++KK+D++EIVLVGGSTRIPKVQQL+KEFFNGKEPSRGINPDEAVA+GAAVQ GVI G E+TG+IVLLDV PLT+GIETVGGVMTKLI RNTVIPTKKSQVFSTAADNQPTVTIQV+EGERPMTKDNH LGKFDLTG+P APRGVPQIEVTFEIDVNGIL V+AEDKGTGNKNKI I  DQNRL+ EDIE+MI DAE +A+ DKKVK+K EA+N+LE YAY+LK Q+ DKEKLG KL   DK+TI +AV+EAISWL  N +A  EE K QKK +E  V PI++KLY+ +G
Sbjct:    1 MKTLFLLGLIALSAVSVYCEEEEKTEKKETK-YGTIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKKDGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETLTRAKFEELNMDLFRATLKPVQKVLEDSDLKKDDVHEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGEEDTGEIVLLDVNPLTMGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFAEDDKKVKDKAEARNELESYAYNLKNQIEDKEKLGGKLDEDDKKTIEEAVEEAISWLGSNAEASAEELKEQKKDLESKVQPIVSKLYKDAG 644          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 956.051 bits (2470), Expect = 0.000e+0
Identity = 498/645 (77.21%), Postives = 574/645 (88.99%), Query Frame = 1
Query:  142 MKSITII-FISLLICSIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTA-EGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            MK++ ++  I+L   S+Y  +++K EK + + YGT+IGIDLGTTYSCVGV+K GRVEIIANDQGNRITPSYVAF+  +G+RLIGDAAKNQLT NPENT+FD KR+IGR++NDKTVQ D+KH+PFKVI+K+NKPSVEV+VG++ K F PEE+SAMVL KMK IAE+YLGK+V +AVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GE+NILVFDLGGGTFDVS+LTIDNGVFEV+ATNGDTHLGGEDFDQRVM YFIKLYKKK GKD+  DKRAVQKLRREVEKAKRALS  H  ++EIESL+DGEDFSETLTRA+FEELNMDLFR+T+KPV+KVL+D+++KK+D++EIVLVGGSTRIPKVQQL+KEFFNGKEPSRGINPDEAVA+GAAVQ GVI G E+TG+IVLLDV PLT+GIETVGGVMTKLI RNTVIPTKKSQVFSTAADNQPTVTIQV+EGERPMTKDNH LGKFDLTG+P APRGVPQIEVTFEIDVNGIL V+AEDKGTGNKNKI I  DQNRL+ EDIE+MI DAE +A+ DKKVK+K EA+N+LE YAY+LK Q+ DKEKLG KL   DK+TI +AV+EAISWL  N +A  EE K QKK +E  V PI++KLY+ +G
Sbjct:    1 MKTLFLLGLIALSAVSVYCEEEEKTEKKETK-YGTIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKKDGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETLTRAKFEELNMDLFRATLKPVQKVLEDSDLKKDDVHEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGEEDTGEIVLLDVNPLTMGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFAEDDKKVKDKAEARNELESYAYNLKNQIEDKEKLGGKLDEDDKKTIEEAVEEAISWLGSNAEASAEELKEQKKDLESKVQPIVSKLYKDAG 644          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 956.051 bits (2470), Expect = 0.000e+0
Identity = 498/645 (77.21%), Postives = 574/645 (88.99%), Query Frame = 1
Query:  142 MKSITII-FISLLICSIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTA-EGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            MK++ ++  I+L   S+Y  +++K EK + + YGT+IGIDLGTTYSCVGV+K GRVEIIANDQGNRITPSYVAF+  +G+RLIGDAAKNQLT NPENT+FD KR+IGR++NDKTVQ D+KH+PFKVI+K+NKPSVEV+VG++ K F PEE+SAMVL KMK IAE+YLGK+V +AVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GE+NILVFDLGGGTFDVS+LTIDNGVFEV+ATNGDTHLGGEDFDQRVM YFIKLYKKK GKD+  DKRAVQKLRREVEKAKRALS  H  ++EIESL+DGEDFSETLTRA+FEELNMDLFR+T+KPV+KVL+D+++KK+D++EIVLVGGSTRIPKVQQL+KEFFNGKEPSRGINPDEAVA+GAAVQ GVI G E+TG+IVLLDV PLT+GIETVGGVMTKLI RNTVIPTKKSQVFSTAADNQPTVTIQV+EGERPMTKDNH LGKFDLTG+P APRGVPQIEVTFEIDVNGIL V+AEDKGTGNKNKI I  DQNRL+ EDIE+MI DAE +A+ DKKVK+K EA+N+LE YAY+LK Q+ DKEKLG KL   DK+TI +AV+EAISWL  N +A  EE K QKK +E  V PI++KLY+ +G
Sbjct:    1 MKTLFLLGLIALSAVSVYCEEEEKTEKKETK-YGTIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKKDGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETLTRAKFEELNMDLFRATLKPVQKVLEDSDLKKDDVHEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGEEDTGEIVLLDVNPLTMGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFAEDDKKVKDKAEARNELESYAYNLKNQIEDKEKLGGKLDEDDKKTIEEAVEEAISWLGSNAEASAEELKEQKKDLESKVQPIVSKLYKDAG 644          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 956.051 bits (2470), Expect = 0.000e+0
Identity = 498/645 (77.21%), Postives = 574/645 (88.99%), Query Frame = 1
Query:  142 MKSITII-FISLLICSIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTA-EGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            MK++ ++  I+L   S+Y  +++K EK + + YGT+IGIDLGTTYSCVGV+K GRVEIIANDQGNRITPSYVAF+  +G+RLIGDAAKNQLT NPENT+FD KR+IGR++NDKTVQ D+KH+PFKVI+K+NKPSVEV+VG++ K F PEE+SAMVL KMK IAE+YLGK+V +AVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GE+NILVFDLGGGTFDVS+LTIDNGVFEV+ATNGDTHLGGEDFDQRVM YFIKLYKKK GKD+  DKRAVQKLRREVEKAKRALS  H  ++EIESL+DGEDFSETLTRA+FEELNMDLFR+T+KPV+KVL+D+++KK+D++EIVLVGGSTRIPKVQQL+KEFFNGKEPSRGINPDEAVA+GAAVQ GVI G E+TG+IVLLDV PLT+GIETVGGVMTKLI RNTVIPTKKSQVFSTAADNQPTVTIQV+EGERPMTKDNH LGKFDLTG+P APRGVPQIEVTFEIDVNGIL V+AEDKGTGNKNKI I  DQNRL+ EDIE+MI DAE +A+ DKKVK+K EA+N+LE YAY+LK Q+ DKEKLG KL   DK+TI +AV+EAISWL  N +A  EE K QKK +E  V PI++KLY+ +G
Sbjct:    1 MKTLFLLGLIALSAVSVYCEEEEKTEKKETK-YGTIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKKDGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETLTRAKFEELNMDLFRATLKPVQKVLEDSDLKKDDVHEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGEEDTGEIVLLDVNPLTMGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFAEDDKKVKDKAEARNELESYAYNLKNQIEDKEKLGGKLDEDDKKTIEEAVEEAISWLGSNAEASAEELKEQKKDLESKVQPIVSKLYKDAG 644          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 956.051 bits (2470), Expect = 0.000e+0
Identity = 498/645 (77.21%), Postives = 574/645 (88.99%), Query Frame = 1
Query:  142 MKSITII-FISLLICSIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTA-EGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            MK++ ++  I+L   S+Y  +++K EK + + YGT+IGIDLGTTYSCVGV+K GRVEIIANDQGNRITPSYVAF+  +G+RLIGDAAKNQLT NPENT+FD KR+IGR++NDKTVQ D+KH+PFKVI+K+NKPSVEV+VG++ K F PEE+SAMVL KMK IAE+YLGK+V +AVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GE+NILVFDLGGGTFDVS+LTIDNGVFEV+ATNGDTHLGGEDFDQRVM YFIKLYKKK GKD+  DKRAVQKLRREVEKAKRALS  H  ++EIESL+DGEDFSETLTRA+FEELNMDLFR+T+KPV+KVL+D+++KK+D++EIVLVGGSTRIPKVQQL+KEFFNGKEPSRGINPDEAVA+GAAVQ GVI G E+TG+IVLLDV PLT+GIETVGGVMTKLI RNTVIPTKKSQVFSTAADNQPTVTIQV+EGERPMTKDNH LGKFDLTG+P APRGVPQIEVTFEIDVNGIL V+AEDKGTGNKNKI I  DQNRL+ EDIE+MI DAE +A+ DKKVK+K EA+N+LE YAY+LK Q+ DKEKLG KL   DK+TI +AV+EAISWL  N +A  EE K QKK +E  V PI++KLY+ +G
Sbjct:    1 MKTLFLLGLIALSAVSVYCEEEEKTEKKETK-YGTIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRLIGDAAKNQLTINPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVIDKSNKPSVEVKVGSDNKQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKKDGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETLTRAKFEELNMDLFRATLKPVQKVLEDSDLKKDDVHEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQGGVISGEEDTGEIVLLDVNPLTMGIETVGGVMTKLIGRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHQLGKFDLTGLPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFAEDDKKVKDKAEARNELESYAYNLKNQIEDKEKLGGKLDEDDKKTIEEAVEEAISWLGSNAEASAEELKEQKKDLESKVQPIVSKLYKDAG 644          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Match: Hsc70-3 (gene:FBgn0001218 transcript:FBtr0073610)

HSP 1 Score: 946.036 bits (2444), Expect = 0.000e+0
Identity = 484/611 (79.21%), Postives = 545/611 (89.20%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTVIGIDLGTTYSCVGV+K GRVEIIANDQGNRITPSYVAFTA+GERLIGDAAKNQLTTNPENTVFD KR+IGR ++D  VQ D+K FPFKV+ KN+KP + V      K FAPEEISAMVLGKMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG+IAGL V+RIINEPTAAAIAYGLDKK GEKN+LVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKKKGKDI  D RAVQKLRREVEKAKRALS +H  RIEIES ++G+DFSETLTRA+FEELN+DLFRST+KPV+KVL+DA+M K+D++EIVLVGGSTRIPKVQQLVK+FF GKEPSRGINPDEAVA+GAAVQAGV+ G ++T  IVLLDV PLT+GIETVGGVMTKLIPRNTVIPTKKSQVFSTA+DNQ TVTIQVYEGERPMTKDNH LGKFDLTGIP APRG+PQIEV+FEID NGIL+VSAEDKGTGNK KI+I  DQNRL  EDI++MI+DAE +AD+DKK+KE+VE++N+LE YAYSLK Q+ DK+KLGAKLS  +K  +  A+DE+I WLE+N  A+ EE+K QKK +E IV P++ KLYQ +G
Sbjct:   29 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETLTRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKLSDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLYQGAG 639          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Match: Hsc70-3 (gene:FBgn0001218 transcript:FBtr0345166)

HSP 1 Score: 946.036 bits (2444), Expect = 0.000e+0
Identity = 484/611 (79.21%), Postives = 545/611 (89.20%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTVIGIDLGTTYSCVGV+K GRVEIIANDQGNRITPSYVAFTA+GERLIGDAAKNQLTTNPENTVFD KR+IGR ++D  VQ D+K FPFKV+ KN+KP + V      K FAPEEISAMVLGKMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG+IAGL V+RIINEPTAAAIAYGLDKK GEKN+LVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKKKGKDI  D RAVQKLRREVEKAKRALS +H  RIEIES ++G+DFSETLTRA+FEELN+DLFRST+KPV+KVL+DA+M K+D++EIVLVGGSTRIPKVQQLVK+FF GKEPSRGINPDEAVA+GAAVQAGV+ G ++T  IVLLDV PLT+GIETVGGVMTKLIPRNTVIPTKKSQVFSTA+DNQ TVTIQVYEGERPMTKDNH LGKFDLTGIP APRG+PQIEV+FEID NGIL+VSAEDKGTGNK KI+I  DQNRL  EDI++MI+DAE +AD+DKK+KE+VE++N+LE YAYSLK Q+ DK+KLGAKLS  +K  +  A+DE+I WLE+N  A+ EE+K QKK +E IV P++ KLYQ +G
Sbjct:   29 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETLTRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKLSDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLYQGAG 639          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Match: Hsc70-3 (gene:FBgn0001218 transcript:FBtr0073609)

HSP 1 Score: 946.036 bits (2444), Expect = 0.000e+0
Identity = 484/611 (79.21%), Postives = 545/611 (89.20%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTVIGIDLGTTYSCVGV+K GRVEIIANDQGNRITPSYVAFTA+GERLIGDAAKNQLTTNPENTVFD KR+IGR ++D  VQ D+K FPFKV+ KN+KP + V      K FAPEEISAMVLGKMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG+IAGL V+RIINEPTAAAIAYGLDKK GEKN+LVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKKKGKDI  D RAVQKLRREVEKAKRALS +H  RIEIES ++G+DFSETLTRA+FEELN+DLFRST+KPV+KVL+DA+M K+D++EIVLVGGSTRIPKVQQLVK+FF GKEPSRGINPDEAVA+GAAVQAGV+ G ++T  IVLLDV PLT+GIETVGGVMTKLIPRNTVIPTKKSQVFSTA+DNQ TVTIQVYEGERPMTKDNH LGKFDLTGIP APRG+PQIEV+FEID NGIL+VSAEDKGTGNK KI+I  DQNRL  EDI++MI+DAE +AD+DKK+KE+VE++N+LE YAYSLK Q+ DK+KLGAKLS  +K  +  A+DE+I WLE+N  A+ EE+K QKK +E IV P++ KLYQ +G
Sbjct:   29 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETLTRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKLSDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLYQGAG 639          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Match: Hsc70-3 (gene:FBgn0001218 transcript:FBtr0073611)

HSP 1 Score: 946.036 bits (2444), Expect = 0.000e+0
Identity = 484/611 (79.21%), Postives = 545/611 (89.20%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTVIGIDLGTTYSCVGV+K GRVEIIANDQGNRITPSYVAFTA+GERLIGDAAKNQLTTNPENTVFD KR+IGR ++D  VQ D+K FPFKV+ KN+KP + V      K FAPEEISAMVLGKMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG+IAGL V+RIINEPTAAAIAYGLDKK GEKN+LVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKKKGKDI  D RAVQKLRREVEKAKRALS +H  RIEIES ++G+DFSETLTRA+FEELN+DLFRST+KPV+KVL+DA+M K+D++EIVLVGGSTRIPKVQQLVK+FF GKEPSRGINPDEAVA+GAAVQAGV+ G ++T  IVLLDV PLT+GIETVGGVMTKLIPRNTVIPTKKSQVFSTA+DNQ TVTIQVYEGERPMTKDNH LGKFDLTGIP APRG+PQIEV+FEID NGIL+VSAEDKGTGNK KI+I  DQNRL  EDI++MI+DAE +AD+DKK+KE+VE++N+LE YAYSLK Q+ DK+KLGAKLS  +K  +  A+DE+I WLE+N  A+ EE+K QKK +E IV P++ KLYQ +G
Sbjct:   29 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETLTRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKLSDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLYQGAG 639          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Match: Hsc70-3 (gene:FBgn0001218 transcript:FBtr0073608)

HSP 1 Score: 946.036 bits (2444), Expect = 0.000e+0
Identity = 484/611 (79.21%), Postives = 545/611 (89.20%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTVIGIDLGTTYSCVGV+K GRVEIIANDQGNRITPSYVAFTA+GERLIGDAAKNQLTTNPENTVFD KR+IGR ++D  VQ D+K FPFKV+ KN+KP + V      K FAPEEISAMVLGKMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG+IAGL V+RIINEPTAAAIAYGLDKK GEKN+LVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKKKGKDI  D RAVQKLRREVEKAKRALS +H  RIEIES ++G+DFSETLTRA+FEELN+DLFRST+KPV+KVL+DA+M K+D++EIVLVGGSTRIPKVQQLVK+FF GKEPSRGINPDEAVA+GAAVQAGV+ G ++T  IVLLDV PLT+GIETVGGVMTKLIPRNTVIPTKKSQVFSTA+DNQ TVTIQVYEGERPMTKDNH LGKFDLTGIP APRG+PQIEV+FEID NGIL+VSAEDKGTGNK KI+I  DQNRL  EDI++MI+DAE +AD+DKK+KE+VE++N+LE YAYSLK Q+ DK+KLGAKLS  +K  +  A+DE+I WLE+N  A+ EE+K QKK +E IV P++ KLYQ +G
Sbjct:   29 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKEGEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETLTRAKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQDTDAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQVFSTASDNQHTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGIPQIEVSFEIDANGILQVSAEDKGTGNKEKIVITNDQNRLTPEDIDRMIRDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKLSDDEKNKLESAIDESIKWLEQNPDADPEEYKKQKKDLEAIVQPVIAKLYQGAG 639          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 970.689 bits (2508), Expect = 0.000e+0
Identity = 490/612 (80.07%), Postives = 555/612 (90.69%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGN-EVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTVIGIDLGTTYSCVGV+K GRVEIIANDQGNRITPSYVAFT EGERLIGDAAKNQLT+NPENTVFD KR+IGR + D +VQ D+K+FPFKVI K NKP +++ +G+ ++K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDK+ GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKRALS  H ARIEIES ++GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL+D+++KK DI+EIVLVGGSTRIPK+QQLVKEFFNGKEPSRGINPDEAVA+GAAVQAGV+ G EETGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  EDIE+M+ +AE +AD+DKK+KE+++++N+LE YAYSLK Q+ DKEKLG KLS  DKE I KAV+E I WLE +Q A+ EEF+ +KK++E++V PI++KLY  +G
Sbjct:   26 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTTEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWGDSSVQQDIKYFPFKVIEKKNKPHIQLDIGSGQMKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKRDGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSAQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKPDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGEEETGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEDIERMVNEAERFADEDKKLKERIDSRNELESYAYSLKNQIGDKEKLGGKLSSEDKEAIEKAVEEKIEWLEAHQDADLEEFQAKKKELEEVVQPIVSKLYGSAG 637          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 396/613 (64.60%), Postives = 489/613 (79.77%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQS 2067
            G  +GIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFD KR+IGR F+D  VQ DMKH+PF VIN N++P V+V+   E KSF PEEIS+MVL KMK IAEAYLGK V++AV+TVPAYFND+QRQAT DAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++++FI  +K+K  KDI+D+KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T+ PVEK L+DA+M K  I++IVLVGGSTRIPK+Q+L++++FNGKE ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQP V IQVYEGER MTKDN+ LGKF+LTGIP APRGVPQIEVTF+ID NGI+ VSA DK TG +NKI I  D+ RL+ EDIE+M+++AE Y  +D   ++KV AKN LE YA+++K+ V D EKL  K+S  DK+ I+   +E I WL+KNQ AE EEF+ Q+K++E +  PI+TKLYQ +
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVED-EKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQSA 614          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 396/613 (64.60%), Postives = 489/613 (79.77%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQS 2067
            G  +GIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFD KR+IGR F+D  VQ DMKH+PF VIN N++P V+V+   E KSF PEEIS+MVL KMK IAEAYLGK V++AV+TVPAYFND+QRQAT DAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++++FI  +K+K  KDI+D+KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T+ PVEK L+DA+M K  I++IVLVGGSTRIPK+Q+L++++FNGKE ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQP V IQVYEGER MTKDN+ LGKF+LTGIP APRGVPQIEVTF+ID NGI+ VSA DK TG +NKI I  D+ RL+ EDIE+M+++AE Y  +D   ++KV AKN LE YA+++K+ V D EKL  K+S  DK+ I+   +E I WL+KNQ AE EEF+ Q+K++E +  PI+TKLYQ +
Sbjct:    9 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVED-EKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQSA 619          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 782.326 bits (2019), Expect = 0.000e+0
Identity = 396/613 (64.60%), Postives = 489/613 (79.77%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQS 2067
            G  +GIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFD KR+IGR F+D  VQ DMKH+PF VIN N++P V+V+   E KSF PEEIS+MVL KMK IAEAYLGK V++AV+TVPAYFND+QRQAT DAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++++FI  +K+K  KDI+D+KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T+ PVEK L+DA+M K  I++IVLVGGSTRIPK+Q+L++++FNGKE ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQP V IQVYEGER MTKDN+ LGKF+LTGIP APRGVPQIEVTF+ID NGI+ VSA DK TG +NKI I  D+ RL+ EDIE+M+++AE Y  +D   ++KV AKN LE YA+++K+ V D EKL  K+S  DK+ I+   +E I WL+KNQ AE EEF+ Q+K++E +  PI+TKLYQ +
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVED-EKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQSA 614          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 782.326 bits (2019), Expect = 0.000e+0
Identity = 396/613 (64.60%), Postives = 489/613 (79.77%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQS 2067
            G  +GIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFD KR+IGR F+D  VQ DMKH+PF VIN N++P V+V+   E KSF PEEIS+MVL KMK IAEAYLGK V++AV+TVPAYFND+QRQAT DAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++++FI  +K+K  KDI+D+KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T+ PVEK L+DA+M K  I++IVLVGGSTRIPK+Q+L++++FNGKE ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQP V IQVYEGER MTKDN+ LGKF+LTGIP APRGVPQIEVTF+ID NGI+ VSA DK TG +NKI I  D+ RL+ EDIE+M+++AE Y  +D   ++KV AKN LE YA+++K+ V D EKL  K+S  DK+ I+   +E I WL+KNQ AE EEF+ Q+K++E +  PI+TKLYQ +
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVED-EKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQSA 614          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Match: nsg1 (neuronal vesicle trafficking associated 1 [Source:Xenbase;Acc:XB-GENE-992527])

HSP 1 Score: 970.304 bits (2507), Expect = 0.000e+0
Identity = 499/644 (77.48%), Postives = 570/644 (88.51%), Query Frame = 1
Query:  139 SMKSITIIFISLLICSIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            +MK   ++   L+  S++AADDD K +      GTV+GIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT EGERLIGDAAKNQLT+NPENTVFD KR+IGR +ND +VQ D+K+ PFKVI +  KP ++V +G+++K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKRALS+ H +RIEIES ++GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL DA++KK DI+EIVLVGGSTRIPK+QQLVKEFFNGKEPSRGINPDEAVA+GAAVQAGV+ G ++TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  E+IE+M+ DAE +A++DKK+KE+++ +N+LE YAYSLK Q+ DKEKLG KLS  DKETI KAV+E I WLE +Q ++ EEFK +KK++E+IV PI+ KLY  +G
Sbjct:    3 TMKLFALVL--LVSASVFAADDDDKRED----VGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKYLPFKVIERKTKPYIQVDIGDQMKTFAPEEISAMVLVKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQSRIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLDDADLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETIEKAVEEKIEWLESHQDSDIEEFKAKKKELEEIVQPIVGKLYGGAG 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Match: nsg1 (neuronal vesicle trafficking associated 1 [Source:Xenbase;Acc:XB-GENE-992527])

HSP 1 Score: 969.918 bits (2506), Expect = 0.000e+0
Identity = 495/636 (77.83%), Postives = 565/636 (88.84%), Query Frame = 1
Query:  163 FISLLICSIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            F+  L+  + A+     +  K+ED GTV+GIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT EGERLIGDAAKNQLT+NPENTVFD KR+IGR +ND +VQ D+K+ PFKVI +  KP ++V +G+++K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKRALS+ H +RIEIES ++GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL DA++KK DI+EIVLVGGSTRIPK+QQLVKEFFNGKEPSRGINPDEAVA+GAAVQAGV+ G ++TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  E+IE+M+ DAE +A++DKK+KE+++ +N+LE YAYSLK Q+ DKEKLG KLS  DKETI KAV+E I WLE +Q ++ EEFK +KK++E+IV PI+ KLY  +G
Sbjct:    6 FLFALVLLVSASVFAADDDDKREDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKYLPFKVIERKTKPYIQVDIGDQMKTFAPEEISAMVLVKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQSRIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLDDADLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETIEKAVEEKIEWLESHQDSDIEEFKAKKKELEEIVQPIVGKLYGGAG 641          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Match: nsg1 (neuronal vesicle trafficking associated 1 [Source:Xenbase;Acc:XB-GENE-992527])

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 499/640 (77.97%), Postives = 569/640 (88.91%), Query Frame = 1
Query:  154 TIIFISLLI-CSIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            T+  + LL+  S++AADDD K +      GTV+GIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT EGERLIGDAAKNQLT+NPENTVFD KR+IGR +ND +VQ D+K+ PFKVI +  KP ++V +G+++K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKRALS+ H +RIEIES ++GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL DA++KK DI+EIVLVGGSTRIPK+QQLVKEFFNGKEPSRGINPDEAVA+GAAVQAGV+ G ++TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  E+IE+M+ DAE +A++DKK+KE+++ +N+LE YAYSLK Q+ DKEKLG KLS  DKETI KAV+E I WLE +Q ++ EEFK +KK++E+IV PI+ KLY  +G
Sbjct:    5 TLFALVLLVSASVFAADDDDKRED----VGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKYLPFKVIERKTKPYIQVDIGDQMKTFAPEEISAMVLVKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQSRIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLDDADLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETIEKAVEEKIEWLESHQDSDIEEFKAKKKELEEIVQPIVGKLYGGAG 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Match: nsg1 (neuronal vesicle trafficking associated 1 [Source:Xenbase;Acc:XB-GENE-992527])

HSP 1 Score: 967.992 bits (2501), Expect = 0.000e+0
Identity = 489/611 (80.03%), Postives = 553/611 (90.51%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTV+GIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT EGERLIGDAAKNQLT+NPENTVFD KR+IGR +ND +VQ D+K+ PFKVI +  KP ++V +G+++K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKRALS+ H +RIEIES ++GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL DA++KK DI+EIVLVGGSTRIPK+QQLVKEFFNGKEPSRGINPDEAVA+GAAVQAGV+ G ++TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  E+IE+M+ DAE +A++DKK+KE+++ +N+LE YAYSLK Q+ DKEKLG KLS  DKETI KAV+E I WLE +Q ++ EEFK +KK++E+IV PI+ KLY  +G
Sbjct:   30 GTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKYLPFKVIERKTKPYIQVDIGDQMKTFAPEEISAMVLVKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQSRIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLDDADLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETIEKAVEEKIEWLESHQDSDIEEFKAKKKELEEIVQPIVGKLYGGAG 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Match: nsg1 (neuronal vesicle trafficking associated 1 [Source:Xenbase;Acc:XB-GENE-992527])

HSP 1 Score: 923.694 bits (2386), Expect = 0.000e+0
Identity = 477/602 (79.24%), Postives = 538/602 (89.37%), Query Frame = 1
Query:  139 SMKSITIIFISLLICSIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKA 1944
            +MK   ++   L+  S++AADDD K +      GTV+GIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT EGERLIGDAAKNQLT+NPENTVFD KR+IGR +ND +VQ D+K+ PFKVI +  KP ++V +G+++K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKRALS+ H +RIEIES ++GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL DA++KK DI+EIVLVGGSTRIPK+QQLVKEFFNGKEPSRGINPDEAVA+GAAVQAGV+ G ++TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  E+IE+M+ DAE +A++DKK+KE+++ +N+LE YAYSLK Q+ DKEKLG KLS  DKETI KA
Sbjct:    3 TMKLFALVL--LVSASVFAADDDDKRED----VGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKYLPFKVIERKTKPYIQVDIGDQMKTFAPEEISAMVLVKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQSRIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLDDADLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETIEKA 598          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Match: Hspa5 (heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95835])

HSP 1 Score: 962.214 bits (2486), Expect = 0.000e+0
Identity = 487/612 (79.58%), Postives = 551/612 (90.03%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGN-EVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTV+GIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT EGERLIGDAAKNQLT+NPENTVFD KR+IGR +ND +VQ D+K  PFKV+ K  KP ++V +G  + K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDK+ GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKRALS+ H ARIEIES ++GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL+D+++KK DI+EIVLVGGSTRIPK+QQLVKEFFNGKEPSRGINPDEAVA+GAAVQAGV+ G ++TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  E+IE+M+ DAE +A++DKK+KE+++ +N+LE YAYSLK Q+ DKEKLG KLS  DKET+ KAV+E I WLE +Q A+ E+FK +KK++E+IV PI++KLY   G
Sbjct:   29 GTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSGG 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Match: Hspa5 (heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95835])

HSP 1 Score: 962.214 bits (2486), Expect = 0.000e+0
Identity = 487/612 (79.58%), Postives = 551/612 (90.03%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGN-EVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTV+GIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT EGERLIGDAAKNQLT+NPENTVFD KR+IGR +ND +VQ D+K  PFKV+ K  KP ++V +G  + K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDK+ GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKRALS+ H ARIEIES ++GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL+D+++KK DI+EIVLVGGSTRIPK+QQLVKEFFNGKEPSRGINPDEAVA+GAAVQAGV+ G ++TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  E+IE+M+ DAE +A++DKK+KE+++ +N+LE YAYSLK Q+ DKEKLG KLS  DKET+ KAV+E I WLE +Q A+ E+FK +KK++E+IV PI++KLY   G
Sbjct:   29 GTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSGG 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 784.252 bits (2024), Expect = 0.000e+0
Identity = 396/611 (64.81%), Postives = 488/611 (79.87%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 2061
            G  +GIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFD KR+IGR F+D  VQ DMKH+PF V+N   +P V+V+   E KSF PEE+S+MVL KMK IAEAYLGK VT+AVVTVPAYFND+QRQAT DAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++++FI  +K+K  KDI+++KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T+ PVEK L+DA++ K  I++IVLVGGSTRIPK+Q+L+++FFNGKE ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQP V IQVYEGER MTKDN+ LGKF+LTGIP APRGVPQIEVTF+ID NGIL VSA DK TG +NKI I  D+ RL+ EDIE+M+++AE Y  +D+K ++KV +KN LE YA+++K  V D EKL  K++  DK+ I+   +E ISWL+KNQ AE EEF+ Q+K++E +  PI+TKLYQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVED-EKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 390/613 (63.62%), Postives = 490/613 (79.93%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKG---GEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXX--XXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 2061
            G  IGIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NT+FD KR+IGR F D TVQ DMKH+PF+V+++  KP V+V+   E+K+F PEEIS+MVL KMK IAEAYLG KV  AV+TVPAYFND+QRQAT DAG I GLNVLRIINEPTAAAIAYGLDKKG   GEKN+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++ +  + +K+K  KDI  +KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T++PVEK L+DA++ K  I EIVLVGGSTRIPK+Q+L+++FFNGKE ++ INPDEAVA+GAAVQA ++     E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQ +V +QVYEGER MTKDN+ LGKFDLTGIP APRGVPQIEVTF+ID NGIL V+A DK TG +NKI I  D+ RL+ +DI++M+++AE Y  +D+  +++V AKN +E Y Y++K  V D EKL  K+S  DK  I+    E I+WL++NQ AE +E++ ++K++E +  PI++KLYQ
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVED-EKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 390/613 (63.62%), Postives = 490/613 (79.93%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKG---GEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXX--XXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 2061
            G  IGIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NT+FD KR+IGR F D TVQ DMKH+PF+V+++  KP V+V+   E+K+F PEEIS+MVL KMK IAEAYLG KV  AV+TVPAYFND+QRQAT DAG I GLNVLRIINEPTAAAIAYGLDKKG   GEKN+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++ +  + +K+K  KDI  +KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T++PVEK L+DA++ K  I EIVLVGGSTRIPK+Q+L+++FFNGKE ++ INPDEAVA+GAAVQA ++     E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQ +V +QVYEGER MTKDN+ LGKFDLTGIP APRGVPQIEVTF+ID NGIL V+A DK TG +NKI I  D+ RL+ +DI++M+++AE Y  +D+  +++V AKN +E Y Y++K  V D EKL  K+S  DK  I+    E I+WL++NQ AE +E++ ++K++E +  PI++KLYQ
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVED-EKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Match: sp|Q16956|BIP_APLCA (Endoplasmic reticulum chaperone BiP OS=Aplysia californica OX=6500 PE=1 SV=1)

HSP 1 Score: 982.245 bits (2538), Expect = 0.000e+0
Identity = 503/611 (82.32%), Postives = 558/611 (91.33%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTVIGIDLGTTYSCVGVFK GRV+IIANDQGNRITPSYVAFTA+GERLIGDAAKNQLT+NPENT+FDVKR+IGR F+DK+VQ D+K +PFKV N NNKP ++   G   +SFAPEEISAMVL KM+ IAE YLGKK+T+AVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV++TNGDTHLGGEDFDQRVM +FIKLYKKKKGKDI  D RAVQKLRREVEKAKRALS+AH  R+EIES +DGEDFSE+LTRA+FEELNMDLFRSTMKPV++VL+DA++K +DI+EIVLVGGSTRIPKVQQLVKE+FNGKEPSRGINPDEAVA+GAAVQAGV+ G E+TGD+VLLDV PLT+GIETVGGVMTKLIPRNTVIPTKKSQ+FSTAADNQPTVTIQVYEGER MTKDNH LGKFDLTGIP APRGVPQIEVTFEIDVNGILKV+AEDKGTG+KN+I+IQ DQNRL+ EDIE+MI DAE YAD+DKKVKEKV+AKN+LE YAYSLK Q+ DKEKLGAKLS  DKE I +AVDEAI WLE N +AE+E F  +K ++E IV PIMTKLY+QSG
Sbjct:   38 GTVIGIDLGTTYSCVGVFKNGRVDIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTSNPENTIFDVKRLIGRTFDDKSVQHDIKFYPFKVTNANNKPHIQAATGEGDRSFAPEEISAMVLSKMRDIAEEYLGKKITNAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVSTNGDTHLGGEDFDQRVMEHFIKLYKKKKGKDIRKDNRAVQKLRREVEKAKRALSSAHQVRLEIESFFDGEDFSESLTRAKFEELNMDLFRSTMKPVKQVLEDADLKTDDIDEIVLVGGSTRIPKVQQLVKEYFNGKEPSRGINPDEAVAYGAAVQAGVLSGEEDTGDLVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQIFSTAADNQPTVTIQVYEGERSMTKDNHLLGKFDLTGIPPAPRGVPQIEVTFEIDVNGILKVTAEDKGTGSKNQIVIQNDQNRLSPEDIERMINDAEKYADEDKKVKEKVDAKNELESYAYSLKNQIGDKEKLGAKLSDEDKEKITEAVDEAIKWLESNAEAESEAFNEKKTELEGIVQPIMTKLYEQSG 648          
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Match: sp|Q90593|BIP_CHICK (Endoplasmic reticulum chaperone BiP OS=Gallus gallus OX=9031 GN=HSPA5 PE=1 SV=1)

HSP 1 Score: 967.222 bits (2499), Expect = 0.000e+0
Identity = 489/612 (79.90%), Postives = 554/612 (90.52%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGN-EVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTV+GIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT EGERLIGDAAKNQLT+NPENTVFD KR+IGR +ND +VQ D+K+ PFKV+ K  KP ++V VG  + K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDK+ GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKRALS+ H ARIEIES ++GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL+D+++KK DI+EIVLVGGSTRIPK+QQLVKEFFNGKEPSRGINPDEAVA+GAAVQAGV+ G ++TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  E+IE+M+ DAE +A++DKK+KE+++A+N+LE YAYSLK Q+ DKEKLG KLS  DKETI KAV+E I WLE +Q A+ E+FK +KK++E++V PI++KLY  +G
Sbjct:   26 GTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKYLPFKVVEKKAKPHIQVDVGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDARNELESYAYSLKNQIGDKEKLGGKLSSEDKETIEKAVEEKIEWLESHQDADIEDFKSKKKELEEVVQPIVSKLYGSAG 637          
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Match: sp|Q0VCX2|BIP_BOVIN (Endoplasmic reticulum chaperone BiP OS=Bos taurus OX=9913 GN=HSPA5 PE=2 SV=1)

HSP 1 Score: 966.452 bits (2497), Expect = 0.000e+0
Identity = 489/612 (79.90%), Postives = 552/612 (90.20%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGN-EVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTV+GIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT EGERLIGDAAKNQLT+NPENTVFD KR+IGR +ND +VQ D+K  PFKV+ K  KP ++V VG  + K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDK+ GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKRALS+ H ARIEIES Y+GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL+D+++KK DI+EIVLVGGSTRIPK+QQLVKEFFNGKEPSRGINPDEAVA+GAAVQAGV+ G ++TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  E+IE+M+ DAE +A++DKK+KE+++ +N+LE YAYSLK Q+ DKEKLG KLS  DKET+ KAV+E I WLE +Q A+ E+FK +KK++E+IV PI++KLY  +G
Sbjct:   29 GTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDVGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAG 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Match: sp|Q91883|BIP_XENLA (Endoplasmic reticulum chaperone BiP OS=Xenopus laevis OX=8355 GN=hspa5 PE=2 SV=1)

HSP 1 Score: 965.681 bits (2495), Expect = 0.000e+0
Identity = 489/611 (80.03%), Postives = 552/611 (90.34%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTV+GIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT EGERLIGDAAKNQLT+NPENTVFD KR+IGR +ND +VQ D+K+ PFKVI K  KP +EV +G+++K+FAPEEISAMVL KMK  AEAYLG+KVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  DKRAVQKLRREVEKAKRALS  H +RIEIES ++GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL D+++KK DI+EIVLVGGSTRIPK+QQLVKE FNGKEPSRGINPDEAVA+GAAVQAGV+ G ++TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  E+IE+M+ DAE +A++DKK+KE+++ +N+LE YAYSLK Q+ DKEKLG KLS  DKETI KAV+E I WLE +Q A+ E+FK +KK++E+IV PI+ KLY  +G
Sbjct:   30 GTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKYLPFKVIEKKTKPYIEVDIGDQMKTFAPEEISAMVLVKMKETAEAYLGRKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRADKRAVQKLRREVEKAKRALSAQHQSRIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLDDSDLKKSDIDEIVLVGGSTRIPKIQQLVKELFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVTDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETIEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIVGKLYGGAG 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Match: sp|P06761|BIP_RAT (Endoplasmic reticulum chaperone BiP OS=Rattus norvegicus OX=10116 GN=Hspa5 PE=1 SV=1)

HSP 1 Score: 965.681 bits (2495), Expect = 0.000e+0
Identity = 488/612 (79.74%), Postives = 552/612 (90.20%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGN-EVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTV+GIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT EGERLIGDAAKNQLT+NPENTVFD KR+IGR +ND +VQ D+K  PFKV+ K  KP ++V +G  + K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDK+ GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKRALS+ H ARIEIES ++GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL+D+++KK DI+EIVLVGGSTRIPK+QQLVKEFFNGKEPSRGINPDEAVA+GAAVQAGV+ G ++TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  E+IE+M+ DAE +A++DKK+KE+++ +N+LE YAYSLK Q+ DKEKLG KLSP DKET+ KAV+E I WLE +Q A+ E+FK +KK++E+IV PI++KLY   G
Sbjct:   28 GTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSPEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSGG 639          
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Match: G8JF14 (Glucose-regulated protein 78 OS=Dugesia japonica OX=6161 GN=grp78 PE=2 SV=2)

HSP 1 Score: 1157.13 bits (2992), Expect = 0.000e+0
Identity = 608/643 (94.56%), Postives = 629/643 (97.82%), Query Frame = 1
Query:  142 MKSITIIFISLLICSIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            MKSIT++ ISLL+C IYAA +++KEKTKKEDYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITP YVAFT+EG+RLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQ+DMKHFPFKV+NKNNKPSVEVQVG+E K+FAPEEISAMVLGKM+ IAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAG IAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVM YF+KLYKKKKGKDI+DDKRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEAVAFGAAVQAGVIGGVEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQV+EGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKI+IQKDQNRLNTEDIEKMIKDAETYADQDKKVKE+VEAKNDLEGYAYSLKTQ+NDKEKLG KLSPSDKE I KA +EAISWLEKNQQA+TEE K QKKKVEDIVTPIMTKLYQQSG
Sbjct:    1 MKSITVLLISLLVCGIYAAGEEEKEKTKKEDYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPPYVAFTSEGDRLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQEDMKHFPFKVVNKNNKPSVEVQVGSETKTFAPEEISAMVLGKMRTIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGTIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMSYFMKLYKKKKGKDISDDKRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEAVAFGAAVQAGVIGGVEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVFEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIVIQKDQNRLNTEDIEKMIKDAETYADQDKKVKERVEAKNDLEGYAYSLKTQINDKEKLGGKLSPSDKEIITKAAEEAISWLEKNQQADTEEMKAQKKKVEDIVTPIMTKLYQQSG 643          
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Match: A0A1I8HNI7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032526g1 PE=3 SV=1)

HSP 1 Score: 1021.54 bits (2640), Expect = 0.000e+0
Identity = 528/650 (81.23%), Postives = 596/650 (91.69%), Query Frame = 1
Query:  118 LIRNLFESMKSITIIFISLLIC---SIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLY 2058
            L+ +  +++ +  + ++++L+C   ++  +D +K ++ KKED GTVIGIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT+EGERLIGDAAKNQLTTNPENT+FDVKRIIGRN+ D  VQ D+K  P+ V+NKN+KP+++VQVG+E K+FAPEEISAMVLGKMK IAE+YLGKKVTHAVVTVPAYFNDAQRQAT DAG+IAGLNV+RIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM YFIKLYKKKKGKD+  D RAVQKLRREVEKAKRALS+AH+AR+EIESLYDGEDFSETLTRARFEELNMDLFRSTMKPV+KVL+DA++KKEDI EIVLVGGSTRIPKVQQLVKEFF+GKEP+RGINPDEAVA+GAAVQAGV+GG E+TGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIP APRGVPQIEVTFEID NGIL+VSAEDKGTGNKNKI+I KDQNRL+ ++IEKMIKDA+T+ADQDKKVKE+VEAKN+LE YAYS+KTQ+ DKEKLG K+S  +K  + KA+  AI WLEKNQQA+TE  K QKK++E +V PI++KLY
Sbjct:    1 LLNSQTQTIMNKQLFYLAMLVCIGLALADSDKEKTDQKKKEDVGTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTSEGERLIGDAAKNQLTTNPENTIFDVKRIIGRNYADDVVQKDIKLLPYTVVNKNSKPAIQVQVGSETKTFAPEEISAMVLGKMKEIAESYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEYFIKLYKKKKGKDLRTDNRAVQKLRREVEKAKRALSSAHTARVEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVQKVLEDADLKKEDIAEIVLVGGSTRIPKVQQLVKEFFSGKEPNRGINPDEAVAYGAAVQAGVLGGAEDTGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPNAPRGVPQIEVTFEIDANGILQVSAEDKGTGNKNKIVINKDQNRLSPDEIEKMIKDADTFADQDKKVKERVEAKNELESYAYSMKTQLADKEKLGGKVSADEKAKMEKAIQAAIDWLEKNQQADTEALKEQKKELEAVVQPIVSKLY 650          
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Match: A0A1I8H5I1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032526g3 PE=3 SV=1)

HSP 1 Score: 1021.54 bits (2640), Expect = 0.000e+0
Identity = 529/641 (82.53%), Postives = 589/641 (91.89%), Query Frame = 1
Query:  157 IIFISLLIC-------SIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLY 2058
            + ++++L+C       S  +AD +K ++ KKED GTVIGIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT+EGERLIGDAAKNQLTTNPENT+FDVKRIIGRN+ D  VQ D+K  P+ V+NKN+KP+++VQVG+E K+FAPEEISAMVLGKMK IAE+YLGKKVTHAVVTVPAYFNDAQRQAT DAG+IAGLNV+RIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM YFIKLYKKKKGKD+  D RAVQKLRREVEKAKRALS+AH+AR+EIESLYDGEDFSETLTRARFEELNMDLFRSTMKPV+KVL+DA++KKEDI EIVLVGGSTRIPKVQQLVKEFF+GKEP+RGINPDEAVA+GAAVQAGV+GG E+TGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIP APRGVPQIEVTFEID NGIL+VSAEDKGTGNKNKI+I KDQNRL+ ++IEKMIKDA+T+ADQDKKVKE+VEAKN+LE YAYS+KTQ+ DKEKLG K+S  +K  + KA+  AI WLEKNQQA+TE  K QKK++E +V PI++KLY
Sbjct:   14 LFYLAMLVCIGLALADSDKSADKEKTDQKKKEDVGTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTSEGERLIGDAAKNQLTTNPENTIFDVKRIIGRNYADDVVQKDIKLLPYTVVNKNSKPAIQVQVGSEAKTFAPEEISAMVLGKMKEIAESYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEYFIKLYKKKKGKDLRTDNRAVQKLRREVEKAKRALSSAHTARVEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVQKVLEDADLKKEDIAEIVLVGGSTRIPKVQQLVKEFFSGKEPNRGINPDEAVAYGAAVQAGVLGGAEDTGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPNAPRGVPQIEVTFEIDANGILQVSAEDKGTGNKNKIVINKDQNRLSPDEIEKMIKDADTFADQDKKVKERVEAKNELESYAYSMKTQLADKEKLGGKVSADEKAKMEKAIQAAIDWLEKNQQADTEALKEQKKELEAVVQPIVSKLY 654          
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Match: A0A267GFX2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032526g2 PE=3 SV=1)

HSP 1 Score: 1021.15 bits (2639), Expect = 0.000e+0
Identity = 527/637 (82.73%), Postives = 589/637 (92.46%), Query Frame = 1
Query:  157 IIFISLLIC---SIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLY 2058
            + ++++L+C   ++  +D +K ++ KKED GTVIGIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT+EGERLIGDAAKNQLTTNPENT+FDVKRIIGRN+ D  VQ D+K  P+ V+NKN+KP+++VQVG+E K+FAPEEISAMVLGKMK IAE+YLGKKVTHAVVTVPAYFNDAQRQAT DAG+IAGLNV+RIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM YFIKLYKKKKGKD+  D RAVQKLRREVEKAKRALS+AH+AR+EIESLYDGEDFSETLTRARFEELNMDLFRSTMKPV+KVL+DA++KKEDI EIVLVGGSTRIPKVQQLVKEFF+GKEP+RGINPDEAVA+GAAVQAGV+GG E+TGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIP APRGVPQIEVTFEID NGIL+VSAEDKGTGNKNKI+I KDQNRL+ ++IEKMIKDA+T+ADQDKKVKE+VEAKN+LE YAYS+KTQ+ DKEKLG K+S  +K  + KA+  AI WLEKNQQA+TE  K QKK++E +V PI++KLY
Sbjct:   14 LFYLAMLVCIGLALADSDKEKTDQKKKEDVGTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTSEGERLIGDAAKNQLTTNPENTIFDVKRIIGRNYADDVVQKDIKLLPYTVVNKNSKPAIQVQVGSEAKTFAPEEISAMVLGKMKEIAESYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEYFIKLYKKKKGKDLRTDNRAVQKLRREVEKAKRALSSAHTARVEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVQKVLEDADLKKEDIAEIVLVGGSTRIPKVQQLVKEFFSGKEPNRGINPDEAVAYGAAVQAGVLGGAEDTGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPNAPRGVPQIEVTFEIDANGILQVSAEDKGTGNKNKIVINKDQNRLSPDEIEKMIKDADTFADQDKKVKERVEAKNELESYAYSMKTQLADKEKLGGKVSADEKAKMEKAIQAAIDWLEKNQQADTEALKEQKKELEAVVQPIVSKLY 650          
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Match: A0A0N5AHC4 (Uncharacterized protein OS=Syphacia muris OX=451379 PE=3 SV=1)

HSP 1 Score: 986.867 bits (2550), Expect = 0.000e+0
Identity = 509/638 (79.78%), Postives = 571/638 (89.50%), Query Frame = 1
Query:  166 ISLLICSI--YAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAE-GERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            + LL+C++   A     KE+  +  YGT+IGIDLGTTYSCVGV+K GRVEIIANDQGNRITPSYVAFT++ GERLIGDAAKNQLT NPENTVFD KR+IGR++ND+TVQDDMK +PFK++NKNNKP V+++V  E K+FAPEEISAMVLGKMK IAEAYLGK+V HAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GE+NILVFDLGGGTFDVS+LTIDNGVFEV+ATNGDTHLGGEDFDQRV+ YFIKLYKKK GKDI  D RAVQKLRREVEKAKRALS  H  R+E+ESLYDGEDFSETLTRA+FEELNMDLFR+T+KPV+KVL+D+++KKED+NEIVLVGGSTRIPKVQQL+KEFFNGKEPSRGINPDEAVA+GAAVQAGVI G E TGDIVLLDV PLTLGIETVGGVMTKLI RNTVIPTKKSQ+FSTAADNQPTVTIQVYEGERPMTKDNH LGKFDLTGIP APRGVPQIEVTFEIDVNGIL V+AEDKGTGNKNKI I  DQNRL+ EDIE+MI DAE +AD+DKKVKE+VEA+N+LE Y+YSLK Q+NDKEKLG KL  SDK+TI +AVDEAISWL+ ++ A  EE + QKK +E  V PI++KLY+ +G
Sbjct:    3 LWLLLCAVGVLALSAFSKEEKSETKYGTIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTSDSGERLIGDAAKNQLTINPENTVFDAKRLIGRDYNDRTVQDDMKVWPFKLVNKNNKPMVQMKVAKESKTFAPEEISAMVLGKMKEIAEAYLGKEVKHAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKKEGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVIEYFIKLYKKKTGKDIRKDTRAVQKLRREVEKAKRALSTQHQVRVEVESLYDGEDFSETLTRAKFEELNMDLFRATLKPVQKVLEDSDLKKEDVNEIVLVGGSTRIPKVQQLIKEFFNGKEPSRGINPDEAVAYGAAVQAGVISGEESTGDIVLLDVNPLTLGIETVGGVMTKLITRNTVIPTKKSQIFSTAADNQPTVTIQVYEGERPMTKDNHILGKFDLTGIPPAPRGVPQIEVTFEIDVNGILHVTAEDKGTGNKNKITITNDQNRLSPEDIERMINDAEKFADEDKKVKEQVEARNELESYSYSLKNQINDKEKLGGKLDESDKKTIEEAVDEAISWLDSHKDASAEELQEQKKDLEGKVQPIISKLYKDAG 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Match: hspa5 (heat shock protein family A (Hsp70) member 5 [Source:NCBI gene;Acc:103030781])

HSP 1 Score: 971.074 bits (2509), Expect = 0.000e+0
Identity = 490/608 (80.59%), Postives = 554/608 (91.12%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVG-NEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLY 2058
            GTV+GIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT+EGERLIGDAAKNQLT+NPENTVFD KR+IGR + D +VQ D+K+FPFKV+ K +KP ++V +G  ++K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKRALS+ H ARIEIES ++GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL+D+++KK +INEIVLVGGSTRIPK+QQLVKEFFNGKEPSRGINPDEAVA+GAAVQAGV+ G E+TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  EDIE+M+ DAE +AD+DKK+KE+++++N+LE YAYSLK QV DKEKLG KLS  DKE I KAV+E I WLE +Q A+ EEF+ +KK++E++V PI++KLY
Sbjct:   26 GTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTSEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWGDSSVQQDVKYFPFKVLEKKSKPHIQVDIGAGQLKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKDGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSEINEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGEEDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEDIERMVNDAERFADEDKKLKERIDSRNELESYAYSLKNQVGDKEKLGGKLSDEDKEAIEKAVEEKIEWLESHQDADLEEFQAKKKELEEVVQPIISKLY 633          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Match: hspa8 (heat shock cognate 71 kDa protein [Source:NCBI gene;Acc:103043364])

HSP 1 Score: 781.556 bits (2017), Expect = 0.000e+0
Identity = 395/613 (64.44%), Postives = 488/613 (79.61%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQS 2067
            G  +GIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NT+FD KR+IGR F+D  VQ DMKH+PF VIN + +P V+V    E KSF PEEIS+MVL KMK IAEAYLGK VT+AV+TVPAYFND+QRQAT DAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++++FI  +K+K  KDI+D+KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T+ PVEK L+DA+M K  I++IVLVGGSTRIPK+Q+L+++FFNGKE ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQP V IQVYEGER MTKDN+ LGKF+LTGIP APRGVPQIEVTF+ID NGI+ VSA DK TG +NKI I  D+ RL+ EDIE+M+++AE Y  +D   ++KV +KN LE YA+++K+ V D EKL  K+S  DK+ I+   +E ISWL+KNQ AE +EF+ Q+K++E +  PI+TKLYQ +
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFDDGVVQSDMKHWPFTVINDSTRPKVQVDYKGEAKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAADKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSSKNSLESYAFNMKSTVED-EKLKGKISDEDKQKIMDKCNEVISWLDKNQTAERDEFEHQQKELEKVCNPIITKLYQSA 614          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Match: hspa8b (heat shock cognate 70 kDa protein-like [Source:NCBI gene;Acc:103047344])

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 396/611 (64.81%), Postives = 488/611 (79.87%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 2061
            G  +GIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFD KR+IGR F+D  VQ DMKH+PF VIN + +P V+V+   E K+F PEEIS+MVL KMK IAEAYLGK VT+AVVTVPAYFND+QRQAT DAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++++FI  +K+K  KDI+D+KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T+ PVEK L+DA++ K  I++IVLVGGSTRIPK+Q+L+++FFNGKE ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQP V IQVYEGER MTKDN+ LGKF+LTGIP APRGVPQIEVTF+ID NGI+ VSA DK TG +NKI I  D+ RL+ E+IE+M++DAE Y  +D   ++KV AKN LE YA+++K+ V D EKL  K+S  DK+ I+   +E ISWL+KNQ AE +EF+ Q+K++E +  PI+TKLYQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFTVINDSTRPKVQVEYKGETKAFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTILIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQDAEKYKAEDDVQRDKVAAKNGLESYAFNMKSTVED-EKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKDEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Match: ENSAMXT00000004733.2 (pep primary_assembly:Astyanax_mexicanus-2.0:20:27541457:27560661:-1 gene:ENSAMXG00000004628.2 transcript:ENSAMXT00000004733.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 391/611 (63.99%), Postives = 487/611 (79.71%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 2061
            GT +GIDLGTTYSCVG+F+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NT+FD KR+IGR F D  VQ DMKH+PFKVI+   +P VEV+   E K+F PEEIS+MVL KMK IAEAYLGK + +AV+TVPAYFND+QRQAT DAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++++FI  +K+K  KDI+D+KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T+ PVEK L+DA++ K  I++IVLVGGSTRIPK+Q+L+++FFNGKE ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQP V IQVYEGER MTKDN+ LGKF+LTGIP APRGVPQIEVTF+ID NGIL VSA DK TG +NKI I  D+ RL+ EDIE+M+++AE Y  +D   ++KV +KN LE YA+++K+ V D +KL  K+S  DK+ I+   +E ISWL+KNQ AE EE++ Q++++E +  PI+TKLYQ
Sbjct:    4 GTAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFEDTVVQSDMKHWPFKVISDGGRPKVEVEYKGETKNFYPEEISSMVLVKMKEIAEAYLGKSINNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKLDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSSKNSLESYAFNMKSTVED-DKLQGKISDEDKQKILDKCNEIISWLDKNQTAEKEEYEHQQQELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Match: hsc70 (heat shock cognate 71 kDa protein-like [Source:NCBI gene;Acc:103045816])

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 391/611 (63.99%), Postives = 490/611 (80.20%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 2061
            G  +GIDLGTTYSCVG+F+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFD KR+IGR F+D  VQ DMKH+PFKV++   KP +EV+   E+K+F PEE+S+MVL KMK I+EAYLGK VT+AV+TVPAYFND+QRQAT DAG IAGLNVLRIINEPTAAAIAYGLDKK GGE+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++++FI  +K+K  KDIT +KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T+ PVEK L+DA++ K  I++IVLVGGSTRIPK+Q+L+++FFNG++ ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQP V IQVYEGER MTKDN+ LGKF+LTGIP APRGVPQIEVTF+ID NGIL VSA DK TG +NKI I  D+ RL+ EDIE+M+++A+ Y  +D+  +EKV +KN LE  A+++K+ V D EKL  K+S  DK+TIV   +E I+WL++NQ AE EE++ Q+K++E +  PI+TKLYQ
Sbjct:    4 GPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDAVVQSDMKHWPFKVVSDGGKPKMEVEYKGEIKTFYPEEVSSMVLTKMKEISEAYLGKPVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKFKKDITGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNSDLFRGTLDPVEKALRDAKLDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEADQYRAEDEAQREKVTSKNTLESLAFNMKSTVED-EKLKDKISAEDKKTIVDKCNEVIAWLDRNQTAEKEEYEHQQKELEKVCNPIITKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 968.378 bits (2502), Expect = 0.000e+0
Identity = 492/608 (80.92%), Postives = 551/608 (90.62%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQV-GNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLY 2058
            GTVIGIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLT+NPENTVFD KR+IGR++ D TVQ D+K +PF V+ K  KP ++V+V   E K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNVLRIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTID+GVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKR LS  H ARI+IES YDG+DFSETLTRA+FEELNMDLFRSTMKPV+KV++D+++KK DI+EIVLVGGSTRIPK+QQLVKE FNGKEPSRGINPDEAVA+GAAVQAGV+ G + TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTAADNQPTVTIQV+EGERPMTKDNH LGKFDLTGIP APRGVPQIEVTFEIDVNGIL+VSAEDKGTGNKNKI I  DQNRL  E+IE+M+ DAE +AD DK+VKE+VEA+N+LE YAYSLK Q+ DKEKLG KLS  D+ET+ KAV++ I+WLE +Q+A+T++FK QKK++E++V PI++KLY
Sbjct:   33 GTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTSNPENTVFDAKRLIGRSWTDPTVQHDIKFWPFTVLEKKGKPHIQVEVIAGESKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDHGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDHRAVQKLRREVEKAKRTLSTQHQARIDIESFYDGDDFSETLTRAKFEELNMDLFRSTMKPVQKVMEDSDLKKTDIDEIVLVGGSTRIPKIQQLVKELFNGKEPSRGINPDEAVAYGAAVQAGVLSGEDNTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTAADNQPTVTIQVFEGERPMTKDNHLLGKFDLTGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKNKITITNDQNRLTPEEIERMVSDAERFADDDKRVKERVEARNELESYAYSLKNQIGDKEKLGGKLSDEDRETVEKAVEDKIAWLEGHQEADTDDFKAQKKELEEVVQPIVSKLY 640          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Match: hspa9 (heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030828-12])

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 316/614 (51.47%), Postives = 423/614 (68.89%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESL----YDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVND-KEKLGAKLSPSDKETIVK--------------AVDEAISWLEKNQQAETEEFKVQKKKV 2022
            G VIGIDLGTT SCV V +G + +++ N +G R TPS VAFTA+GERL+G  AK Q  TNP NT +  KR+IGR F+D  VQ DM +  +K++  +N    +  V    K ++P +I A VL KMK  AE ++G  V +AV+TVPAYFND+QRQAT DAG I+GLNVLR+INEPTAAA+AYGLDK   +K I V+DLGGGTFD+S+L I  GVFEV +TNGDT LGGEDFD  ++ Y +K +K++ G D+T D  A+Q++R   EKAK  LS++    I +  L       +  +  LTR++FE +  DL R T+ P +K LQD E+ K DI +++LVGG TR+PKVQQ V+E F G+ PS+ +NPDEAVA GAA+Q GV+ G  +  D++LLDV PL+LGIET+GGV TKLI RNT IPTKKSQVFSTAAD Q  V I+V++GER M  DN  LG+F L G+P APRGVPQIEVTF+ID NGI+ VSA+DKGTG + +I+IQ     L+ ++IE M+K+AE YA++D++ K++VEA N  EG  + +++++ + K++L A      KE I K              A+ +A S L   QQ+  + F++  KK+
Sbjct:   53 GAVIGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRFDDSDVQKDMNNLSYKIVRASNG---DAWVEAHGKMYSPSQIGAFVLLKMKETAENFMGTSVKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK-ADDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDNALLKYIVKEFKRESGVDLTKDSMALQRVREAAEKAKCELSSSLQTDINLPYLTMDSSGPKHLNMKLTRSQFENIVGDLIRKTIAPCQKALQDGEVAKSDIGDVILVGGMTRMPKVQQTVQEVF-GRAPSKAVNPDEAVAIGAAIQGGVLAG--DVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAGDNKNLGQFTLVGVPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGG-LSKDEIENMVKNAEKYAEEDRRRKDRVEAVNQAEGIVHDIESKMEEFKDQLPADECTKLKEEIAKVRELLTRKDTETGEAIKQAASTL---QQSSLKLFEMAYKKM 655          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Match: hspa14 (heat shock protein 14 [Source:NCBI gene;Acc:565232])

HSP 1 Score: 246.514 bits (628), Expect = 2.702e-73
Identity = 164/518 (31.66%), Postives = 258/518 (49.81%), Query Frame = 1
Query:  247 IGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEK--NILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVC---PLTLGIETVG-------------GVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHF----LGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQ 1734
            +G+ LG+T +CV ++K GR ++IAND G+R+TP+ VAF  + E+++G AAK     N   TV  VKRI+G  F D  VQ  +      VI K+  P   +  G   K     E++ ++L KMK  A   +G     AV+T P  F   Q      A   AG NVLRI++EP AA +A+G+ ++       +LV+ LGG     + + +++G++ V+ +  D  +GGE+F + +  Y    ++K   +D+  + RA+ KL    E AK  LS    +   ++SL+DG DF   +TRARF+ L   LF+ +++P+  +L    +   D  ++VL GGS RIPK+QQL++E F G E    I  DE +A GAA          E G ++  D     P  L IE                   T + P  T +P ++   F  A    P+V + VYEG   + K + F    L +  L  +     G+  I   F +  +G L ++  D+ +G    + ++
Sbjct:    4 VGVHLGSTCACVAIYKDGRADVIANDAGDRVTPAMVAFR-DSEKIVGLAAKQGRIRNATTTVVGVKRILGHRFEDDVVQKYISSSSCPVIEKDGCPVFSINNGTVKKHITRHEVATLILQKMKETALFAVGADAKDAVITTPLNFTTQQVDELRQAAESAGFNVLRILSEPAAALLAFGIGQESSHSKCKVLVYKLGGTCAYATAIEVNSGLYRVLGSVSDDTVGGEEFTEALAEYLATEFQKFHRQDLRGNSRAMMKLHTNAEMAKHVLSTMAISNCFVDSLHDGLDFECNITRARFDSLCSVLFQQSLQPIHDLLAQINLTTSDFQKVVLCGGSARIPKLQQLLQEQFVGSELMCSIPVDEVIALGAAA---------EAGILLGRDAVRFEPEALSIECASLDILVKEQDEAGQDCYTVVFPVGTPLPARRQHTFQ-APGTLPSVLVDVYEG---VAKGSSFEGVHLAQLVLKDLQQQDNGLRDISTVFTMKRDGSLLITCTDQLSGTSETVTVE 507          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Match: hspa13 (heat shock protein 70 family, member 13 [Source:ZFIN;Acc:ZDB-GENE-070410-58])

HSP 1 Score: 242.662 bits (618), Expect = 3.359e-72
Identity = 141/406 (34.73%), Postives = 221/406 (54.43%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFKGG--RVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQ-VGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARI------------------------------------------EIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPD 1326
            ++GIDLGTTY  +GV+  G   VE++A+  G R  PS VA  ++G  L G  A  Q   NP  T++D KR IGR F+   ++ +   + F V   + +    ++  G   ++  PE + A +L +++++AE  LG  V +AV+ VPA F++ QR +T  A  +AGL VLR++NEPTAAA+AYGL ++    ++LV DLGGGT DVSLLT   G+F   A  G+ HLGG+DF QR++ +       + G      +   Q LR   E AK  L++   AR+                                          +++  ++  +  ET+TR  FE LN DLF+  M+P+ +VL+   +  + ++ +VLVGGSTRIP+V++++ ++F G EP   ++P+
Sbjct:   33 IVGIDLGTTYCSIGVYHAGVGEVEVLADADGRRAFPSVVAAGSDGRVLAGFPALQQAADNPHATLYDAKRFIGRAFSPGELEREAGRYQFTVRQVSGEVVFVLRGHGGAEQTVTPEWVGAQMLDQLRLLAEERLGLPVRYAVLAVPAEFDERQRNSTIKAATMAGLEVLRVVNEPTAAALAYGLHEEESVSSVLVVDLGGGTTDVSLLTKQGGMFFTRAMAGNNHLGGQDFTQRLVEHLTGRLADRHGGGRPWGRADTQLLREAAEMAKLELTHNDRARVSLRLSLVFMPDNRPCCVHQETTVYIRRPLCTGGNAHVLFFGLKLKGTHNTVEMDETVTRQEFESLNEDLFQKVMEPIVEVLRSGRLVAKQVDRVVLVGGSTRIPRVRRMLADYF-GSEPDTSVDPE 437          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Match: KAR2 (ATPase involved in protein import into the ER; also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p [Source:SGD;Acc:S000003571])

HSP 1 Score: 783.097 bits (2021), Expect = 0.000e+0
Identity = 407/609 (66.83%), Postives = 493/609 (80.95%), Query Frame = 1
Query:  235 YGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKN-QQAETEEFKVQKKKVEDIVTPIMTKLY 2058
            YGTVIGIDLGTTYSCV V K G+ EI+AN+QGNRITPSYVAFT + ERLIGDAAKNQ+  NP+NT+FD+KR+IG  +ND++VQ D+KH PF V+NK+ KP+VEV V  E K F PEEIS M+LGKMK IAE YLG KVTHAVVTVPAYFNDAQRQAT DAG IAGLNVLRI+NEPTAAAIAYGLDK   E  I+V+DLGGGTFDVSLL+I+NGVFEV AT+GDTHLGGEDFD +++   IK +KKK G D++D+ +A+ KL+RE EKAKRALS+  S RIEI+S  DG D SETLTRA+FEELN+DLF+ T+KPVEKVLQD+ ++K+D+++IVLVGGSTRIPKVQQL++ +F+GK+ S+GINPDEAVA+GAAVQAGV+ G E   DIVLLDV  LTLGIET GGVMT LI RNT IPTKKSQ+FSTA DNQPTV I+VYEGER M+KDN+ LGKF+LTGIP APRGVPQIEVTF +D NGILKVSA DKGTG    I I  D+ RL  E+I++M+++AE +A +D  +K KVE++N LE YA+SLK QVN    LG KL   DKET++ A ++ + WL+ N + A  E+F  + + +  +  PI +KLY
Sbjct:   49 YGTVIGIDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVAFT-DDERLIGDAAKNQVAANPQNTIFDIKRLIGLKYNDRSVQKDIKHLPFNVVNKDGKPAVEVSVKGEKKVFTPEEISGMILGKMKQIAEDYLGTKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPTAAAIAYGLDKSDKEHQIIVYDLGGGTFDVSLLSIENGVFEVQATSGDTHLGGEDFDYKIVRQLIKAFKKKHGIDVSDNNKALAKLKREAEKAKRALSSQMSTRIEIDSFVDGIDLSETLTRAKFEELNLDLFKKTLKPVEKVLQDSGLEKKDVDDIVLVGGSTRIPKVQQLLESYFDGKKASKGINPDEAVAYGAAVQAGVLSGEEGVEDIVLLDVNALTLGIETTGGVMTPLIKRNTAIPTKKSQIFSTAVDNQPTVMIKVYEGERAMSKDNNLLGKFELTGIPPAPRGVPQIEVTFALDANGILKVSATDKGTGKSESITITNDKGRLTQEEIDRMVEEAEKFASEDASIKAKVESRNKLENYAHSLKNQVNG--DLGEKLEEEDKETLLDAANDVLEWLDDNFETAIAEDFDEKFESLSKVAYPITSKLY 654          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Match: SSA1 (ATPase involved in protein folding and NLS-directed nuclear transport; member of HSP70 family; required for ubiquitin-dependent degradation of short-lived proteins; forms chaperone complex with Ydj1p; localized to nucleus, cytoplasm, cell wall; 98% identical to paralog Ssa2p with different functional specificity in propagation of yeast [URE3] prions, vacuolar-mediated degradations of gluconeogenesis enzymes; general targeting factor of Hsp104p to prion fibrils [Source:SGD;Acc:S000000004])

HSP 1 Score: 760.37 bits (1962), Expect = 0.000e+0
Identity = 392/608 (64.47%), Postives = 491/608 (80.76%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXE--ETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 2061
             +GIDLGTTYSCV  F   RV+IIANDQGNR TPS+VAFT + ERLIGDAAKNQ   NP NTVFD KR+IGRNFND  VQ DMKHFPFK+I+ + KP ++V+   E K+F PE+IS+MVLGKMK  AE+YLG KV  AVVTVPAYFND+QRQAT DAG IAGLNVLRIINEPTAAAIAYGLDKKG E+++L+FDLGGGTFDVSLL+I++G+FEV AT GDTHLGGEDFD R++++FI+ +K+K  KD++ ++RA+++LR   E+AKR LS++    +EI+SL++G DF  ++TRARFEEL  DLFRST+ PVEKVL+DA++ K  ++EIVLVGGSTRIPKVQ+LV ++FNGKEP+R INPDEAVA+GAAVQA ++ G E  +T D++LLDV PL+LGIET GGVMTKLIPRN+ IPTKKS++FST ADNQP V IQV+EGER  TKDN+ LGKF+L+GIP APRGVPQIEVTF++D NGIL VSA +KGTG  NKI I  D+ RL+ EDIEKM+ +AE + ++D+K  +++ +KN LE  AYSLK  +++    G KL  +DK+T+ K  +E ISWL+ N  A  EEF  + K+++DI  PIM+KLYQ
Sbjct:    4 AVGIDLGTTYSCVAHFANDRVDIIANDQGNRTTPSFVAFT-DTERLIGDAAKNQAAMNPSNTVFDAKRLIGRNFNDPEVQADMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKGKEEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEA---GDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQ 607          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Match: SSA2 (HSP70 family ATP-binding protein; involved in protein folding, vacuolar import of proteins; required for ubiquitin-dependent degradation of short-lived proteins; associated with chaperonin-containing T-complex; 98% identical to paralog Ssa1p with distinct functional specificity in propagation of yeast [URE3] prions and vacuolar-mediated degradation of gluconeogenesis enzymes; binds tRNA, has role in tRNA nuclear import during starvation [Source:SGD;Acc:S000003947])

HSP 1 Score: 756.133 bits (1951), Expect = 0.000e+0
Identity = 390/611 (63.83%), Postives = 490/611 (80.20%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXE--ETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
             +GIDLGTTYSCV  F   RV+IIANDQGNR TPS+V FT + ERLIGDAAKNQ   NP NTVFD KR+IGRNFND  VQ DMKHFPFK+I+ + KP ++V+   E K+F PE+IS+MVLGKMK  AE+YLG KV  AVVTVPAYFND+QRQAT DAG IAGLNVLRIINEPTAAAIAYGLDKKG E+++L+FDLGGGTFDVSLL+I++G+FEV AT GDTHLGGEDFD R++++FI+ +K+K  KD++ ++RA+++LR   E+AKR LS++    +EI+SL++G DF  ++TRARFEEL  DLFRST+ PVEKVL+DA++ K  ++EIVLVGGSTRIPKVQ+LV ++FNGKEP+R INPDEAVA+GAAVQA ++ G E  +T D++LLDV PL+LGIET GGVMTKLIPRN+ IPTKKS+VFST ADNQP V IQV+EGER  TKDN+ LGKF+L+GIP APRGVPQIEVTF++D NGIL VSA +KGTG  NKI I  D+ RL+ EDIEKM+ +AE + ++D+K  +++ +KN LE  AYSLK  +++    G KL  +DK+ + K  +E I+WL+ N  A  EEF  Q K+++++  PIM+KLYQ  G
Sbjct:    4 AVGIDLGTTYSCVAHFSNDRVDIIANDQGNRTTPSFVGFT-DTERLIGDAAKNQAAMNPANTVFDAKRLIGRNFNDPEVQGDMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKGKEEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEA---GDKLEQADKDAVTKKAEETIAWLDSNTTATKEEFDDQLKELQEVANPIMSKLYQAGG 610          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 389/611 (63.67%), Postives = 481/611 (78.72%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKG-GEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXE--ETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVND---KEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLY 2058
             +GIDLGTTYSCV  F   RVEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ   NP NTVFD KR+IGR F+D  V  D KHFPFKVI+++ KP V+V+   E K+F PEEIS+MVL KMK  AE YLG  V  AVVTVPAYFND+QRQAT DAG IAG+NVLRIINEPTAAAIAYGLDKKG  E N+L+FDLGGGTFDVSLL+ID GVFEV AT GDTHLGGEDFD R++++    +K+K  KDI++++R++++LR   E+AKRALS++    IEI+SL++G DF  +LTRARFEEL  DLFRST++PVEKVL+D+++ K  I+EIVLVGGSTRIPK+Q+LV +FFNGKEP+R INPDEAVA+GAAVQA ++ G +  +T D++LLDV PL+LGIET GG+MTKLIPRN+ IPTKKS+ FST ADNQP V IQV+EGER  TKDN+ LGKF+L+GIP APRGVPQI+VTF+ID NGIL VSA +KGTG  NKI I  D+ RL+ +DI++M+ +AE Y   D++  E+V+AKN LE YA++LK  +N+   KEK+G      D + +  A  E I WL+ +Q A T+E+K ++K++E I  PIMTK Y
Sbjct:    4 AVGIDLGTTYSCVAHFSNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQAAINPHNTVFDAKRLIGRKFDDPEVTTDAKHFPFKVISRDGKPVVQVEYKGETKTFTPEEISSMVLSKMKETAENYLGTTVNDAVVTVPAYFNDSQRQATKDAGTIAGMNVLRIINEPTAAAIAYGLDKKGRAEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDNRLVNHLATEFKRKTKKDISNNQRSLRRLRTAAERAKRALSSSSQTSIEIDSLFEGMDFYTSLTRARFEELCADLFRSTLEPVEKVLKDSKLDKSQIDEIVLVGGSTRIPKIQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSTKTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIDVTFDIDANGILNVSALEKGTGKSNKITITNDKGRLSKDDIDRMVSEAEKYRADDEREAERVQAKNQLESYAFTLKNTINEASFKEKVGE----DDAKRLETASQETIDWLDASQAASTDEYKDRQKELEGIANPIMTKFY 609          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 388/611 (63.50%), Postives = 481/611 (78.72%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKG-GEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEE--TGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQV---NDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLY 2058
             +GIDLGTTYSCV  F   RVEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ   NP NTVFD KR+IGR F+D  V +D KH+PFKVI+K  KP V+V+   E K+F PEEIS+M+L KMK  AE +LG +V  AVVTVPAYFND+QRQAT DAG IAGLNVLRIINEPTAAAIAYGLDKK   E N+L+FDLGGGTFDVSLL+ID GVFEV AT GDTHLGGEDFD R++++  + +K+K  KD+T ++R++++LR   E+AKR LS++    IEI+SL++G DF  ++TRARFEEL  DLFRST++PVEKVL D+++ K  I+EIVLVGGSTRIPKVQ+LV +FFNGKEP+R INPDEAVA+GAAVQA ++ G +   T D++LLDV PL+LGIET GG+MTKLIPRN+ IPTKKS+VFST ADNQP V IQV+EGER  TKDN+ LGKF+L+GIP APRGVPQIEVTF+ID NGIL VSA +KGTG  NKI I  D+ RL+ EDI+KM+ +AE +  +D++  ++V+AKN LE YA++LK  V   N KEK+G +    D   +  A  +AI+WL+ +Q A TEE+K ++K++E +  PIM+K Y
Sbjct:    4 AVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQAAMNPHNTVFDAKRLIGRKFDDPEVTNDAKHYPFKVIDKGGKPVVQVEYKGETKTFTPEEISSMILTKMKETAENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKSQKEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDSRLVNFLAEEFKRKNKKDLTTNQRSLRRLRTAAERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARFEELCADLFRSTLEPVEKVLADSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSSTTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSNKITITNDKGRLSKEDIDKMVAEAEKFKAEDEQEAQRVQAKNQLESYAFTLKNSVSENNFKEKVGEE----DARKLEAAAQDAINWLDASQAASTEEYKERQKELEGVANPIMSKFY 609          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Match: EDO33296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL5])

HSP 1 Score: 955.281 bits (2468), Expect = 0.000e+0
Identity = 501/639 (78.40%), Postives = 563/639 (88.11%), Query Frame = 1
Query:  142 MKSITIIFISLLICSIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLY 2058
            MK I  I    L  S+  AD  ++ K ++E  GTVIGIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT EGERLIGD AKNQLTTNPENTVFD KR+IGR+++D +VQ+D+K FPFKV++KN KP V+V+V +E+K+FA EEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGL V+RIINEPTAAAIAYG+DKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQ VM +FIKLYKKKKGK+I  D RAVQKLRREVEKAKRALS  H AR+EIES ++GEDFSE LTRARFEELN  LF+ST+KPV+KVL+DA++KK +I+EIVLVGGSTRIPKVQQLVK+FF GKEPSRGINPDEAVA+GAAVQAGV+GG E+TG++VLLDV PLTLGIETVGGVMTKLI RNTVIPTKKSQVFSTAADNQ TVTIQV+EGERPMTKDNH LGKFDL GIP APRGVPQIEVTFEIDVNGIL+VSAEDKGTGNK KI I  DQNRL  EDIE+M+ DAE +AD+DKK KEKVEA+N+LE YAYSLK QV DKEKLG KLS  DK+TI +AV++AISW++KNQ A  E+FK +KK++ED+V PI++KLY
Sbjct:    1 MKCIYTICTLALASSLVFADKKEERKEQREKVGTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEEGERLIGDGAKNQLTTNPENTVFDAKRLIGRSWDDTSVQNDLKFFPFKVVDKNKKPHVQVKVKDEIKTFAAEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLTVMRIINEPTAAAIAYGMDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQNVMEHFIKLYKKKKGKNIRKDNRAVQKLRREVEKAKRALSTQHQARVEIESFFEGEDFSEMLTRARFEELNAKLFKSTLKPVQKVLEDADLKKSEIHEIVLVGGSTRIPKVQQLVKDFFEGKEPSRGINPDEAVAYGAAVQAGVLGGEEDTGEVVLLDVNPLTLGIETVGGVMTKLISRNTVIPTKKSQVFSTAADNQNTVTIQVFEGERPMTKDNHPLGKFDLNGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKEKITITNDQNRLTPEDIERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKEKLGGKLSEDDKKTITEAVEKAISWMDKNQDASVEDFKKEKKELEDVVQPIVSKLY 639          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Match: EDO30323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T144])

HSP 1 Score: 743.036 bits (1917), Expect = 0.000e+0
Identity = 374/610 (61.31%), Postives = 480/610 (78.69%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMK-KEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 2061
             IGIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT E ERL+GDAAKNQ+  NP NT+FD KR+IGR F+D  V+DDMKH+ F+V+N+  +P V+V+   E K+F  EEIS+MVL KMK  AEAYLG KVT AVVTVPAYFND+QRQAT DAG+I+GLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+L+I++G+FEV +T+GDTHLGGEDFD  ++ +F+K +K+K  KDIT +KRA+++LR   E+AKR LS++  A IEI+SLYDG DF  ++TRARFEE+N  LF+ T++PVEK ++D++++ KE I+EIV+VGGSTRIPK+Q L++ FFNGKE ++ INPDEAVA               E T D++LLDV PLTLG+ET GGVMT  I RNT IPTK++Q F+T +DNQ +V IQVYEGER +TKDN+ LGKF+L+GIP APRGVPQI+VTF++D NGIL VSA DK TG +NKI I  D+ RL+ EDIE+M+K+AE +   D+ V+E++++KN LE YA+S+K+ + D EK+  KLS  ++E ++      + WLE NQ AE EE    +K++E +  PI+TKLYQ
Sbjct:    6 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDE-ERLVGDAAKNQVAMNPTNTIFDAKRLIGRRFDDPGVKDDMKHWSFEVVNEAGRPKVKVEYKGETKTFFAEEISSMVLNKMKETAEAYLGCKVTDAVVTVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAIAYGLDKKVGQERNVLIFDLGGGTFDVSVLSIEDGIFEVKSTHGDTHLGGEDFDNNMVDFFVKQFKQKYKKDITPNKRALRRLRTACERAKRTLSSSTQASIEIDSLYDGIDFYTSITRARFEEMNAHLFKKTLEPVEKAIKDSKLESKEKIDEIVMVGGSTRIPKIQSLLQNFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEATQDLLLLDVAPLTLGLETAGGVMTAAIKRNTTIPTKQTQTFTTYSDNQTSVLIQVYEGERSLTKDNNLLGKFELSGIPPAPRGVPQIDVTFDVDSNGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMKSTMED-EKVKDKLSEDEREKVISRCKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITKLYQ 613          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Match: EDO37280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG65])

HSP 1 Score: 733.021 bits (1891), Expect = 0.000e+0
Identity = 378/611 (61.87%), Postives = 488/611 (79.87%), Query Frame = 1
Query:  247 IGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGG-EKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMK--KEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEE--TGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQ 2064
            +GIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAF ++ ERLIGDAAKNQ+  NPENTVFD KR+IGR F+D  V  DM H+PF VI +  +P ++V+   E KSF PEEIS+MVL KMK  AEAYLG KVT AVVTVPAYFND+QRQAT DAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+L++DLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD +++ +F+K +K+K  KDIT +KRA+++LR   E+AKR LS++  A IEI+SL++G DF  ++TRARFEELN DLF+ T +PVE+ ++D+++   KE I++IVLVGGSTRIPK+Q++++E F GKE ++ INPDEAVA+GAAVQA ++ G ++    D++LLDV PL++GIET GGVM+ LI RN+ IPTK++Q F+T +DNQP V IQV+EGER MT  N+ LGKF+LTGIP APRGVPQIEVTF+ID NGIL VSA DK TG +NKI I  D+ RL+ EDIE+M+ +A  Y ++D+K +++++ KN LE YAYS+K+ V D +K+  K+S  DK+ I+    E + WL+ NQ AE +EF+  +K++E +  PI+TKLYQQ
Sbjct:    7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-SDTERLIGDAAKNQVAMNPENTVFDAKRLIGRKFDDPVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFPEEISSMVLTKMKETAEAYLGAKVTDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGVERNVLIYDLGGGTFDVSVLTIEDGIFEVKSTAGDTHLGGEDFDNKMVDHFVKQFKQKYKKDITPNKRAMRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNQDLFKKTTEPVEQAIRDSKIPGGKESIHDIVLVGGSTRIPKIQKMLQELFGGKELNKSINPDEAVAYGAAVQAAILHGDKDDTVKDLLLLDVAPLSMGIETAGGVMSVLIKRNSTIPTKQTQTFTTYSDNQPGVLIQVFEGERSMTAHNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSMKSTVED-DKVKDKISEEDKKAILDKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITKLYQQ 615          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Match: EDO44530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV88])

HSP 1 Score: 727.243 bits (1876), Expect = 0.000e+0
Identity = 374/613 (61.01%), Postives = 485/613 (79.12%), Query Frame = 1
Query:  244 VIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNG-VFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXX--XXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
             IGIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYV FT + ERL+GDAAKNQ+  NPENT+FD KR+IGR ++D TVQ DMK +PFK+I+ NNKP ++V+   E K+FA EEIS+MVLGKMK  AEAYLG+KVT AV+TVPAYFND+QRQAT DAG IAGLNVLR+INEPTAAA+AYGLDK   GEKN+L+FDLGGGTFDVS+LTID+G +FEV +T GDTHLGGEDFD R++++F+  +K+K  KD++ + RA+++LR   E+AKR LS++  A IE++SL++G DF   ++RARFE+L  DLF S + PV K L DA+  K DI+E+VLVGGSTR+PK+Q++++E+F+GK  ++ INPDEAVA+GAAVQA        +E  D++L+DV PL+LGIET G VMTKLI RN  IPTK +Q F+T +DNQP VTI+V+EGERP+TK N+ LGKFDL+GIP APRGVPQIEVTF+ID NGIL VSA+DK TG    I I  D+ RL+ E+I++MI DAE Y  +D+  +EK+ A+N LE YA+ +K+ +++   L  KLS SDK+T+   V+E ++WLEKN  AE EEF+ Q+K+++ + +PIM K++  SG
Sbjct:    6 AIGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFT-DTERLVGDAAKNQVALNPENTIFDAKRLIGRRYDDATVQSDMKLWPFKIISDNNKPKIQVEYKGERKTFAAEEISSMVLGKMKETAEAYLGQKVTSAVITVPAYFNDSQRQATKDAGTIAGLNVLRVINEPTAAALAYGLDKSLSGEKNVLIFDLGGGTFDVSILTIDDGSLFEVKSTAGDTHLGGEDFDNRLVNHFVAEFKRKYKKDMSKNSRAMRRLRTACERAKRTLSSSTEASIEVDSLFEGIDFYTKISRARFEDLCSDLFLSCLDPVNKALSDAKFSKSDIHEVVLVGGSTRVPKIQKMLEEYFSGKSLNKSINPDEAVAYGAAVQAAILSGDKSDEVKDVLLVDVAPLSLGIETAGEVMTKLIERNARIPTKATQTFTTYSDNQPAVTIRVFEGERPLTKHNNLLGKFDLSGIPPAPRGVPQIEVTFDIDANGILNVSAKDKSTGKTGSITITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISEPS-LEGKLSQSDKDTVKNKVEEVLNWLEKNSLAEKEEFEEQEKELQRVCSPIMAKVHGGSG 616          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Match: EDO47723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLN7])

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 309/575 (53.74%), Postives = 402/575 (69.91%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSE------TLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVND-KEKLGAKLSPSDKETIVK 1941
            G V GIDLGTT SCV V  G   ++I N +G+R TPS VAFT EGERL+G  A+ Q  TNP+NT++  KR IGR F+   ++ D+K+  +K++  +N  +     G   K ++P ++ A VL KMK  AE+YLG  V +AVVTVPAYFND+QRQAT DAG IAGLNVLR+INEPTAAA+AYG+DK   +K I V+DLGGGTFD+S+L I  GVFEV ATNGDT+LGGEDFD  ++ + I  +KK+ G D++ D  A+Q+LR   EKAK  LS+  S + +I   Y   D S        L+R++FE L  DL   T+ P +K LQDAE+ K +I +++LVGG TR+PKVQQ V++ F G+ PS+ +NPDEAVA GAA+Q GV+ G  +  D++LLDV PL+LGIET+GGV TKLI RNT IPTKKSQVFSTAAD Q  V I+V++GER M  DN  LG+F L GIP APRGVPQ+EVTF+ID NGI+ VSA DKGTG + +I+IQ     L+ + IE MIK+AE YA+ DK+ KE  EA N  EG  +  +T++ + K++L ++     KE I K
Sbjct:   12 GAVCGIDLGTTNSCVAVMDGKTPKVIENAEGSRTTPSVVAFTPEGERLVGAPARRQAITNPQNTLYATKRYIGRRFDAPEIKKDLKNVSYKIVRASNGDAWFEVAG---KVYSPSQVGAFVLMKMKETAESYLGTNVNNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDKTE-DKIIAVYDLGGGTFDISILEIQKGVFEVKATNGDTYLGGEDFDNTLLKFLIAEFKKESGVDLSKDSMALQRLREAAEKAKIELSS--SVQTDINLPYITVDASGPKHLNMKLSRSKFESLVADLINRTVGPCKKCLQDAEINKGEIGDVLLVGGMTRMPKVQQTVQDIF-GRVPSKAVNPDEAVAIGAAIQGGVLAG--DVKDVLLLDVTPLSLGIETLGGVFTKLITRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAIDNKLLGQFQLVGIPPAPRGVPQVEVTFDIDANGIVNVSARDKGTGREQQIVIQSSGG-LSKDAIENMIKEAEKYAEADKQKKETTEAVNQAEGMIHDTETKMEEFKDQLPSEEVEKLKEEIAK 576          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Match: hspa5 (heat shock protein family A (Hsp70) member 5 [Source:NCBI gene;Acc:101157378])

HSP 1 Score: 976.082 bits (2522), Expect = 0.000e+0
Identity = 492/612 (80.39%), Postives = 558/612 (91.18%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGN-EVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTVIGIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT+EGERLIGDAAKNQLT+NPENTVFD KR+IGR++ D +VQ D+K+FPFKVI K +KP +++ +G  ++K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKRALS  H ARIEIES ++GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL+D+++KK +I+EIVLVGGSTRIPK+QQLVKEFFNGKEPSRGINPDEAVA+GAAVQAGV+ G E+TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  EDIE+M+ DAE +AD+DK++KE+++A+N+LE YAYSLK Q+ DKEKLG KLS  DKETI KAV+E I W+E +Q AETE+F+ +KK++E++V PI+TKLY  +G
Sbjct:   26 GTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTSEGERLIGDAAKNQLTSNPENTVFDAKRLIGRSWGDSSVQQDIKYFPFKVIEKKSKPHIQIDIGGGQMKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKDGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSAQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSEIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGEEDTGDVVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEDIERMVNDAERFADEDKRLKERIDARNELESYAYSLKNQIGDKEKLGGKLSDDDKETIEKAVEEKIEWMESHQDAETEDFQAKKKELEEVVQPIITKLYGSAG 637          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Match: hspa5 (heat shock protein family A (Hsp70) member 5 [Source:NCBI gene;Acc:101157378])

HSP 1 Score: 976.082 bits (2522), Expect = 0.000e+0
Identity = 492/612 (80.39%), Postives = 558/612 (91.18%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGN-EVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            GTVIGIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT+EGERLIGDAAKNQLT+NPENTVFD KR+IGR++ D +VQ D+K+FPFKVI K +KP +++ +G  ++K+FAPEEISAMVL KMK  AEAYLGKKVTHAVVTVPAYFNDAQRQAT DAG IAGLNV+RIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM +FIKLYKKK GKD+  D RAVQKLRREVEKAKRALS  H ARIEIES ++GEDFSETLTRA+FEELNMDLFRSTMKPV+KVL+D+++KK +I+EIVLVGGSTRIPK+QQLVKEFFNGKEPSRGINPDEAVA+GAAVQAGV+ G E+TGD+VLLDVCPLTLGIETVGGVMTKLIPRNTV+PTKKSQ+FSTA+DNQPTVTI+VYEGERP+TKDNH LG FDLTGIP APRGVPQIEVTFEIDVNGIL+V+AEDKGTGNKNKI I  DQNRL  EDIE+M+ DAE +AD+DK++KE+++A+N+LE YAYSLK Q+ DKEKLG KLS  DKETI KAV+E I W+E +Q AETE+F+ +KK++E++V PI+TKLY  +G
Sbjct:   26 GTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTSEGERLIGDAAKNQLTSNPENTVFDAKRLIGRSWGDSSVQQDIKYFPFKVIEKKSKPHIQIDIGGGQMKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKDGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSAQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSEIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGEEDTGDVVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEDIERMVNDAERFADEDKRLKERIDARNELESYAYSLKNQIGDKEKLGGKLSDDDKETIEKAVEEKIEWMESHQDAETEDFQAKKKELEEVVQPIITKLYGSAG 637          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 399/611 (65.30%), Postives = 489/611 (80.03%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 2061
            G  +GIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFD KR+IGR F+D  VQ DMKH+PF VIN N +P V+V+   E K+F PEEIS+MVL KMK IAEAYLGK VT+AVVTVPAYFND+QRQAT DAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++++FI  +K+K  KDI+D+KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T+ PVEK L+DA+M K  I++IVLVGGSTRIPK+Q+L+++FFNGKE ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T ADNQP V IQV+EGER MTKDN+ LGKFDLTGIP APRGVPQIEVTF+ID NGI+ VSA DK TG +NKI I  D+ RL+ EDIE+M+++AE Y  +D   +EKV AKN LE YA+++K+ V ++EKL  K+S  D++ I+   +E ISWL++NQ AE EEF+ Q+K++E +  PIMTKLYQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPNNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVINDNTRPKVKVEYKGETKTFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILCGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYADNQPGVLIQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQREKVSAKNGLESYAFNMKSTV-EEEKLKDKISEDDRKKILDKCNEVISWLDRNQSAEKEEFEHQQKELEKVCNPIMTKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 783.867 bits (2023), Expect = 0.000e+0
Identity = 391/611 (63.99%), Postives = 494/611 (80.85%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 2061
            G  +GIDLGTTYSCVG+F+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFD KR+IGR F+D  VQ DMKH+PFKV+N ++KP VEV+   E+K+F PEEIS+MVL KMK I+EAYLGK VT+AV+TVPAYFND+QRQAT DAG IAGLNVLRIINEPTAAAIAYGLDKK GGE+N+L+FDLGGGTFDVS+LTI++G+FEV AT GDTHLGGEDFD R++++FI  +K+K  K+IT++KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T++PVEK L+DA+M K  I+++VLVGGSTRIPK+Q+L+++ FNG++ ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQP V IQVYEGER MTKDN+ LGKF+LTGIP APRGVPQIEVTF+ID NGIL VSA DK TG +NKI I  D+ RL+ EDIE+M+++AE +  +D+  ++K+ AKN LE  A+++K+ V+D EKL  K+S  DK+TIV   +E I+WL+KNQ AE +E++ Q+K++E +  PI++KLYQ
Sbjct:    4 GPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPANTVFDAKRLIGRKFDDAVVQSDMKHWPFKVVNDSSKPKVEVEYKGEIKTFYPEEISSMVLTKMKEISEAYLGKSVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFITEFKRKFKKEITNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDFYTSITRARFEELNADLFRGTIEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDESQRDKITAKNSLESLAFNMKSTVDD-EKLQDKISSEDKKTIVDKCNEIIAWLDKNQMAEKDEYEHQQKELEKVCNPIISKLYQ 612          
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 781.941 bits (2018), Expect = 0.000e+0
Identity = 396/610 (64.92%), Postives = 487/610 (79.84%), Query Frame = 1
Query:  247 IGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQS 2067
            IGIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFD KR+IGR F+D  VQ DMKH+PF VIN N +P V+V+   E KSF PEEIS+MVL KMK IAEAYLGK V +AV+TVPAYFND+QRQAT DAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++++FI  +K+K  KDI+D+KRAV++LR   E+AKR LS++  A IEI+SLY+G DF  ++TRARFEELN DLFR T+ PVEK L+DA+M K  I++IVLVGGSTRIPK+Q+L+++FFNGKE ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQP V IQVYEGER MTKDN+ LGKF+LTGIP APRGVPQIEVTF+ID NGI+ VSA DK TG +NKI I  D+ RL+ EDIE+M+++AE Y  +D   ++KV AKN LE YA+++K+ V D EKL  K+S  DK+ I+   +E ISWL+KNQ AE +E++ Q+K++E +  PI+TKLYQ +
Sbjct:    4 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVED-EKLAGKISDEDKQKILDKCNEVISWLDKNQTAERDEYEHQQKELEKVCNPIITKLYQSA 611          
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Match: SMESG000062699.1 (SMESG000062699.1)

HSP 1 Score: 1180.62 bits (3053), Expect = 0.000e+0
Identity = 643/643 (100.00%), Postives = 643/643 (100.00%), Query Frame = 1
Query:  142 MKSITIIFISLLICSIYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            MKSITIIFISLLICSIYAADDDKKEKTKKEDYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIKLYKKKKGKDITDDKRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEAVAFGAAVQAGVIGGVEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG
Sbjct:    1 MKSITIIFISLLICSIYAADDDKKEKTKKEDYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIKLYKKKKGKDITDDKRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEAVAFGAAVQAGVIGGVEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 643          
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Match: SMESG000068215.1 (SMESG000068215.1)

HSP 1 Score: 996.112 bits (2574), Expect = 0.000e+0
Identity = 527/640 (82.34%), Postives = 583/640 (91.09%), Query Frame = 1
Query:  163 FISLLICS----IYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            FI +++C      YA ++ K  ++ K+DYGTVIGIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT E ERLIGDAAKNQLT+NPENT+FDVKR IGR F+D+TV+ D+K++PF VINKNNKP V+V+VG E + FAPEEISAMVLGKMK IAE+YLGK+VTHAVVTVPAYFNDAQRQAT DAG I+GLNVLRIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM YFIKLY+KK GKD+  D RAVQKLRREVEKAKR+LSN+HSARI+IES YDG+DFSETLTRARFEELNMDLF++TMKPVEKVLQD+++KKED++EIVLVGGSTRIPK+QQLVKE F+GKEPSRGINPDEAVAFGAAVQAGVIGG EETGD+VLLDVCPLTLGIETVG VMTKLIPRNTVIPTKKSQ+FSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKI+I KDQNRL+ E+IEKMI DAE +A+ DKK+K+KVEAKN+LEGYAYSLKTQVNDK KLG KLS  +++ I+ A  E ISWLEKN QAE EEFK +KKK+EDI  PI++K YQQ G
Sbjct:    6 FICIILCINVVISYATENKKDSESPKDDYGTVIGIDLGTTYSCVGVFKSGRVEIIANDQGNRITPSYVAFTQESERLIGDAAKNQLTSNPENTIFDVKRFIGRGFDDETVKQDIKNYPFLVINKNNKPHVQVKVGEENRIFAPEEISAMVLGKMKEIAESYLGKRVTHAVVTVPAYFNDAQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDYFIKLYRKKHGKDVRKDNRAVQKLRREVEKAKRSLSNSHSARIDIESFYDGDDFSETLTRARFEELNMDLFKNTMKPVEKVLQDSDLKKEDVSEIVLVGGSTRIPKIQQLVKELFDGKEPSRGINPDEAVAFGAAVQAGVIGGAEETGDLVLLDVCPLTLGIETVGAVMTKLIPRNTVIPTKKSQIFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIVINKDQNRLSPENIEKMINDAEKFAESDKKLKDKVEAKNELEGYAYSLKTQVNDKTKLGGKLSADEQKIILDAAQETISWLEKNPQAEVEEFKKEKKKLEDIAQPIVSKFYQQEG 645          
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Match: SMESG000068215.1 (SMESG000068215.1)

HSP 1 Score: 995.727 bits (2573), Expect = 0.000e+0
Identity = 527/640 (82.34%), Postives = 583/640 (91.09%), Query Frame = 1
Query:  163 FISLLICS----IYAAXXXXXXXXXXXXYGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            FI +++C      YA ++ K  ++ K+DYGTVIGIDLGTTYSCVGVFK GRVEIIANDQGNRITPSYVAFT E ERLIGDAAKNQLT+NPENT+FDVKR IGR F+D+TV+ D+K++PF VINKNNKP V+V+VG E + FAPEEISAMVLGKMK IAE+YLGK+VTHAVVTVPAYFNDAQRQAT DAG I+GLNVLRIINEPTAAAIAYGLDKK GEKNILVFDLGGGTFDVSLLTIDNGVFEV+ATNGDTHLGGEDFDQRVM YFIKLY+KK GKD+  D RAVQKLRREVEKAKR+LSN+HSARI+IES YDG+DFSETLTRARFEELNMDLF++TMKPVEKVLQD+++KKED++EIVLVGGSTRIPK+QQLVKE F+GKEPSRGINPDEAVAFGAAVQAGVIGG EETGD+VLLDVCPLTLGIETVG VMTKLIPRNTVIPTKKSQ+FSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKI+I KDQNRL+ E+IEKMI DAE +A+ DKK+K+KVEAKN+LEGYAYSLKTQVNDK KLG KLS  +++ I+ A  E ISWLEKN QAE EEFK +KKK+EDI  PI++K YQQ G
Sbjct:    7 FICIILCINVVISYATENKKDSESPKDDYGTVIGIDLGTTYSCVGVFKSGRVEIIANDQGNRITPSYVAFTQESERLIGDAAKNQLTSNPENTIFDVKRFIGRGFDDETVKQDIKNYPFLVINKNNKPHVQVKVGEENRIFAPEEISAMVLGKMKEIAESYLGKRVTHAVVTVPAYFNDAQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDYFIKLYRKKHGKDVRKDNRAVQKLRREVEKAKRSLSNSHSARIDIESFYDGDDFSETLTRARFEELNMDLFKNTMKPVEKVLQDSDLKKEDVSEIVLVGGSTRIPKIQQLVKELFDGKEPSRGINPDEAVAFGAAVQAGVIGGAEETGDLVLLDVCPLTLGIETVGAVMTKLIPRNTVIPTKKSQIFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIVINKDQNRLSPENIEKMINDAEKFAESDKKLKDKVEAKNELEGYAYSLKTQVNDKTKLGGKLSADEQKIILDAAQETISWLEKNPQAEVEEFKKEKKKLEDIAQPIVSKFYQQEG 646          
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Match: SMESG000061528.1 (SMESG000061528.1)

HSP 1 Score: 860.136 bits (2221), Expect = 0.000e+0
Identity = 448/616 (72.73%), Postives = 513/616 (83.28%), Query Frame = 1
Query:  235 YGTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKKG----GEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXXXXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSG 2070
            YGTVIGIDLGTTYSCVG+FK GRVEII NDQGNRITPSY+AFT +GERLIGD+AKNQLTTNP NT+FDVKR+IGR + D +VQ D+ H+PFKVIN +NKP + V +  E KSF PEEISAMVLGKMK IAE YLGKKVTHAVVTVPAYFNDAQRQAT +AGIIAGL VLRIINEPTAAAIAYGLDKK      E  ILVFDLGGGTFDVSLLTID GVFEV+ATNGDTHLGGEDFDQRV+ YF  LYKKKK KD+  D RA+QKLRREVEKAKRALS+  + RIEIESL DGEDFSETLTRA+FEELN DLF+ST+ PVEKVLQDA +KK DI EIVLVGGSTRIPKVQ+LV+ FFNGKEP++GINPDEAVA+GAAVQAGV+ G   TGD++LLDVCPLTLG+E  GGVM KLI RNT IPT K  VF+T  DNQ TVT  VYEGER + KDNHFLG+FDLTGIP APRGVPQIEVTFEID NGILKVSAEDKGTGNK  I+I  D+NRL  EDI+KMIKDAE + ++D+ +K+++EA+++LE Y YS+K Q+NDK KLG K+S  D +    AV + I WL+ N+ A  E++  QK  +E I+ PI++KLY++ G
Sbjct:   34 YGTVIGIDLGTTYSCVGIFKEGRVEIIPNDQGNRITPSYIAFTQDGERLIGDSAKNQLTTNPVNTIFDVKRLIGREWTDSSVQKDITHYPFKVINVDNKPHISVNIKGEEKSFQPEEISAMVLGKMKTIAEEYLGKKVTHAVVTVPAYFNDAQRQATKNAGIIAGLIVLRIINEPTAAAIAYGLDKKAKSEPKEHQILVFDLGGGTFDVSLLTIDQGVFEVVATNGDTHLGGEDFDQRVIDYFSLLYKKKKNKDLKKDIRAIQKLRREVEKAKRALSSVLTTRIEIESLIDGEDFSETLTRAKFEELNADLFKSTLIPVEKVLQDANLKKNDIAEIVLVGGSTRIPKVQELVRGFFNGKEPNKGINPDEAVAYGAAVQAGVLSGDSTTGDLLLLDVCPLTLGMELEGGVMAKLINRNTPIPTIKKDVFTTVVDNQNTVTTAVYEGERQLVKDNHFLGQFDLTGIPPAPRGVPQIEVTFEIDANGILKVSAEDKGTGNKQHIVITNDKNRLKPEDIDKMIKDAEKFKEEDESIKQRIEARSELEQYVYSMKNQLNDKTKLGGKISSDDLKKSNDAVLKVIDWLDLNKSATKEDYIKQKSDIESILNPIVSKLYEKDG 649          
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Match: SMESG000051570.1 (SMESG000051570.1)

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 391/611 (63.99%), Postives = 486/611 (79.54%), Query Frame = 1
Query:  238 GTVIGIDLGTTYSCVGVFKGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDVKRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEISAMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVLRIINEPTAAAIAYGLDKK-GGEKNILVFDLGGGTFDVSLLTIDNGVFEVIATNGDTHLGGEDFDQRVMHYFIXXXXXXXXXXXXXXXRAVQKLRREVEKAKRALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVLQDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEXXX--XXXXXXXXXXXXXEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQIEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAETYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVKAVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQ 2061
            G  IGIDLGTTYSCVGVF+ G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFD KR+IGR F++ +VQ DMKH+ F VIN+  +P + V+   E K+F PEEIS+MVL KMK IAEAYLGK V  AVVTVPAYFND+QRQAT DAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++++FI+ +K+K  KDI+D+KRAV++LR   E+AKR LS++  A +EI+SLY+G DF  ++TRARFEELN DLFRST++PVEK L+DA++ K  I++IVLVGGSTRIPK+Q+L+++ FNGKE ++ INPDEAVA               E   D++LLDV PL+LGIET GGVMT LI RNT IPTK++Q+F+T +DNQP V IQVYEGER MTKDN+ LGKF+L GIP APRGVPQIEVTF+ID NGIL VSA +KGTG +NKI I  D+ RL+ +DIE+M+ +AE Y  +D++ K+++  KN LE YAY +K+ V D EKL  K+S SD++ I+    EAI+WLEKNQQA  EEF+   K++E +  PIMTK+YQ
Sbjct:    3 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVED-EKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 611          
The following BLAST results are available for this feature:
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPA50.000e+079.74heat shock protein family A (Hsp70) member 5 [Sour... [more]
HSPA80.000e+064.65heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA80.000e+064.65heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA80.000e+064.65heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA20.000e+063.78heat shock protein family A (Hsp70) member 2 [Sour... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-30.000e+077.21Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
hsp-30.000e+077.21Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
hsp-30.000e+077.21Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
hsp-30.000e+077.21Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
hsp-30.000e+077.21Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsc70-30.000e+079.21gene:FBgn0001218 transcript:FBtr0073610[more]
Hsc70-30.000e+079.21gene:FBgn0001218 transcript:FBtr0345166[more]
Hsc70-30.000e+079.21gene:FBgn0001218 transcript:FBtr0073609[more]
Hsc70-30.000e+079.21gene:FBgn0001218 transcript:FBtr0073611[more]
Hsc70-30.000e+079.21gene:FBgn0001218 transcript:FBtr0073608[more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa50.000e+080.07heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hspa80.000e+064.60heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+064.60heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+064.60heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+064.60heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsg10.000e+077.48neuronal vesicle trafficking associated 1 [Source:... [more]
nsg10.000e+077.83neuronal vesicle trafficking associated 1 [Source:... [more]
nsg10.000e+077.97neuronal vesicle trafficking associated 1 [Source:... [more]
nsg10.000e+080.03neuronal vesicle trafficking associated 1 [Source:... [more]
nsg10.000e+079.24neuronal vesicle trafficking associated 1 [Source:... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspa50.000e+079.58heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95... [more]
Hspa50.000e+079.58heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95... [more]
Hspa80.000e+064.81heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa20.000e+063.62heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa20.000e+063.62heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q16956|BIP_APLCA0.000e+082.32Endoplasmic reticulum chaperone BiP OS=Aplysia cal... [more]
sp|Q90593|BIP_CHICK0.000e+079.90Endoplasmic reticulum chaperone BiP OS=Gallus gall... [more]
sp|Q0VCX2|BIP_BOVIN0.000e+079.90Endoplasmic reticulum chaperone BiP OS=Bos taurus ... [more]
sp|Q91883|BIP_XENLA0.000e+080.03Endoplasmic reticulum chaperone BiP OS=Xenopus lae... [more]
sp|P06761|BIP_RAT0.000e+079.74Endoplasmic reticulum chaperone BiP OS=Rattus norv... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G8JF140.000e+094.56Glucose-regulated protein 78 OS=Dugesia japonica O... [more]
A0A1I8HNI70.000e+081.23Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H5I10.000e+082.53Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GFX20.000e+082.73Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A0N5AHC40.000e+079.78Uncharacterized protein OS=Syphacia muris OX=45137... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa50.000e+080.59heat shock protein family A (Hsp70) member 5 [Sour... [more]
hspa80.000e+064.44heat shock cognate 71 kDa protein [Source:NCBI gen... [more]
hspa8b0.000e+064.81heat shock cognate 70 kDa protein-like [Source:NCB... [more]
ENSAMXT00000004733.20.000e+063.99pep primary_assembly:Astyanax_mexicanus-2.0:20:275... [more]
hsc700.000e+063.99heat shock cognate 71 kDa protein-like [Source:NCB... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hspa50.000e+080.92heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hspa90.000e+051.47heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
hspa142.702e-7331.66heat shock protein 14 [Source:NCBI gene;Acc:565232... [more]
hspa133.359e-7234.73heat shock protein 70 family, member 13 [Source:ZF... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KAR20.000e+066.83ATPase involved in protein import into the ER; als... [more]
SSA10.000e+064.47ATPase involved in protein folding and NLS-directe... [more]
SSA20.000e+063.83HSP70 family ATP-binding protein; involved in prot... [more]
SSA30.000e+063.67ATPase involved in protein folding and the respons... [more]
SSA40.000e+063.50Heat shock protein that is highly induced upon str... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO332960.000e+078.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303230.000e+061.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372800.000e+061.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445300.000e+061.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477230.000e+053.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa50.000e+080.39heat shock protein family A (Hsp70) member 5 [Sour... [more]
hspa50.000e+080.39heat shock protein family A (Hsp70) member 5 [Sour... [more]
hspa8b0.000e+065.30heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
hsp70-30.000e+063.99heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
hsc700.000e+064.92heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
back to top
BLAST of Endoplasmic reticulum chaperone BiP vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062699.10.000e+0100.00SMESG000062699.1[more]
SMESG000068215.10.000e+082.34SMESG000068215.1[more]
SMESG000068215.10.000e+082.34SMESG000068215.1[more]
SMESG000061528.10.000e+072.73SMESG000061528.1[more]
SMESG000051570.10.000e+063.99SMESG000051570.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025067 ID=SMED30025067|Name=Endoplasmic reticulum chaperone BiP|organism=Schmidtea mediterranea sexual|type=transcript|length=2317bp
CTACGACCAATCAAAATTTCACACGAATATTAGAACACACAATAATTCTC
TTATACGTGTATATATTCATATAAAAGGGATTTATTTATATTATTTCTAT
CATTTCTGTATTGTTCTTTAATACGAAACTTATTTGAATCGATGAAATCG
ATAACAATTATCTTTATTTCATTATTGATTTGCAGTATTTATGCTGCAGA
CGATGATAAAAAGGAGAAAACTAAAAAGGAAGATTATGGAACTGTTATTG
GTATAGATTTGGGAACTACTTATTCATGCGTTGGTGTCTTTAAAGGAGGT
CGTGTAGAAATAATTGCAAACGATCAAGGAAACAGAATCACTCCATCATA
TGTGGCTTTCACTGCTGAAGGTGAAAGGTTGATTGGAGACGCAGCAAAGA
ATCAATTAACTACAAATCCTGAAAATACAGTTTTCGATGTCAAAAGAATT
ATTGGCAGAAATTTCAACGATAAAACTGTTCAGGATGACATGAAGCATTT
TCCATTTAAAGTTATAAACAAAAATAATAAACCAAGTGTGGAAGTTCAGG
TAGGAAATGAAGTTAAATCTTTCGCACCAGAAGAAATATCTGCCATGGTT
TTAGGTAAGATGAAAGTTATAGCTGAGGCTTACTTGGGTAAGAAAGTCAC
TCATGCAGTTGTAACTGTACCTGCATATTTTAATGATGCCCAAAGACAAG
CAACAAGTGATGCTGGAATAATTGCTGGATTGAATGTATTGAGAATTATT
AACGAACCTACAGCAGCGGCCATTGCATATGGATTGGACAAAAAAGGAGG
TGAAAAAAACATTCTTGTATTTGACCTTGGAGGAGGAACTTTTGATGTTT
CATTGTTGACAATCGATAATGGAGTTTTTGAAGTTATTGCAACTAATGGA
GATACTCACTTGGGAGGTGAAGATTTCGATCAAAGAGTAATGCATTACTT
CATTAAATTATACAAGAAAAAGAAAGGAAAGGATATCACCGATGACAAAA
GAGCTGTTCAGAAATTGCGTAGAGAAGTTGAAAAGGCCAAGAGAGCATTG
AGTAATGCACACAGTGCAAGAATTGAAATTGAATCATTATACGATGGTGA
AGATTTCTCAGAAACATTGACAAGAGCTAGATTTGAAGAATTAAACATGG
ATTTGTTTAGATCTACGATGAAACCAGTAGAAAAAGTACTACAGGATGCT
GAAATGAAAAAAGAGGATATTAATGAAATTGTTCTTGTCGGTGGTTCAAC
TAGAATTCCTAAAGTTCAACAGTTAGTTAAAGAATTTTTTAATGGCAAAG
AACCCAGTCGAGGTATTAATCCAGATGAAGCTGTTGCTTTTGGTGCAGCT
GTTCAGGCCGGTGTTATTGGTGGTGTTGAAGAAACCGGAGATATCGTTCT
TTTGGATGTATGCCCATTGACTTTAGGTATTGAAACAGTTGGTGGTGTTA
TGACCAAATTAATTCCAAGAAACACTGTTATTCCTACTAAAAAATCACAA
GTCTTTTCAACAGCAGCTGATAATCAACCAACTGTCACAATTCAGGTTTA
TGAAGGAGAGAGACCTATGACTAAGGATAATCATTTCCTTGGTAAATTTG
ATCTTACTGGCATTCCAGCTGCACCTCGTGGTGTTCCACAAATTGAAGTT
ACATTTGAAATAGATGTTAATGGTATTCTGAAAGTATCAGCGGAAGACAA
AGGTACTGGAAACAAGAACAAAATCATCATTCAAAAAGACCAAAATAGAT
TGAATACTGAAGACATTGAAAAAATGATTAAAGATGCTGAAACATATGCT
GACCAGGATAAGAAAGTGAAAGAAAAGGTTGAAGCTAAAAACGACTTAGA
AGGTTATGCTTATTCATTGAAAACTCAGGTAAATGATAAAGAAAAATTGG
GAGCTAAATTAAGCCCTTCAGACAAAGAAACTATAGTAAAAGCAGTTGAT
GAAGCTATTAGTTGGTTAGAGAAGAATCAACAAGCAGAAACTGAAGAATT
TAAAGTGCAAAAGAAGAAAGTTGAAGATATTGTTACACCAATTATGACCA
AGTTATATCAACAAAGTGGTGCACCTCCTCCCCAACCTGATGATAAGAAA
GACGATGCTAAAACTGAATTGTAATACTTTCACTTTCTCAGATCAAGCTT
TTTAATGTATATATTTTCTGTTATTGTTTTCTAATAAATTCCAATTTCCG
GATGTTTAAGTTTTTGAATTTTCAATCTTTTAATTGAAATAATTTGGTTA
GTCAATTTAGTGTTGTTCAAAAGGAAAGGGTTAATTTTTTATAAATAAAG
GTTTGGAAAGCAAAACA
back to top

protein sequence of SMED30025067-orf-1

>SMED30025067-orf-1 ID=SMED30025067-orf-1|Name=SMED30025067-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=661bp
MKSITIIFISLLICSIYAADDDKKEKTKKEDYGTVIGIDLGTTYSCVGVF
KGGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTTNPENTVFDV
KRIIGRNFNDKTVQDDMKHFPFKVINKNNKPSVEVQVGNEVKSFAPEEIS
AMVLGKMKVIAEAYLGKKVTHAVVTVPAYFNDAQRQATSDAGIIAGLNVL
RIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSLLTIDNGVFEVIA
TNGDTHLGGEDFDQRVMHYFIKLYKKKKGKDITDDKRAVQKLRREVEKAK
RALSNAHSARIEIESLYDGEDFSETLTRARFEELNMDLFRSTMKPVEKVL
QDAEMKKEDINEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGINPDEAVAF
GAAVQAGVIGGVEETGDIVLLDVCPLTLGIETVGGVMTKLIPRNTVIPTK
KSQVFSTAADNQPTVTIQVYEGERPMTKDNHFLGKFDLTGIPAAPRGVPQ
IEVTFEIDVNGILKVSAEDKGTGNKNKIIIQKDQNRLNTEDIEKMIKDAE
TYADQDKKVKEKVEAKNDLEGYAYSLKTQVNDKEKLGAKLSPSDKETIVK
AVDEAISWLEKNQQAETEEFKVQKKKVEDIVTPIMTKLYQQSGAPPPQPD
DKKDDAKTEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0016887ATPase activity
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: biological process
TermDefinition
GO:0031333negative regulation of protein complex assembly
GO:1903895negative regulation of IRE1-mediated unfolded protein response
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000120progenitor cell
PLANA:0000136whole organism
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR042050BIP_NBD
IPR043129ATPase_NBD
IPR013126Hsp_70_fam
IPR029047HSP70_peptide-bd_sf
IPR029048HSP70_C_sf
IPR018181Heat_shock_70_CS
IPR019651Glutamate_DH_NAD-spec
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005788endoplasmic reticulum lumen
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 282..309
NoneNo IPR availablePRINTSPR00301HEATSHOCK70coord: 62..74
score: 80.3
coord: 172..192
score: 87.32
coord: 392..412
score: 69.91
coord: 232..242
score: 79.97
coord: 498..514
score: 75.34
coord: 360..376
score: 78.37
coord: 417..436
score: 74.46
coord: 85..93
score: 65.96
coord: 34..47
score: 82.73
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 214..392
e-value: 7.6E-176
score: 586.3
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 35..405
e-value: 7.6E-176
score: 586.3
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 258..341
e-value: 7.6E-176
score: 586.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 637..660
NoneNo IPR availablePANTHERPTHR19375:SF380ENDOPLASMIC RETICULUM CHAPERONE BIPcoord: 24..647
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.831
IPR029048Heat shock protein 70kD, C-terminal domain superfamilyGENE3DG3DSA:1.20.1270.10coord: 537..641
e-value: 1.5E-31
score: 110.6
IPR029048Heat shock protein 70kD, C-terminal domain superfamilySUPERFAMILYSSF100934Heat shock protein 70kD (HSP70), C-terminal subdomaincoord: 564..647
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilyGENE3DG3DSA:2.60.34.10coord: 406..534
e-value: 1.6E-60
score: 204.5
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilySUPERFAMILYSSF100920Heat shock protein 70kD (HSP70), peptide-binding domaincoord: 413..570
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 35..640
e-value: 3.6E-259
score: 861.0
IPR013126Heat shock protein 70 familyPANTHERPTHR19375HEAT SHOCK PROTEIN 70KDAcoord: 24..647
IPR018181Heat shock protein 70, conserved sitePROSITEPS00297HSP70_1coord: 38..45
IPR018181Heat shock protein 70, conserved sitePROSITEPS00329HSP70_2coord: 226..239
IPR018181Heat shock protein 70, conserved sitePROSITEPS01036HSP70_3coord: 363..377
IPR042050Endoplasmic reticulum chaperone BIP, nucleotide-binding domainCDDcd10241HSPA5-like_NBDcoord: 33..407
e-value: 0.0
score: 788.814
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 220..408
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 33..217