SMED30025065

Overview
NameSMED30025065
Smed IDSMED30025065
Length (bp)1373
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30025065 (SMED30025065) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30025065 (SMED30025065) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30025065 (SMED30025065) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30025065 (SMED30025065) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025065

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 33

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025065h1SMcG0005839 Contig92uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025065h1SMcG0005839 Contig92newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025065h1SMcG0005834 Contig92uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025065h1SMcG0005834 Contig92newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025065h1SMcG0005911 Contig92uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025065h1SMcG0005911 Contig92newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025065h1SMcG0005835 Contig7058uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025065h1SMcG0005835 Contig7058newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025065h1SMcG0005836 Contig7058uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025065h1SMcG0005836 Contig7058newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30025065h1SMcG0005834 Contig9655uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025065h1SMcG0005834 Contig9655newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025065h1SMcG0005839 Contig9655uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025065h1SMcG0005839 Contig9655newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30025065h1SMcG0005834 dd_Smed_v4_8017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025065h1SMcG0005834 dd_Smed_v4_8017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025065h1SMcG0005834 dd_Smed_v4_8017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025065h1SMcG0005834 dd_Smed_v4_8017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025065h1SMcG0005834 dd_Smed_v4_8017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30025065h1SMcG0005840 dd_Smed_v4_4251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025065h1SMcG0005840 dd_Smed_v4_4251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025065h1SMcG0005840 dd_Smed_v4_4251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025065h1SMcG0005840 dd_Smed_v4_4251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30025065h1SMcG0005840 dd_Smed_v4_4251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30025065h1SMcG0005840 dd_Smed_v4_4251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025065h1SMcG0005823 Contig19411newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025065h1SMcG0005823 Contig19411uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025065h1SMcG0005817 Contig10395newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025065h1SMcG0005817 Contig10395uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025065h1SMcG0005834 Contig10395newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025065h1SMcG0005834 Contig10395uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30025065h1SMcG0005834 dd_Smed_v4_8017_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025065h1SMcG0005840 dd_Smed_v4_4251_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30025065 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.009145:30939..33025 -6359
v31.010883:16034..17634 +6301
v31.015331:6099..8767 -6145
v31.017690:5883..8718 -5600
v31.015478:8325..10032 +5119
v31.002942:66822..68518 +4146
v31.005332:40932..42499 -4053
Homology
BLAST of SMED30025065 vs. Planmine SMEST
Match: SMESG000036060.1 (SMESG000036060.1)

HSP 1 Score: 377.867 bits (969), Expect = 2.972e-124
Identity = 228/352 (64.77%), Postives = 252/352 (71.59%), Query Frame = 2
Query:  137 MSFGRASRQVTSSSNILLSKNQFPLTQNKQNXXXXXXXAHNKNRRQISASNSKTTVPSFSSINSPNEINVWNSHKHSTNHFTDLNGKPITYDHNQHTHSPRQYTXXXXXXXXXXXXXXXXGRNAKLKSNADRDKYSDGGGRSRQNSRFHGDNYFSTNSADIYGTMPKWNDDYQSRNRDLHSELDRHERWIERFGEEIEDLRIRSNKSERKYGRLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQS 1192
            MSFGRASRQVTSSSNIL  KNQFPLTQ KQNS SRSSSAHNKNRRQISASNSKT    FSSINSPNE NVWNSHKHSTNHFTDLNGKPI Y  NQHTHSPRQYTSLSEASRISHHSSSSSG+NAKLKSNADR+KYS+GG  SRQNSRFHGDNYF+TNSADIYGTMPKWNDDYQSRNRD HSELDRHER IE FGEEIEDLRIRSNKSERK GR Q++ DDCK KL  SQ RN QLE+ N    +I   + EN   S  +L+++                                       CK LQNE +    Q+  +I +L+  +K+       LQ  +D+CK++ N S
Sbjct:    1 MSFGRASRQVTSSSNILPRKNQFPLTQYKQNSLSRSSSAHNKNRRQISASNSKTIDLGFSSINSPNENNVWNSHKHSTNHFTDLNGKPIAYYQNQHTHSPRQYTSLSEASRISHHSSSSSGKNAKLKSNADRNKYSEGGAGSRQNSRFHGDNYFATNSADIYGTMPKWNDDYQSRNRDWHSELDRHERGIEIFGEEIEDLRIRSNKSERKNGRSQEELDDCKAKLKLSQERNLQLENEN----EIFILEMENSKNSNEKLRSE---------------------------------------CKILQNETN----QYLTRINQLQSALKESKGINLRLQQDFDDCKVKLNHS 305          

HSP 2 Score: 327.791 bits (839), Expect = 5.380e-105
Identity = 183/200 (91.50%), Postives = 191/200 (95.50%), Query Frame = 2
Query:  773 RLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHEEQILQWQTEMKNLTTKYVKLQSERDNLKLLVKEIDKENKILQNNYNKSDKENENLKF 1372
            RLQQDFDDCKVKLNHSQRRNSQLE+AN ++ QI  NQC NCAESTRQLQNQKSKVKKKIEELAK +QLKMENSKSSIEKLK ELN+SVNKCKSLQNENDSNKSQFSGQIGKLELIIK+INEERQILQNKYDECKLRFNQSNHEEQILQWQTEMKNLTTKYV LQS+RDNLKLLVKEID +NKILQNNYNKSDKENENLKF
Sbjct:  290 RLQQDFDDCKVKLNHSQRRNSQLETANQYEHQINRNQCANCAESTRQLQNQKSKVKKKIEELAKYYQLKMENSKSSIEKLKPELNQSVNKCKSLQNENDSNKSQFSGQIGKLELIIKEINEERQILQNKYDECKLRFNQSNHEEQILQWQTEMKNLTTKYVILQSDRDNLKLLVKEIDDKNKILQNNYNKSDKENENLKF 489          

HSP 3 Score: 88.9669 bits (219), Expect = 1.305e-18
Identity = 72/153 (47.06%), Postives = 107/153 (69.93%), Query Frame = 2
Query:  773 RLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHEEQILQWQTEM 1231
            RLQQ+FD    K  HS+R NSQLESAN FKSQ+  ++ EN +E  +QL+N+K   K+K+EE+ KDFQLK ENS  SIEKLK +L++S NK +SLQN+N++ KS F+ QI +L+  +K+ + +   LQ  +++CK +   S  +++ +Q + EM
Sbjct:  510 RLQQEFD---AKSKHSER-NSQLESANLFKSQMDRSRFENNSELIKQLENEKETDKRKVEEITKDFQLKRENSNRSIEKLKLQLSQSENKFQSLQNDNNNIKSGFAAQIEQLQSALKESDRKMGSLQRDFEDCKEKLKHS--QKRNIQLENEM 656          
BLAST of SMED30025065 vs. Planmine SMEST
Match: SMESG000038532.1 (SMESG000038532.1)

HSP 1 Score: 382.874 bits (982), Expect = 9.301e-122
Identity = 263/442 (59.50%), Postives = 294/442 (66.52%), Query Frame = 2
Query:  137 MSFGRASRQVTSSSNILLSKNQFPLTQNKQNXXXXXXXAHNKNRRQISASNSKTTVPSFSSINSPNEINVWNSHKHSTNHFTDLNGKPITYDHNQHTHSPRQYTXXXXXXXXXXXXXXXXGRNAKLKSNADRDKYSDGGGRSRQNSRFHGDNYFSTNSADIYGTMPKWNDDYQSRNRDLHSELDRHERWIERFGEEIEDLRIRSNKSERKYGRLQQDFDDCKVKLNHSQRRNSQLESAN---YFKSQIGTNQCENCAESTRQLQNQ-----------KSKVKK-------------------------------KIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHEEQILQWQTEMKNLTTKYVKLQSERDNLKLLVKEIDKENKILQ 1327
            MSFGRASRQVTSSSNIL SKNQFPLTQ KQNS SRSSSAHNKNRRQISASNSKT VPSFSSINSPNEINVWNSHKHSTNHFTDLN     Y   Q  H+        +   +   +    G N  ++           G RSRQNSR H DNYFSTNSADIYGTMPKWNDDYQSRNRD HSELDRHER IERFGEEIEDLRIRSNKSERK GRLQ++ DDCK KL  SQ RNSQLE+ N     + +   N  E      + LQN+           +S +K+                               KIEELAK +QLKMENSKSSIEKLKSELNKSVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQ+ Y       N+S  E + L++Q +      KY+   +E + L+ ++KE D+ N+ LQ
Sbjct:    1 MSFGRASRQVTSSSNILPSKNQFPLTQYKQNSLSRSSSAHNKNRRQISASNSKTIVPSFSSINSPNEINVWNSHKHSTNHFTDLNDNIHLY---QKLHAFL-IIPAHQVEEMQSLNPMLIGINILIE-----------GARSRQNSRSHRDNYFSTNSADIYGTMPKWNDDYQSRNRDWHSELDRHERGIERFGEEIEDLRIRSNKSERKNGRLQEELDDCKAKLKLSQERNSQLENENEIFILEMENSNNSNEKLRSECKILQNETNQYLAQINQLQSALKESKGINGRLQQDFDDCKNRQDNCKIKNRKLKKKIEELAKYYQLKMENSKSSIEKLKSELNKSVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQSNY-------NKSGEENENLKFQHD------KYL---AEINKLESMLKESDRTNRRLQ 411          

HSP 2 Score: 255.373 bits (651), Expect = 5.241e-75
Identity = 158/222 (71.17%), Postives = 179/222 (80.63%), Query Frame = 2
Query:  707 ERFGEEIEDLRIRSNKSERKYGRLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHEEQILQWQTEMKNLTTKYVKLQSERDNLKLLVKEIDKENKILQNNYNKSDKENENLKF 1372
            +++  EI  L     +S+R   RLQQ+ D    K  HS   NSQLES N ++ QI  NQC NC E  +QLQN+  +VK KIEE+ KDFQLKME+S S+IEKLKSELN+SVNKCKSLQNEND++KS+F  Q  K E IIK+INEERQILQNKYDECKLRFNQSNHE+QILQWQTEMKNLTTKYVKLQSERDNLKLLVKEIDKENKILQNNYNKS +ENENLKF
Sbjct:  387 DKYLAEINKLESMLKESDRTNRRLQQEID---AKSKHSDW-NSQLESTNQYEHQINRNQCTNCEELIKQLQNENERVKSKIEEITKDFQLKMEDSNSTIEKLKSELNQSVNKCKSLQNENDNDKSKFLEQNRKFESIIKEINEERQILQNKYDECKLRFNQSNHEKQILQWQTEMKNLTTKYVKLQSERDNLKLLVKEIDKENKILQNNYNKSGEENENLKF 604          

HSP 3 Score: 93.2041 bits (230), Expect = 8.359e-20
Identity = 76/156 (48.72%), Postives = 99/156 (63.46%), Query Frame = 2
Query:  707 ERFGEEIEDLRIRSNKSERKYGRLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECK 1174
            +++  EI  L     +S+R   RLQQ+FD    K  HS+R NSQLESAN FKSQ+  N+ EN AE  +QL+N+K   KKK+EE+ KDFQLKMENS  SIEKLK        +C++LQN ND           +LE  IK+I++ +QILQ KYD+ K
Sbjct:  607 DKYLAEINKLESVLKESDRTNSRLQQEFD---AKSKHSER-NSQLESANLFKSQMDRNRFENNAELIKQLENEKEIDKKKVEEITKDFQLKMENSNRSIEKLKL-------ECRNLQNAND-----------QLESTIKEIDKGKQILQKKYDDVK 740          

HSP 4 Score: 86.2705 bits (212), Expect = 1.270e-17
Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 3
Query:  432 LQDNIHLYQKLHAFLIIPAHQVEEMQSLNPMLIGINILMEG 554
            L DNIHLYQKLHAFLIIPAHQVEEMQSLNPMLIGINIL+EG
Sbjct:   84 LNDNIHLYQKLHAFLIIPAHQVEEMQSLNPMLIGINILIEG 124          
BLAST of SMED30025065 vs. Planmine SMEST
Match: SMESG000036102.1 (SMESG000036102.1)

HSP 1 Score: 378.637 bits (971), Expect = 3.640e-121
Identity = 252/478 (52.72%), Postives = 295/478 (61.72%), Query Frame = 2
Query:  137 MSFGRASRQVTSSSNILLSKNQFPLTQNKQNXXXXXXXAHNKNRRQISASNSKTTVPSFSSINSPNEINVWNSHKHSTNHFTDLNGKPITYDHNQHTHSPRQYTXXXXXXXXXXXXXXXXGRNAKLKSNADRDKYSDGGGRSRQNSRFHGDNYFSTNSADIYGTMPKWNDDYQSRNRDLHSELDRHERWIERFGEEIEDLRIRSNKSERKYGRLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQS-----------NHEEQI--------------LQ----------------WQTEMKNLTTKYVKLQSERDN-------------------------LKLLVKEIDKENKILQNNYNKSDKENENLKF 1372
            MSFG+ASRQ+T   NIL +KN FPLTQ KQNSSSRSSSAHNKN RQISASNSKT    FSSINSPNEINVWNSHK+STNHFTDLN KPI Y  NQHTHSPRQY+ + EA+RISHHS+SSSGRNAKLKSNADRDKYSDGG RSRQNSRFHGDNYFSTNSADIYGTMP+WN+DYQSRN D HSELDRHER IE FGEEIEDLRIRSNKSERK GRLQ++ DD K KL  SQ RN QLE+ N    +I   + EN   S  +L+++                                       CK LQNE +    Q+  QI +L+  +K+       LQ  +D+CK++ N S            +E QI              LQ                +Q +M+N  +   KL+SE +                          L+L++KEI++E +ILQNNYNKS +ENENLKF
Sbjct:    1 MSFGKASRQLT---NILPNKNSFPLTQYKQNSSSRSSSAHNKNLRQISASNSKTIDLGFSSINSPNEINVWNSHKYSTNHFTDLNVKPIAYYQNQHTHSPRQYSPIPEAARISHHSNSSSGRNAKLKSNADRDKYSDGGARSRQNSRFHGDNYFSTNSADIYGTMPEWNNDYQSRNSDWHSELDRHERGIEIFGEEIEDLRIRSNKSERKNGRLQEELDDWKAKLKLSQERNLQLENEN----EIFILEMENSKNSNEKLRSE---------------------------------------CKILQNETN----QYLAQINQLQSALKESKGINGRLQQDFDDCKVKLNHSQRRNSQLESANQYEHQIGTNKCANCAESTRQLQNQKSKVKKKIEELAKYYQLKMENSKSSIEKLKSELNQSVNKCKSLLNENDSNKSQFSGQIGKLELIIKEINEEKQILQNNYNKSGEENENLKF 428          

HSP 2 Score: 259.225 bits (661), Expect = 1.155e-76
Identity = 152/220 (69.09%), Postives = 170/220 (77.27%), Query Frame = 2
Query:  713 FGEEIEDLRIRSNKSERKYGRLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHEEQILQWQTEMKNLTTKYVKLQSERDNLKLLVKEIDKENKILQNNYNKSDKENENLKF 1372
            F  +IE L+    +S+RK G LQ+DF+DCK KL HSQ RN QLE                         N+ +  K+ IEE+ KDFQLKME+S SS EK+  +LN+S +KCKSLQNEND++KS FSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHE+QILQWQTEMKNLTTKY KLQSERDNLKLLVKEIDKENKILQNNYNKSDKENENLKF
Sbjct:  651 FAAQIEQLQSALKESDRKMGSLQRDFEDCKEKLKHSQERNLQLE-------------------------NEMAVNKRTIEEITKDFQLKMEDSNSSNEKMLLQLNRSEDKCKSLQNENDNDKSHFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHEQQILQWQTEMKNLTTKYDKLQSERDNLKLLVKEIDKENKILQNNYNKSDKENENLKF 845          

HSP 3 Score: 192.2 bits (487), Expect = 5.584e-53
Identity = 131/211 (62.09%), Postives = 146/211 (69.19%), Query Frame = 2
Query:  770 GRLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHEEQILQWQTEMKNLTTKYVKLQSERDNLKL--------------LVKEIDKENKILQNNYNKSDKENE 1360
            GRLQQDFDDCKVKLNHSQRRNSQLESAN ++ QIGTN+C NCAESTRQLQNQKSKVKKKIEELAK +QLKMENSKSSIEKLKSELN+SVNKCKSL NENDSNKSQFSGQIGKLELIIK+INEE+QILQN Y+                              K   E +NLK               ++KE D+ N+ LQ  +    K +E
Sbjct:  286 GRLQQDFDDCKVKLNHSQRRNSQLESANQYEHQIGTNKCANCAESTRQLQNQKSKVKKKIEELAKYYQLKMENSKSSIEKLKSELNQSVNKCKSLLNENDSNKSQFSGQIGKLELIIKEINEEKQILQNNYN------------------------------KSGEENENLKFQCNKYLAEINKLESVLKESDRTNRRLQQEFEAKSKHSE 466          

HSP 4 Score: 104.76 bits (260), Expect = 1.136e-23
Identity = 87/186 (46.77%), Postives = 120/186 (64.52%), Query Frame = 2
Query:  716 GEEIEDLRIRSNK--------------SERKYGRLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHEEQILQWQTEM 1231
            GEE E+L+ + NK              S+R   RLQQ+F+    K  HS+R NSQLESAN FKSQ+  N+ EN AE  +QL+N+K   K+K+EE+ KDFQLKMEN   SIEKLK +L++S NK KSLQNEND+ KS F+ QI +L+  +K+ + +   LQ  +++CK +   S  +E+ LQ + EM
Sbjct:  420 GEENENLKFQCNKYLAEINKLESVLKESDRTNRRLQQEFE---AKSKHSER-NSQLESANLFKSQMDRNRFENNAELIKQLENEKETDKRKVEEIIKDFQLKMENLNRSIEKLKLQLSQSENKFKSLQNENDNIKSGFAAQIEQLQSALKESDRKMGSLQRDFEDCKEKLKHS--QERNLQLENEM 599          
BLAST of SMED30025065 vs. Planmine SMEST
Match: SMESG000036102.1 (SMESG000036102.1)

HSP 1 Score: 379.022 bits (972), Expect = 1.607e-120
Identity = 252/478 (52.72%), Postives = 295/478 (61.72%), Query Frame = 2
Query:  137 MSFGRASRQVTSSSNILLSKNQFPLTQNKQNXXXXXXXAHNKNRRQISASNSKTTVPSFSSINSPNEINVWNSHKHSTNHFTDLNGKPITYDHNQHTHSPRQYTXXXXXXXXXXXXXXXXGRNAKLKSNADRDKYSDGGGRSRQNSRFHGDNYFSTNSADIYGTMPKWNDDYQSRNRDLHSELDRHERWIERFGEEIEDLRIRSNKSERKYGRLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQS-----------NHEEQI--------------LQ----------------WQTEMKNLTTKYVKLQSERDN-------------------------LKLLVKEIDKENKILQNNYNKSDKENENLKF 1372
            MSFG+ASRQ+T   NIL +KN FPLTQ KQNSSSRSSSAHNKN RQISASNSKT    FSSINSPNEINVWNSHK+STNHFTDLN KPI Y  NQHTHSPRQY+ + EA+RISHHS+SSSGRNAKLKSNADRDKYSDGG RSRQNSRFHGDNYFSTNSADIYGTMP+WN+DYQSRN D HSELDRHER IE FGEEIEDLRIRSNKSERK GRLQ++ DD K KL  SQ RN QLE+ N    +I   + EN   S  +L+++                                       CK LQNE +    Q+  QI +L+  +K+       LQ  +D+CK++ N S            +E QI              LQ                +Q +M+N  +   KL+SE +                          L+L++KEI++E +ILQNNYNKS +ENENLKF
Sbjct:    1 MSFGKASRQLT---NILPNKNSFPLTQYKQNSSSRSSSAHNKNLRQISASNSKTIDLGFSSINSPNEINVWNSHKYSTNHFTDLNVKPIAYYQNQHTHSPRQYSPIPEAARISHHSNSSSGRNAKLKSNADRDKYSDGGARSRQNSRFHGDNYFSTNSADIYGTMPEWNNDYQSRNSDWHSELDRHERGIEIFGEEIEDLRIRSNKSERKNGRLQEELDDWKAKLKLSQERNLQLENEN----EIFILEMENSKNSNEKLRSE---------------------------------------CKILQNETN----QYLAQINQLQSALKESKGINGRLQQDFDDCKVKLNHSQRRNSQLESANQYEHQIGTNKCANCAESTRQLQNQKSKVKKKIEELAKYYQLKMENSKSSIEKLKSELNQSVNKCKSLLNENDSNKSQFSGQIGKLELIIKEINEEKQILQNNYNKSGEENENLKF 428          

HSP 2 Score: 259.225 bits (661), Expect = 2.108e-76
Identity = 152/220 (69.09%), Postives = 170/220 (77.27%), Query Frame = 2
Query:  713 FGEEIEDLRIRSNKSERKYGRLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHEEQILQWQTEMKNLTTKYVKLQSERDNLKLLVKEIDKENKILQNNYNKSDKENENLKF 1372
            F  +IE L+    +S+RK G LQ+DF+DCK KL HSQ RN QLE                         N+ +  K+ IEE+ KDFQLKME+S SS EK+  +LN+S +KCKSLQNEND++KS FSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHE+QILQWQTEMKNLTTKY KLQSERDNLKLLVKEIDKENKILQNNYNKSDKENENLKF
Sbjct:  651 FAAQIEQLQSALKESDRKMGSLQRDFEDCKEKLKHSQERNLQLE-------------------------NEMAVNKRTIEEITKDFQLKMEDSNSSNEKMLLQLNRSEDKCKSLQNENDNDKSHFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHEQQILQWQTEMKNLTTKYDKLQSERDNLKLLVKEIDKENKILQNNYNKSDKENENLKF 845          

HSP 3 Score: 192.2 bits (487), Expect = 6.071e-53
Identity = 131/211 (62.09%), Postives = 146/211 (69.19%), Query Frame = 2
Query:  770 GRLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHEEQILQWQTEMKNLTTKYVKLQSERDNLKL--------------LVKEIDKENKILQNNYNKSDKENE 1360
            GRLQQDFDDCKVKLNHSQRRNSQLESAN ++ QIGTN+C NCAESTRQLQNQKSKVKKKIEELAK +QLKMENSKSSIEKLKSELN+SVNKCKSL NENDSNKSQFSGQIGKLELIIK+INEE+QILQN Y+                              K   E +NLK               ++KE D+ N+ LQ  +    K +E
Sbjct:  286 GRLQQDFDDCKVKLNHSQRRNSQLESANQYEHQIGTNKCANCAESTRQLQNQKSKVKKKIEELAKYYQLKMENSKSSIEKLKSELNQSVNKCKSLLNENDSNKSQFSGQIGKLELIIKEINEEKQILQNNYN------------------------------KSGEENENLKFQCNKYLAEINKLESVLKESDRTNRRLQQEFEAKSKHSE 466          

HSP 4 Score: 104.76 bits (260), Expect = 1.248e-23
Identity = 87/186 (46.77%), Postives = 120/186 (64.52%), Query Frame = 2
Query:  716 GEEIEDLRIRSNK--------------SERKYGRLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHEEQILQWQTEM 1231
            GEE E+L+ + NK              S+R   RLQQ+F+    K  HS+R NSQLESAN FKSQ+  N+ EN AE  +QL+N+K   K+K+EE+ KDFQLKMEN   SIEKLK +L++S NK KSLQNEND+ KS F+ QI +L+  +K+ + +   LQ  +++CK +   S  +E+ LQ + EM
Sbjct:  420 GEENENLKFQCNKYLAEINKLESVLKESDRTNRRLQQEFE---AKSKHSER-NSQLESANLFKSQMDRNRFENNAELIKQLENEKETDKRKVEEIIKDFQLKMENLNRSIEKLKLQLSQSENKFKSLQNENDNIKSGFAAQIEQLQSALKESDRKMGSLQRDFEDCKEKLKHS--QERNLQLENEM 599          
BLAST of SMED30025065 vs. Planmine SMEST
Match: SMESG000038532.1 (SMESG000038532.1)

HSP 1 Score: 354.755 bits (909), Expect = 2.085e-111
Identity = 236/433 (54.50%), Postives = 276/433 (63.74%), Query Frame = 2
Query:  137 MSFGRASRQVTSSSNILLSKNQFPLTQNKQNXXXXXXXAHNKNRRQISASNSKTTVPSFSSINSPNEINVWNSHKHSTNHFTDLNGKPITYDHNQHTHSPRQYTXXXXXXXXXXXXXXXXGRNAKLKSNADRDKYSDGGGRSRQNSRFHGDNYFSTNSADIYGTMPKWNDDYQSRNRDLHSELDRHERWIERFGEEIEDLRIRSNKSERKYGRLQQDFDDCKVKLNHSQRRNSQLESAN---YFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAK-----------------DFQLKMXXXXXXXXXXXXXXXXX----VNKC-------KSLQ-----NENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHEEQILQWQTEMKNLTTKYVKLQSERDNLKLLVKEIDKENKILQ 1327
            MSFGRASRQVTSSSNIL SKNQFPLTQ KQNS SRSSSAHNKNRRQISASNSKT VPSFSSINSPNEINVWNSHKHSTNHFTDLN     Y   Q  H+        +   +   +    G N  ++           G RSRQNSR H DNYFSTNSADIYGTMPKWNDDYQSRNRD HSELDRHER IERFGEEIEDLRIRSNKSERK GRLQ++ DDCK KL  SQ RNSQLE+ N     + +   N  E      + LQN+ ++   +I +L                   D ++K+ +S+    +L+S          N+C       + LQ     NENDSNKSQFSGQIGKLELIIKQINEERQILQ+ Y       N+S  E + L++Q +      KY+   +E + L+ ++KE D+ N+ LQ
Sbjct:    1 MSFGRASRQVTSSSNILPSKNQFPLTQYKQNSLSRSSSAHNKNRRQISASNSKTIVPSFSSINSPNEINVWNSHKHSTNHFTDLNDNIHLY---QKLHAFL-IIPAHQVEEMQSLNPMLIGINILIE-----------GARSRQNSRSHRDNYFSTNSADIYGTMPKWNDDYQSRNRDWHSELDRHERGIERFGEEIEDLRIRSNKSERKNGRLQEELDDCKAKLKLSQERNSQLENENEIFILEMENSNNSNEKLRSECKILQNETNQYLAQINQLQSALKESKGINGRLQQDFDDCKVKLNHSQRRNSQLESANQYEHQIGTNQCANCAESTRQLQNQKSKNENDSNKSQFSGQIGKLELIIKQINEERQILQSNY-------NKSGEENENLKFQHD------KYL---AEINKLESMLKESDRTNRRLQ 402          

HSP 2 Score: 255.758 bits (652), Expect = 3.623e-75
Identity = 158/222 (71.17%), Postives = 179/222 (80.63%), Query Frame = 2
Query:  707 ERFGEEIEDLRIRSNKSERKYGRLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQSNHEEQILQWQTEMKNLTTKYVKLQSERDNLKLLVKEIDKENKILQNNYNKSDKENENLKF 1372
            +++  EI  L     +S+R   RLQQ+ D    K  HS   NSQLES N ++ QI  NQC NC E  +QLQN+  +VK KIEE+ KDFQLKME+S S+IEKLKSELN+SVNKCKSLQNEND++KS+F  Q  K E IIK+INEERQILQNKYDECKLRFNQSNHE+QILQWQTEMKNLTTKYVKLQSERDNLKLLVKEIDKENKILQNNYNKS +ENENLKF
Sbjct:  378 DKYLAEINKLESMLKESDRTNRRLQQEID---AKSKHSDW-NSQLESTNQYEHQINRNQCTNCEELIKQLQNENERVKSKIEEITKDFQLKMEDSNSTIEKLKSELNQSVNKCKSLQNENDNDKSKFLEQNRKFESIIKEINEERQILQNKYDECKLRFNQSNHEKQILQWQTEMKNLTTKYVKLQSERDNLKLLVKEIDKENKILQNNYNKSGEENENLKF 595          

HSP 3 Score: 93.2041 bits (230), Expect = 6.767e-20
Identity = 76/156 (48.72%), Postives = 99/156 (63.46%), Query Frame = 2
Query:  707 ERFGEEIEDLRIRSNKSERKYGRLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQCENCAESTRQLQNQKSKVKKKIEELAKDFQLKMXXXXXXXXXXXXXXXXXVNKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECK 1174
            +++  EI  L     +S+R   RLQQ+FD    K  HS+R NSQLESAN FKSQ+  N+ EN AE  +QL+N+K   KKK+EE+ KDFQLKMENS  SIEKLK        +C++LQN ND           +LE  IK+I++ +QILQ KYD+ K
Sbjct:  598 DKYLAEINKLESVLKESDRTNSRLQQEFD---AKSKHSER-NSQLESANLFKSQMDRNRFENNAELIKQLENEKEIDKKKVEEITKDFQLKMENSNRSIEKLKL-------ECRNLQNAND-----------QLESTIKEIDKGKQILQKKYDDVK 731          

HSP 4 Score: 86.2705 bits (212), Expect = 1.333e-17
Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 3
Query:  432 LQDNIHLYQKLHAFLIIPAHQVEEMQSLNPMLIGINILMEG 554
            L DNIHLYQKLHAFLIIPAHQVEEMQSLNPMLIGINIL+EG
Sbjct:   84 LNDNIHLYQKLHAFLIIPAHQVEEMQSLNPMLIGINILIEG 124          
The following BLAST results are available for this feature:
BLAST of SMED30025065 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025065 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025065 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025065 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025065 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025065 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025065 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025065 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025065 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025065 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025065 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025065 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025065 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025065 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036060.12.972e-12464.77SMESG000036060.1[more]
SMESG000038532.19.301e-12259.50SMESG000038532.1[more]
SMESG000036102.13.640e-12152.72SMESG000036102.1[more]
SMESG000036102.11.607e-12052.72SMESG000036102.1[more]
SMESG000038532.12.085e-11154.50SMESG000038532.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025065 ID=SMED30025065|Name=SMED30025065|organism=Schmidtea mediterranea sexual|type=transcript|length=1373bp
ATAAAATTGAATGATTAGTGGTATTTTTATGGAAATTTGATAAATATATT
TTAATAAAATTAAAGGTGTAAAATCATATTTGAATTTCTTGATTTCTTAT
CACAATTTGACGTTATTTTTGCAGCTGTGCGTGTAAATGTCATTTGGTAG
AGCATCAAGACAAGTAACCTCGTCTTCCAATATTCTTCTAAGTAAAAATC
AATTTCCATTAACTCAGAACAAGCAAAACTCATCATCAAGATCTTCATCT
GCACATAATAAAAATAGAAGACAAATCAGTGCTTCTAACAGCAAAACTAC
AGTTCCTAGCTTCTCATCGATAAATTCTCCAAATGAAATTAATGTATGGA
ATTCTCATAAACATTCCACCAATCATTTCACTGATTTAAATGGTAAGCCA
ATCACATATGATCATAATCAACACACTCATTCTCCAAGACAATATACATC
TCTATCAGAAGCTTCACGCATTTCTCATCATTCCAGCTCATCAAGTGGAA
GAAATGCAAAGCTTAAATCCAATGCTGATAGGGATAAATATTCTGATGGA
GGGGGTAGATCGAGGCAAAACAGCAGATTTCATGGAGACAATTACTTTTC
TACCAACTCGGCTGATATTTATGGCACAATGCCCAAGTGGAATGATGATT
ATCAATCACGGAACAGAGATTTGCATTCAGAATTAGATAGGCACGAGAGG
TGGATAGAAAGATTTGGAGAAGAAATAGAGGATTTGAGAATAAGATCGAA
TAAATCAGAAAGAAAATATGGAAGATTGCAGCAAGATTTTGATGATTGCA
AAGTGAAATTGAATCATTCTCAGAGGAGGAATTCACAATTGGAATCTGCA
AATTACTTCAAATCACAAATCGGCACAAATCAATGTGAAAATTGTGCAGA
ATCGACAAGACAATTGCAAAATCAAAAATCGAAAGTTAAAAAAAAAATTG
AAGAACTTGCTAAAGATTTCCAATTGAAAATGGAAAATTCAAAAAGCTCT
ATTGAGAAGTTGAAATCGGAATTGAATAAATCGGTAAACAAATGCAAAAG
CTTGCAGAATGAAAATGATAGCAATAAGTCACAATTTTCAGGACAAATTG
GGAAATTGGAATTAATAATAAAACAAATTAATGAGGAAAGACAAATTCTG
CAAAATAAATATGATGAGTGCAAATTGAGATTCAACCAATCAAATCACGA
GGAACAAATTTTGCAGTGGCAAACCGAAATGAAAAATTTAACAACTAAAT
ATGTTAAATTGCAGTCGGAAAGGGATAATTTGAAATTGTTAGTAAAAGAA
ATTGATAAGGAAAATAAAATTCTTCAAAATAATTATAATAAATCAGACAA
AGAAAATGAAAATTTAAAATTTC
back to top

protein sequence of SMED30025065-orf-1

>SMED30025065-orf-1 ID=SMED30025065-orf-1|Name=SMED30025065-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=412bp
MSFGRASRQVTSSSNILLSKNQFPLTQNKQNSSSRSSSAHNKNRRQISAS
NSKTTVPSFSSINSPNEINVWNSHKHSTNHFTDLNGKPITYDHNQHTHSP
RQYTSLSEASRISHHSSSSSGRNAKLKSNADRDKYSDGGGRSRQNSRFHG
DNYFSTNSADIYGTMPKWNDDYQSRNRDLHSELDRHERWIERFGEEIEDL
RIRSNKSERKYGRLQQDFDDCKVKLNHSQRRNSQLESANYFKSQIGTNQC
ENCAESTRQLQNQKSKVKKKIEELAKDFQLKMENSKSSIEKLKSELNKSV
NKCKSLQNENDSNKSQFSGQIGKLELIIKQINEERQILQNKYDECKLRFN
QSNHEEQILQWQTEMKNLTTKYVKLQSERDNLKLLVKEIDKENKILQNNY
NKSDKENENLKF
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 351..371
NoneNo IPR availableCOILSCoilCoilcoord: 321..348
NoneNo IPR availableCOILSCoilCoilcoord: 379..412
NoneNo IPR availableCOILSCoilCoilcoord: 197..217
NoneNo IPR availableCOILSCoilCoilcoord: 253..277
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 97..151
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..52
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 97..126