Neurobeachin

Overview
NameNeurobeachin
Smed IDSMED30025055
Length (bp)8744
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neurobeachin (SMED30025055) t-SNE clustered cells

Violin plots show distribution of expression levels for Neurobeachin (SMED30025055) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neurobeachin (SMED30025055) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neurobeachin (SMED30025055) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025055

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30025055h1SMcG0020809 dd_Smed_v4_3880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025055h1SMcG0020809 dd_Smed_v4_3880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025055h1SMcG0020809 dd_Smed_v4_3880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025055h1SMcG0020809 dd_Smed_v4_3880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025055h1SMcG0020809 dd_Smed_v4_3880_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neurobeachin vs. Ensembl Human
Match: LRBA (LPS responsive beige-like anchor protein [Source:HGNC Symbol;Acc:HGNC:1742])

HSP 1 Score: 1152.5 bits (2980), Expect = 0.000e+0
Identity = 595/1224 (48.61%), Postives = 792/1224 (64.71%), Query Frame = 3
Query: 4947 SSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWA-SDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEPRSNEDNXXXXXXXXXXXXXXXXYKIPDNKDSNQNKI----SDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            S+ S+T+RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLLCSQEWQNS+QK+AGLAFIELVNEGRLL+    DH VRVANEA FILSR RAED+ +H+EF  LCA    +++ +E++ +HLI +A+ RD   A +L  ++ +++   HG W  S  +   EF+RLDYWEDD RRRRRFV NP GSTHPEA L TA                 IFK       L+ N  A                 TDE++    K   RS                     +   N++S +N+I     DDT S+   K +         +LA P++        LSTPA L+AP V V G++S+T SELYFE+D  + N   +D K+L Y   LHGKW F+EIR+IFSR++L +N ALEIF+ANR+AVMF FPD  TV+KV+  LPRVG+G  + + Q R+ SLASPRQ+FK SNMTQRWQ REISNF+YLM+LNTIAGR+YNDLNQYP+FPWV+ NYESE +DL+ P+N+RDLS PIGALNP R  FF  R+++W+DD    FHYGTHYSTA+FVL +L+R+EPFTT FLNLQ GKFDHADRTF S+++ W+N QRDTSD+KELIPEF+YLPEMF N N+Y  G  +DG +V DV LP WAKT E+FV INR ALESE VSCQLH WIDLIFGYKQ+GPEA+R+ NVF YLTYEG+VN + I DP++R+A+E QIRSFGQTPSQL+ EPHPPR SA+ VSPLMFT     D++M+LKF SNSP+  + AN  P     AV+TV+AN ++ VNKW+++ A                                  G +Q           D P+            QLP+ +DPL++  T +++R + +  D  ++ H+  F  T DNR I   GFWDKSFR++S +TGRL+QVV+GH+ VV C+ARSE     +CYI++GS D T++LW W N + + +GD    E+A PR  +TGH  E+ C  +  ELG+++S S++  CLIH++ G+LLR+L   ++ + P  +  SREG+ ++  +      +++NGK             L+  ME D          +I A+ L++DG Y+    + G V +R+  +L+ + +YP CDA I ++A++ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct: 1792 SNMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREDEKMCDHLIRAAKYRDHVTATQLIQKIINILTDKHGAWGNSAVSRPLEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTAV------------EHVCIFK-------LRENSKA-----------------TDEDILAKGKQSIRS---------------------QALGNQNS-ENEILLEGDDDTLSSVDEKDL--------ENLAGPVS--------LSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPKILAYTEGLHGKWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFGLPQTRRISLASPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPTNFRDLSKPIGALNPKRAAFFAERYESWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSISRAWRNSQRDTSDIKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVHINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEPHPPRGSAMQVSPLMFTDKAQQDVIMVLKFPSNSPVTHVAANTQPGLATPAVITVTANRLFAVNKWHNLPA--------------------------------HQGAVQ-----------DQPY------------QLPVEIDPLIASNTGMHRRQITDLLDQSIQVHSQCFVITSDNRYILVCGFWDKSFRVYSTDTGRLIQVVFGHWDVVTCLARSESYIGGNCYILSGSRDATLLLWYW-NGKCSGIGDNPGSETAAPRAILTGHDYEVTCAAVCAELGLVLSGSQEGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGLFCTFSVNGK-------------LQATMETD---------DNIRAIQLSRDGQYLLTGGDRGVVVVRQVSDLKQLFAYPGCDAGIRAMALSYDQRCIISGMASGSIVLFYNDFNRWHHEYQTRY 2863          

HSP 2 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 402/967 (41.57%), Postives = 629/967 (65.05%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYE 3272
             I +K+ +L GL++V ++  ++IV+ V  LLV G FD+E NF+I   + +  M+D+++  D   +AE+ S+F  +++KS  NL +  E   +EK L  ++  D M ADLL++MLG++AS++++V+ELK  F  L+G    WP H+ +LL+VL+ MP + GPD FFNFPG   +AIA+PPI+KWPYQNG+TF+ W+ +DP + +N+D+DKPYLYCFRT+KGLGYS HFVG  L++T++K K KG QHCVK++ +P++WYMV++V++YNRW  SE+RCY++GEL S  E+ W +NT++ FD+CF+G+S       +  GQ++ +Y F+E+LN  QI AIY LG  YKG FKF+AE    L++  +   ++G+L  ++ F YNP A D QLCL  +PK N  +F HS HALM  +V+ VLT SI S +HS+GGV++LFPLF+QLD  YR     Q +S+++   I + L+  + ELL  S A++ Q++  KG L+I Y + +S+      S +  ++++LCL+ S+    +LS  QN                                                    + L+K + D++L N A+WIH   +VQL L+ +L+ +F+    ++N  R +  VL  ++++KYYYW VNP+DRSGI  K  +  P  N +++ ++R+ +  FIK+L++K  +GV ++E+Q  LNYL  ++EDDN+  VL   V LMSE P++M+PAFD ++G++VI+KLLAS  E +R+ ALK +G++L+    KRK + M+ H LF+L+ ERL+L +  +TM  YN L+EI+ E++  ++    H  PD +  ++NP +LKVIA L+R S    E ++VR+ FL+D+  L NNS+ENRR++LQ SVWQ+W+  L   +P+  D++++ + V  + R+LL+HA+K E+GGWRVW+DTL+I HSKV +   + ++  ++ + +
Sbjct:   43 GIRMKFAVLTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESINCMVDLLEKCDITCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDNMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGRWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIVTSIKSKGKGFQHCVKFDFKPQKWYMVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQMTAVYLFSEALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSAIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLFAQLD--YR-----QYLSDEIDLTICSTLLAFIMELLKNSIAMQEQMLACKGFLVIGYSLEKSS-----KSHVSRAVLELCLAFSK----YLSNLQN---------------------------------------------------GMPLLKQLCDHVLLNPAIWIHTPAKVQLMLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLD-GPRPNQKEMLSLRAFLLMFIKQLVMK-DSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMSEHPNSMIPAFDQRNGLRVIYKLLASKSEGIRVQALKAMGYFLKHLAPKRKAEVMLGHGLFSLLAERLMLQTNLITMTTYNVLFEILIEQIGTQVIHKQHPDPDSSVKIQNPQILKVIATLLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREQQ 940          

HSP 3 Score: 238.424 bits (607), Expect = 9.389e-62
Identity = 133/275 (48.36%), Postives = 195/275 (70.91%), Query Frame = 3
Query: 3546 RSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            RS  FRIP F WSQ+HQRLL DLL SIE+D+Q+W+  + + +++FVN+++N ++V N +HL++ + D+++  CGG+LPLL+AATS + +++ +E   G+++  +V FL R++++ D+++FASSL F E+E EK+MS+GGILRQCLRLVC  AVRNCLE +    H QL               ++ D  L   PM  L+  L   +    V+ +     P+ D + LLQ+MDINRLRAVV+RD+E++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1300 RSTVFRIPEFNWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKSMSSGGILRQCLRLVCAVAVRNCLECQ---QHSQL--------------KTRGDKAL--KPMHSLIP-LGKSAAKSPVDIVTGGISPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEP 1554          
BLAST of Neurobeachin vs. Ensembl Human
Match: LRBA (LPS responsive beige-like anchor protein [Source:HGNC Symbol;Acc:HGNC:1742])

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 442/869 (50.86%), Postives = 593/869 (68.24%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            ++ GPV LSTPA L+AP V V G++S+T SELYFE+D  + N   +D K+L Y   LHGKW F+EIR+IFSR++L +N ALEIF+ANR+AVMF FPD  TV+KV+  LPRVG+G  + + Q R+ SLASPRQ+FK SNMTQRWQ REISNF+YLM+LNTIAGR+YNDLNQYP+FPWV+ NYESE +DL+ P+N+RDLS PIGALNP R  FF  R+++W+DD    FHYGTHYSTA+FVL +L+R+EPFTT FLNLQ GKFDHADRTF S+++ W+N QRDTSD+KELIPEF+YLPEMF N N+Y  G  +DG +V DV LP WAKT E+FV INR ALESE VSCQLH WIDLIFGYKQ+GPEA+R+ NVF YLTYEG+VN + I DP++R+A+E QIRSFGQTPSQL+ EPHPPR SA+ VSPLMFT     D++M+LKF SNSP+  + AN  P     AV+TV+AN ++ VNKW+++ A                                  G +Q           D P+            QLP+ +DPL++  T +++R + +  D  ++ H+  F  T DNR I   GFWDKSFR++S +TGRL+QVV+GH+ VV C+ARSE     +CYI++GS D T++LW W N + + +GD    E+A PR  +TGH  E+ C  +  ELG+++S S++  CLIH++ G+LLR+L   ++ + P  +  SREG+ ++  +      +++NGK             L+  ME D          +I A+ L++DG Y+    + G V +R+  +L+ + +YP CDA I ++A++ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct: 2062 NLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPKILAYTEGLHGKWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFGLPQTRRISLASPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPTNFRDLSKPIGALNPKRAAFFAERYESWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSISRAWRNSQRDTSDIKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVHINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEPHPPRGSAMQVSPLMFTDKAQQDVIMVLKFPSNSPVTHVAANTQPGLATPAVITVTANRLFAVNKWHNLPA--------------------------------HQGAVQ-----------DQPY------------QLPVEIDPLIASNTGMHRRQITDLLDQSIQVHSQCFVITSDNRYILVCGFWDKSFRVYSTDTGRLIQVVFGHWDVVTCLARSESYIGGNCYILSGSRDATLLLWYW-NGKCSGIGDNPGSETAAPRAILTGHDYEVTCAAVCAELGLVLSGSQEGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGLFCTFSVNGK-------------LQATMETD---------DNIRAIQLSRDGQYLLTGGDRGVVVVRQVSDLKQLFAYPGCDAGIRAMALSYDQRCIISGMASGSIVLFYNDFNRWHHEYQTRY 2852          

HSP 2 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 402/967 (41.57%), Postives = 629/967 (65.05%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYE 3272
             I +K+ +L GL++V ++  ++IV+ V  LLV G FD+E NF+I   + +  M+D+++  D   +AE+ S+F  +++KS  NL +  E   +EK L  ++  D M ADLL++MLG++AS++++V+ELK  F  L+G    WP H+ +LL+VL+ MP + GPD FFNFPG   +AIA+PPI+KWPYQNG+TF+ W+ +DP + +N+D+DKPYLYCFRT+KGLGYS HFVG  L++T++K K KG QHCVK++ +P++WYMV++V++YNRW  SE+RCY++GEL S  E+ W +NT++ FD+CF+G+S       +  GQ++ +Y F+E+LN  QI AIY LG  YKG FKF+AE    L++  +   ++G+L  ++ F YNP A D QLCL  +PK N  +F HS HALM  +V+ VLT SI S +HS+GGV++LFPLF+QLD  YR     Q +S+++   I + L+  + ELL  S A++ Q++  KG L+I Y + +S+      S +  ++++LCL+ S+    +LS  QN                                                    + L+K + D++L N A+WIH   +VQL L+ +L+ +F+    ++N  R +  VL  ++++KYYYW VNP+DRSGI  K  +  P  N +++ ++R+ +  FIK+L++K  +GV ++E+Q  LNYL  ++EDDN+  VL   V LMSE P++M+PAFD ++G++VI+KLLAS  E +R+ ALK +G++L+    KRK + M+ H LF+L+ ERL+L +  +TM  YN L+EI+ E++  ++    H  PD +  ++NP +LKVIA L+R S    E ++VR+ FL+D+  L NNS+ENRR++LQ SVWQ+W+  L   +P+  D++++ + V  + R+LL+HA+K E+GGWRVW+DTL+I HSKV +   + ++  ++ + +
Sbjct:   43 GIRMKFAVLTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESINCMVDLLEKCDITCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDNMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGRWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIVTSIKSKGKGFQHCVKFDFKPQKWYMVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQMTAVYLFSEALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSAIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLFAQLD--YR-----QYLSDEIDLTICSTLLAFIMELLKNSIAMQEQMLACKGFLVIGYSLEKSS-----KSHVSRAVLELCLAFSK----YLSNLQN---------------------------------------------------GMPLLKQLCDHVLLNPAIWIHTPAKVQLMLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLD-GPRPNQKEMLSLRAFLLMFIKQLVMK-DSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMSEHPNSMIPAFDQRNGLRVIYKLLASKSEGIRVQALKAMGYFLKHLAPKRKAEVMLGHGLFSLLAERLMLQTNLITMTTYNVLFEILIEQIGTQVIHKQHPDPDSSVKIQNPQILKVIATLLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREQQ 940          

HSP 3 Score: 258.07 bits (658), Expect = 1.048e-67
Identity = 141/266 (53.01%), Postives = 186/266 (69.92%), Query Frame = 3
Query: 4947 SSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWA-SDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTS 5735
            S+ S+T+RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLLCSQEWQNS+QK+AGLAFIELVNEGRLL+    DH VRVANEA FILSR RAED+ +H+EF  LCA    +++ +E++ +HLI +A+ RD   A +L  ++ +++   HG W  S  +   EF+RLDYWEDD RRRRRFV NP GSTHPEA L TA        I+  K K  I    L   N ++ ++  +  +D+T++S
Sbjct: 1792 SNMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREDEKMCDHLIRAAKYRDHVTATQLIQKIINILTDKHGAWGNSAVSRPLEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTAVEHATDEDILA-KGKQSIRSQALGNQNSENEIL--LEGDDDTLSS 2054          

HSP 4 Score: 238.424 bits (607), Expect = 8.467e-62
Identity = 133/275 (48.36%), Postives = 195/275 (70.91%), Query Frame = 3
Query: 3546 RSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            RS  FRIP F WSQ+HQRLL DLL SIE+D+Q+W+  + + +++FVN+++N ++V N +HL++ + D+++  CGG+LPLL+AATS + +++ +E   G+++  +V FL R++++ D+++FASSL F E+E EK+MS+GGILRQCLRLVC  AVRNCLE +    H QL               ++ D  L   PM  L+  L   +    V+ +     P+ D + LLQ+MDINRLRAVV+RD+E++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1300 RSTVFRIPEFNWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKSMSSGGILRQCLRLVCAVAVRNCLECQ---QHSQL--------------KTRGDKAL--KPMHSLIP-LGKSAAKSPVDIVTGGISPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEP 1554          
BLAST of Neurobeachin vs. Ensembl Human
Match: LRBA (LPS responsive beige-like anchor protein [Source:HGNC Symbol;Acc:HGNC:1742])

HSP 1 Score: 931.013 bits (2405), Expect = 0.000e+0
Identity = 443/869 (50.98%), Postives = 594/869 (68.35%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            ++ GPV LSTPA L+AP V V G++S+T SELYFE+D  + N   +D K+L Y   LHGKW F+EIR+IFSR++L +N ALEIF+ANR+AVMF FPD  TV+KV+  LPRVG+G  + + Q R+ SLASPRQ+FK SNMTQRWQ REISNF+YLM+LNTIAGR+YNDLNQYP+FPWV+ NYESE +DL+ P+N+RDLS PIGALNP R  FF  R+++W+DD    FHYGTHYSTA+FVL +L+R+EPFTT FLNLQ GKFDHADRTF S+++ W+N QRDTSD+KELIPEF+YLPEMF N N+Y  G  +DG +V DV LP WAKT E+FV INR ALESE VSCQLH WIDLIFGYKQ+GPEA+R+ NVF YLTYEG+VN + I DP++R+A+E QIRSFGQTPSQL+ EPHPPR SA+ VSPLMFT     D++M+LKF SNSP+  + AN  P     AV+TV+AN ++ VNKW+++ A                                  G +Q           D P+            QLP+ +DPL++  T +++R + +  D  ++ H+  F  T DNR I   GFWDKSFR++S +TGRL+QVV+GH+ VV C+ARSE     +CYI++GS D T++LW W N + + +GD N  E+A PR  +TGH  E+ C  +  ELG+++S S++  CLIH++ G+LLR+L   ++ + P  +  SREG+ ++  +      +++NGK             L+  ME D          +I A+ L++DG Y+    + G V +R+  +L+ + +YP CDA I ++A++ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct: 2062 NLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPKILAYTEGLHGKWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFGLPQTRRISLASPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPTNFRDLSKPIGALNPKRAAFFAERYESWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSISRAWRNSQRDTSDIKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVHINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEPHPPRGSAMQVSPLMFTDKAQQDVIMVLKFPSNSPVTHVAANTQPGLATPAVITVTANRLFAVNKWHNLPA--------------------------------HQGAVQ-----------DQPY------------QLPVEIDPLIASNTGMHRRQITDLLDQSIQVHSQCFVITSDNRYILVCGFWDKSFRVYSTDTGRLIQVVFGHWDVVTCLARSESYIGGNCYILSGSRDATLLLWYW-NGKCSGIGD-NPGETAAPRAILTGHDYEVTCAAVCAELGLVLSGSQEGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGLFCTFSVNGK-------------LQATMETD---------DNIRAIQLSRDGQYLLTGGDRGVVVVRQVSDLKQLFAYPGCDAGIRAMALSYDQRCIISGMASGSIVLFYNDFNRWHHEYQTRY 2851          

HSP 2 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 402/967 (41.57%), Postives = 629/967 (65.05%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYE 3272
             I +K+ +L GL++V ++  ++IV+ V  LLV G FD+E NF+I   + +  M+D+++  D   +AE+ S+F  +++KS  NL +  E   +EK L  ++  D M ADLL++MLG++AS++++V+ELK  F  L+G    WP H+ +LL+VL+ MP + GPD FFNFPG   +AIA+PPI+KWPYQNG+TF+ W+ +DP + +N+D+DKPYLYCFRT+KGLGYS HFVG  L++T++K K KG QHCVK++ +P++WYMV++V++YNRW  SE+RCY++GEL S  E+ W +NT++ FD+CF+G+S       +  GQ++ +Y F+E+LN  QI AIY LG  YKG FKF+AE    L++  +   ++G+L  ++ F YNP A D QLCL  +PK N  +F HS HALM  +V+ VLT SI S +HS+GGV++LFPLF+QLD  YR     Q +S+++   I + L+  + ELL  S A++ Q++  KG L+I Y + +S+      S +  ++++LCL+ S+    +LS  QN                                                    + L+K + D++L N A+WIH   +VQL L+ +L+ +F+    ++N  R +  VL  ++++KYYYW VNP+DRSGI  K  +  P  N +++ ++R+ +  FIK+L++K  +GV ++E+Q  LNYL  ++EDDN+  VL   V LMSE P++M+PAFD ++G++VI+KLLAS  E +R+ ALK +G++L+    KRK + M+ H LF+L+ ERL+L +  +TM  YN L+EI+ E++  ++    H  PD +  ++NP +LKVIA L+R S    E ++VR+ FL+D+  L NNS+ENRR++LQ SVWQ+W+  L   +P+  D++++ + V  + R+LL+HA+K E+GGWRVW+DTL+I HSKV +   + ++  ++ + +
Sbjct:   43 GIRMKFAVLTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESINCMVDLLEKCDITCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDNMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGRWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIVTSIKSKGKGFQHCVKFDFKPQKWYMVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQMTAVYLFSEALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSAIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLFAQLD--YR-----QYLSDEIDLTICSTLLAFIMELLKNSIAMQEQMLACKGFLVIGYSLEKSS-----KSHVSRAVLELCLAFSK----YLSNLQN---------------------------------------------------GMPLLKQLCDHVLLNPAIWIHTPAKVQLMLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLD-GPRPNQKEMLSLRAFLLMFIKQLVMK-DSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMSEHPNSMIPAFDQRNGLRVIYKLLASKSEGIRVQALKAMGYFLKHLAPKRKAEVMLGHGLFSLLAERLMLQTNLITMTTYNVLFEILIEQIGTQVIHKQHPDPDSSVKIQNPQILKVIATLLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREQQ 940          

HSP 3 Score: 257.684 bits (657), Expect = 1.120e-67
Identity = 141/266 (53.01%), Postives = 186/266 (69.92%), Query Frame = 3
Query: 4947 SSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWA-SDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTS 5735
            S+ S+T+RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLLCSQEWQNS+QK+AGLAFIELVNEGRLL+    DH VRVANEA FILSR RAED+ +H+EF  LCA    +++ +E++ +HLI +A+ RD   A +L  ++ +++   HG W  S  +   EF+RLDYWEDD RRRRRFV NP GSTHPEA L TA        I+  K K  I    L   N ++ ++  +  +D+T++S
Sbjct: 1792 SNMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREDEKMCDHLIRAAKYRDHVTATQLIQKIINILTDKHGAWGNSAVSRPLEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTAVEHATDEDILA-KGKQSIRSQALGNQNSENEIL--LEGDDDTLSS 2054          

HSP 4 Score: 238.424 bits (607), Expect = 9.364e-62
Identity = 133/275 (48.36%), Postives = 195/275 (70.91%), Query Frame = 3
Query: 3546 RSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            RS  FRIP F WSQ+HQRLL DLL SIE+D+Q+W+  + + +++FVN+++N ++V N +HL++ + D+++  CGG+LPLL+AATS + +++ +E   G+++  +V FL R++++ D+++FASSL F E+E EK+MS+GGILRQCLRLVC  AVRNCLE +    H QL               ++ D  L   PM  L+  L   +    V+ +     P+ D + LLQ+MDINRLRAVV+RD+E++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1300 RSTVFRIPEFNWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKSMSSGGILRQCLRLVCAVAVRNCLECQ---QHSQL--------------KTRGDKAL--KPMHSLIP-LGKSAAKSPVDIVTGGISPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEP 1554          
BLAST of Neurobeachin vs. Ensembl Human
Match: LRBA (LPS responsive beige-like anchor protein [Source:HGNC Symbol;Acc:HGNC:1742])

HSP 1 Score: 929.087 bits (2400), Expect = 0.000e+0
Identity = 442/869 (50.86%), Postives = 593/869 (68.24%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            ++ GPV LSTPA L+AP V V G++S+T SELYFE+D  + N   +D K+L Y   LHGKW F+EIR+IFSR++L +N ALEIF+ANR+AVMF FPD  TV+KV+  LPRVG+G  + + Q R+ SLASPRQ+FK SNMTQRWQ REISNF+YLM+LNTIAGR+YNDLNQYP+FPWV+ NYESE +DL+ P+N+RDLS PIGALNP R  FF  R+++W+DD    FHYGTHYSTA+FVL +L+R+EPFTT FLNLQ GKFDHADRTF S+++ W+N QRDTSD+KELIPEF+YLPEMF N N+Y  G  +DG +V DV LP WAKT E+FV INR ALESE VSCQLH WIDLIFGYKQ+GPEA+R+ NVF YLTYEG+VN + I DP++R+A+E QIRSFGQTPSQL+ EPHPPR SA+ VSPLMFT     D++M+LKF SNSP+  + AN  P     AV+TV+AN ++ VNKW+++ A                                  G +Q           D P+            QLP+ +DPL++  T +++R + +  D  ++ H+  F  T DNR I   GFWDKSFR++S +TGRL+QVV+GH+ VV C+ARSE     +CYI++GS D T++LW W N + + +GD    E+A PR  +TGH  E+ C  +  ELG+++S S++  CLIH++ G+LLR+L   ++ + P  +  SREG+ ++  +      +++NGK             L+  ME D          +I A+ L++DG Y+    + G V +R+  +L+ + +YP CDA I ++A++ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct:  715 NLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPKILAYTEGLHGKWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFGLPQTRRISLASPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPTNFRDLSKPIGALNPKRAAFFAERYESWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSISRAWRNSQRDTSDIKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVHINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEPHPPRGSAMQVSPLMFTDKAQQDVIMVLKFPSNSPVTHVAANTQPGLATPAVITVTANRLFAVNKWHNLPA--------------------------------HQGAVQ-----------DQPY------------QLPVEIDPLIASNTGMHRRQITDLLDQSIQVHSQCFVITSDNRYILVCGFWDKSFRVYSTDTGRLIQVVFGHWDVVTCLARSESYIGGNCYILSGSRDATLLLWYW-NGKCSGIGDNPGSETAAPRAILTGHDYEVTCAAVCAELGLVLSGSQEGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGLFCTFSVNGK-------------LQATMETD---------DNIRAIQLSRDGQYLLTGGDRGVVVVRQVSDLKQLFAYPGCDAGIRAMALSYDQRCIISGMASGSIVLFYNDFNRWHHEYQTRY 1505          

HSP 2 Score: 256.529 bits (654), Expect = 8.691e-68
Identity = 141/266 (53.01%), Postives = 186/266 (69.92%), Query Frame = 3
Query: 4947 SSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWA-SDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTS 5735
            S+ S+T+RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLLCSQEWQNS+QK+AGLAFIELVNEGRLL+    DH VRVANEA FILSR RAED+ +H+EF  LCA    +++ +E++ +HLI +A+ RD   A +L  ++ +++   HG W  S  +   EF+RLDYWEDD RRRRRFV NP GSTHPEA L TA        I+  K K  I    L   N ++ ++  +  +D+T++S
Sbjct:  445 SNMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREDEKMCDHLIRAAKYRDHVTATQLIQKIINILTDKHGAWGNSAVSRPLEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTAVEHATDEDILA-KGKQSIRSQALGNQNSENEIL--LEGDDDTLSS 707          

HSP 3 Score: 174.866 bits (442), Expect = 1.180e-42
Identity = 106/226 (46.90%), Postives = 156/226 (69.03%), Query Frame = 3
Query: 3693 ENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            +N ++V N +HL++ + D+++  CGG+LPLL+AATS + +++ +E   G+++  +V FL R++++ D+++FASSL F E+E EK+MS+GGILRQCLRLVC  AVRNCLE +    H QL               ++ D  L   PM  L+  L   +    V+ +     P+ D + LLQ+MDINRLRAVV+RD+E++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct:    2 DNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKSMSSGGILRQCLRLVCAVAVRNCLECQ---QHSQL--------------KTRGDKAL--KPMHSLIP-LGKSAAKSPVDIVTGGISPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEP 207          
BLAST of Neurobeachin vs. Ensembl Human
Match: LRBA (LPS responsive beige-like anchor protein [Source:HGNC Symbol;Acc:HGNC:1742])

HSP 1 Score: 928.702 bits (2399), Expect = 0.000e+0
Identity = 442/874 (50.57%), Postives = 593/874 (67.85%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHV-----SPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            ++ GPV LSTPA L+AP V V G++S+T SELYFE+D  + N   +D K+L Y   LHGKW F+EIR+IFSR++L +N ALEIF+ANR+AVMF FPD  TV+KV+  LPRVG+G  + + Q R+ SLASPRQ+FK SNMTQRWQ REISNF+YLM+LNTIAGR+YNDLNQYP+FPWV+ NYESE +DL+ P+N+RDLS PIGALNP R  FF  R+++W+DD    FHYGTHYSTA+FVL +L+R+EPFTT FLNLQ GKFDHADRTF S+++ W+N QRDTSD+KELIPEF+YLPEMF N N+Y  G  +DG +V DV LP WAKT E+FV INR ALESE VSCQLH WIDLIFGYKQ+GPEA+R+ NVF YLTYEG+VN + I DP++R+A+E QIRSFGQTPSQL+ EPHPPR SA+ V     SPLMFT     D++M+LKF SNSP+  + AN  P     AV+TV+AN ++ VNKW+++ A                                  G +Q           D P+            QLP+ +DPL++  T +++R + +  D  ++ H+  F  T DNR I   GFWDKSFR++S +TGRL+QVV+GH+ VV C+ARSE     +CYI++GS D T++LW W N + + +GD    E+A PR  +TGH  E+ C  +  ELG+++S S++  CLIH++ G+LLR+L   ++ + P  +  SREG+ ++  +      +++NGK             L+  ME D          +I A+ L++DG Y+    + G V +R+  +L+ + +YP CDA I ++A++ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct: 1300 NLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPKILAYTEGLHGKWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFGLPQTRRISLASPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPTNFRDLSKPIGALNPKRAAFFAERYESWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSISRAWRNSQRDTSDIKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVHINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEPHPPRGSAMQVYLLLQSPLMFTDKAQQDVIMVLKFPSNSPVTHVAANTQPGLATPAVITVTANRLFAVNKWHNLPA--------------------------------HQGAVQ-----------DQPY------------QLPVEIDPLIASNTGMHRRQITDLLDQSIQVHSQCFVITSDNRYILVCGFWDKSFRVYSTDTGRLIQVVFGHWDVVTCLARSESYIGGNCYILSGSRDATLLLWYW-NGKCSGIGDNPGSETAAPRAILTGHDYEVTCAAVCAELGLVLSGSQEGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGLFCTFSVNGK-------------LQATMETD---------DNIRAIQLSRDGQYLLTGGDRGVVVVRQVSDLKQLFAYPGCDAGIRAMALSYDQRCIISGMASGSIVLFYNDFNRWHHEYQTRY 2095          

HSP 2 Score: 256.914 bits (655), Expect = 1.463e-67
Identity = 141/266 (53.01%), Postives = 186/266 (69.92%), Query Frame = 3
Query: 4947 SSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWA-SDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTS 5735
            S+ S+T+RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLLCSQEWQNS+QK+AGLAFIELVNEGRLL+    DH VRVANEA FILSR RAED+ +H+EF  LCA    +++ +E++ +HLI +A+ RD   A +L  ++ +++   HG W  S  +   EF+RLDYWEDD RRRRRFV NP GSTHPEA L TA        I+  K K  I    L   N ++ ++  +  +D+T++S
Sbjct: 1030 SNMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREDEKMCDHLIRAAKYRDHVTATQLIQKIINILTDKHGAWGNSAVSRPLEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTAVEHATDEDILA-KGKQSIRSQALGNQNSENEIL--LEGDDDTLSS 1292          

HSP 3 Score: 238.81 bits (608), Expect = 5.140e-62
Identity = 133/275 (48.36%), Postives = 195/275 (70.91%), Query Frame = 3
Query: 3546 RSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            RS  FRIP F WSQ+HQRLL DLL SIE+D+Q+W+  + + +++FVN+++N ++V N +HL++ + D+++  CGG+LPLL+AATS + +++ +E   G+++  +V FL R++++ D+++FASSL F E+E EK+MS+GGILRQCLRLVC  AVRNCLE +    H QL               ++ D  L   PM  L+  L   +    V+ +     P+ D + LLQ+MDINRLRAVV+RD+E++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct:  538 RSTVFRIPEFNWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKSMSSGGILRQCLRLVCAVAVRNCLECQ---QHSQL--------------KTRGDKAL--KPMHSLIP-LGKSAAKSPVDIVTGGISPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEP 792          

HSP 4 Score: 152.91 bits (385), Expect = 6.113e-36
Identity = 74/178 (41.57%), Postives = 122/178 (68.54%), Query Frame = 3
Query: 2739 NLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYE 3272
             LF+L+ ERL+L +  +TM  YN L+EI+ E++  ++    H  PD +  ++NP +LKVIA L+R S    E ++VR+ FL+D+  L NNS+ENRR++LQ SVWQ+W+  L   +P+  D++++ + V  + R+LL+HA+K E+GGWRVW+DTL+I HSKV +   + ++  ++ + +
Sbjct:    1 GLFSLLAERLMLQTNLITMTTYNVLFEILIEQIGTQVIHKQHPDPDSSVKIQNPQILKVIATLLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREQQ 178          
BLAST of Neurobeachin vs. Ensembl Celegans
Match: sel-2 (Putative neurobeachin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19317])

HSP 1 Score: 794.267 bits (2050), Expect = 0.000e+0
Identity = 397/865 (45.90%), Postives = 547/865 (63.24%), Query Frame = 3
Query: 6012 LSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLL---SQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFN-CRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
             ST A L+APGV V G++S+T ++L+F+ + ++ N      +VL Y   LH +W+  EIRAIF R++L +N ALE+F+A+R A+MFAF  ++ V+KV+Y LPRVG+G+KY + Q RK+SL +PRQ+FK S+M  +WQ+REISNFDYLM+LNT+AGRT+NDL+QYP+FPW+L NY S+T+DLS  SN+RDLS PIGAL+ +R+KFF++R+ +WDDD   AFHYGTHYST AF LN+L+RVEPF ++F+NL  GKFDH DR  HS+  +W  CQRD+ DVKELIPE FYLPEMF NS+ +  G+  DG  VDDV+LP WA++PE FV ++RQALES+LVSCQL+ WIDLIFGYKQRG EA+R+TNVF +LTYEG+V     + P    A+E QI SFGQTPSQL+TE HPPR+S + ++P MF     DL MM+K++SNSP+V++ AN   Q P   V+ V+ N V+ +NKW     D S    A+Q S         +L+  P+    Q                               V LPL+ D  L   + TT + +R LG+ FD  +      F  T D++ IFA G+ D SFRI   ++GR+ Q VYGH  VV CIARSE     DCY+VTGS DCT++LW W      + G++N   E   PR  +TGH+A I  + +S E G++VS  +D   LIHT   +LLR +          +L +SRE  +L       ++ Y+   K +  +L  D+                      I  + +T+DG++    + +G + I R   L  +++Y   ++A+ S+A+    RFIL GL +G IV+FN DFN+WH+EY+ RY
Sbjct: 1697 FSTTAKLIAPGVVVPGTLSVTANDLFFDANESDPNYKKQCAQVLRYCEALHARWNLQEIRAIFLRRYLLQNTALELFLASRTAIMFAFDSEDAVKKVVYQLPRVGVGVKYGLPQSRKTSLMTPRQLFKHSDMCAKWQKREISNFDYLMFLNTVAGRTFNDLSQYPVFPWILTNYTSDTLDLSVASNFRDLSKPIGALSEARRKFFNDRYTSWDDDQVPAFHYGTHYSTPAFTLNWLLRVEPFASMFINLHDGKFDHPDRITHSIKDSWDRCQRDSHDVKELIPELFYLPEMFRNSSKFNLGRRADGTPVDDVVLPPWAESPEHFVLMHRQALESDLVSCQLNQWIDLIFGYKQRGAEAVRATNVFYHLTYEGTVTPKMAETPGQVAAIEQQILSFGQTPSQLLTEAHPPRHSIMSMAPTMFRRHDEDLCMMMKYISNSPVVYLAANTFHQLPQPTVVGVAQNLVFSLNKW-----DNSYSYGASQRS---------ALSMDPSNAEGQ-------------------------------VSLPLTADAQLASAASTTPVARRHLGDAFDQRLTVQCSNFVTTTDSKFIFACGYPDYSFRIVDTDSGRVRQAVYGHGDVVTCIARSETSLFSDCYVVTGSMDCTVVLWHWNGTTGFIAGEYNQPGEVPSPRSILTGHEASISALCVSAEHGLVVSGCEDGVILIHTTSSDLLRRIRGHGIVT---QLSMSRECILLSLFDSKRMVTYSATAKKLDEVLVDDK----------------------IECVTVTRDGEFAVTGAVNGRINIWRMFPLTKLYTYQPLNSAVRSVAVVASHRFILGGLDSGAIVVFNADFNRWHYEYKHRY 2491          

HSP 2 Score: 580.482 bits (1495), Expect = 7.888e-168
Identity = 358/1006 (35.59%), Postives = 554/1006 (55.07%), Query Frame = 3
Query:  297 KLDDNRSNIKDSFAEKIYLIKSMKENIDIKYGLLIGLIKVNQ--IEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKI-NNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLP-NDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHAL-ELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKC-----HNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHS 3284
            +L+D+ ++       K  LI S +E  D     L+ ++  N    +  ++VD +  LLV G FD E  F+I  +  V HML ++   D  L+ E+ S+F+ +++KS  NL        I K L++L  A  + ADLL++++  + ++S++VK+ K + + LK +   WP +S++LL+VL++MP     D FF+FPG   S I +PPI   PYQ GWTF  W+ ++P ++V  ++++P LY FRT+KG+GYS HF G+ LV+   K K K    CV+  L  R+W+ +++ + Y+RW +S+I+C+IDG+L   +E+ W + +   +DRC IG S +    +   GQ+  +Y FAE+L   Q  +++ LGP Y+  FK ++E   +L +  +K  F+G L  SL+FAY P  C  QLCL   PK   +  F    HA+M   V  + T SI+ +L S+GG++IL PLF+Q+D    LP ++  +I  +V   + + +  LL         + H    SKG L+IS  + +++    L+ ++L+ +I         HI     R   PA          GP  ++                  + DY +  P     A  E+  H+Y YL ++                 FLAN+  S+ +     R +  V++  +++K++YWL  P+  S     I E      T  I  IRSSI  FI ++++          V D+E+   LN L  V EDDN+  VL     L++E P+ M+PA D    + +IF LLA+ +E +RI ALK+LGF+L RST KRK +SM   NLF+LIGERLL +   L++  YN L EI+ E+MT   +   H         ENP LLKVIAH+I Q + ++ ++Q++K FL D+ +LC  SKENRRT+LQMSVWQDWL  L  +   T  Q ++ + V     +LLHHA++ EYGGWRVW+DTLAI HSKV++ +F+R + +   + E+  S
Sbjct:  115 ELEDDVTSSLPRLLSKTTLIHSNEEGADETIQRLVTVLHSNSPNTDRTQVVDNLFNLLVGGHFDQESKFVIEDAANVDHMLTLLSHCDYDLQNEIWSLFLAVMKKSNRNLEACTRVGLISKVLDILPEAPPLLADLLVQIIAALVAYSINVKQTKHLLRALKSTKEQWPPNSLKLLHVLKEMPQHDSADVFFSFPGKDQSGIILPPIKTMPYQQGWTFATWLRMEPLNSVTFEKEQPVLYSFRTSKGVGYSCHFTGNCLVVNVEKTKGKEQSRCVRAELGARKWHHIAIAHCYSRWGRSDIKCFIDGQLAETIELSWVVTSATNWDRCSIGVSADGTANSAFCGQMGAMYLFAEALTLQQANSLFCLGPVYQSTFKHDSET--SLPEGYKKHLFDGHLHSSLVFAYCPKNCHGQLCLYTPPKTAASTYFVQIPHAVMKEGVEVITTHSIHKSLQSVGGIQILLPLFAQID----LPSSNDNSIDGEVCQTLLSLIALLLSSSQSSQQQLFH----SKGFLIISSCLQKASPS-HLSMKVLEQLI---------HIAKFLLRC--PA---------GGPLLKH------------------LFDYILFNPKLWIRARPEVQVHLYQYLATD-----------------FLANNNFSQML-----RRVPTVIEMCHTLKHFYWLALPQTVSDY--TIEERPENFATADIVAIRSSILTFINRIIIASAGPEEEERVRDQEVHTLLNLLATVREDDNLYDVLALVTRLLAEHPAIMIPAIDKNKALGIIFNLLAAPNELIRIPALKILGFFLSRSTLKRKTESMGNQNLFSLIGERLLSHKKVLSLPTYNVLLEILVEQMTPTFTYACHQPAQPEWKFENPHLLKVIAHVISQCEESENIVQIKKCFLIDIINLCRESKENRRTILQMSVWQDWLIGLAYVFHTTESQNEVSELVWEAFSILLHHALRNEYGGWRVWVDTLAIAHSKVSFEKFKRKLAEAKIKAERSES 1047          

HSP 3 Score: 219.935 bits (559), Expect = 1.220e-56
Identity = 126/255 (49.41%), Postives = 164/255 (64.31%), Query Frame = 3
Query: 4959 LTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLV--TLR-QSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEY---NEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAG 5705
            LT +L+ AL   APL+RE+  DF  YL +TL+G+HGQE+++   V  TLR ++ SV+E+VMLLCSQEWQ SLQKHAGLAFIELVNEGRL+AHA+ DH +RVANEA FIL+R+RAEDV KH++F          R  E    + LIAS R RD   A +L  ++ +++        SDQ++     +F++LD WEDDSRRR+RFV N YGS H EA LP      + P I    S+ E  +  LK L  K    +G
Sbjct: 1428 LTTKLQTALETCAPLLREMMSDFRGYLQKTLLGTHGQEIMNDTKVLETLRNRNASVIELVMLLCSQEWQTSLQKHAGLAFIELVNEGRLMAHATRDHVLRVANEADFILNRLRAEDVSKHAQFEAESREQLAARHEEYGRCDLLIASGRLRDSINATRLLEKMSAIL--------SDQDDSKSGTQFWKLDVWEDDSRRRKRFVPNAYGSRHEEANLPEGE-KNEEPEI----SEQEKIRKVLKGLFSKRQNSSG 1669          

HSP 4 Score: 159.458 bits (402), Expect = 2.415e-38
Identity = 131/320 (40.94%), Postives = 189/320 (59.06%), Query Frame = 3
Query: 3504 AQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLEN-GNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRD-VEEAKQAQFLALSIVYFLSVLMVSRYRDLLE----PSPTYDSYSLE----SSVNRETNDQD 4433
            ++S  E     P P    +R P F WS +H RLL DLL  IE  +  WK +    I +  NA+ENQV+V N+VH+V+ LSDSLI  CGGLLPLLA+AT+P+ D+++++     + +S +  FL+R   + D  V AS ++F ELEQEK M  GG+LRQ LR+  T  VR+ L +R +        ++  YE +S+ ++           M+ +   L  RS D            + + E L+Q+ DI R++ VVYRD VEE +QAQFLALS++Y +SVLMVSRYRD+LE    PSP +DS + +     +VN ET+ ++
Sbjct: 1045 SESGGEEAKMEPTPI---YRAPEFAWSDVHVRLLADLLSGIERVVDEWKVAEC-GISDQCNASENQVFVGNVVHVVSQLSDSLIMACGGLLPLLASATAPNNDMEIVDPCQQQLPISVSAGFLMRFARLVDTFVLASGVSFSELEQEKNMPAGGVLRQSLRISATVTVRHILASRIQQ------PDTPRYETNSTKKNQCI--------MEFVREALEKRSPD-----------GLENVERLVQDSDITRIKGVVYRDMVEENRQAQFLALSVIYLVSVLMVSRYRDILEPPSSPSPFFDSTTQKQENSENVNSETSPEN 1335          
BLAST of Neurobeachin vs. Ensembl Celegans
Match: wdfy-3 (WD40 and FYVE domain protein [Source:UniProtKB/TrEMBL;Acc:H2FLM2])

HSP 1 Score: 348.591 bits (893), Expect = 1.313e-95
Identity = 176/383 (45.95%), Postives = 246/383 (64.23%), Query Frame = 3
Query: 6159 LHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIY------------------VLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSA--FHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQR-DTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKT-PEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPR 7241
            L  K+ ++ IR +  R++L + IALE+F ++    + AFP +  +R  ++                     +  + I+   +  R +SL S   +    ++TQRW    ISNF YLM+LNT+AGR YNDL+QYPIFPWVLA+Y S  +D ++ S +RD S P+GA +P R + F  RF+ WDD S     + YGTHYS+A  V++YLVR+EPFT  FL+LQ G FD ADR FHSV   W +  R + +DVKELIPEFF LPEMFTN+N +  G  ++G  V+DV+LP W    P +F+R++RQALES+ VS  LH WIDLIFGYKQ G EA++++N+F +L YEGSV+++ I DP+ R A    + +FGQ P+QL  +PHP +
Sbjct: 2494 LCSKFSYNMIREVHKRRYLLQPIALEVFSSDGRNYLLAFPKK--IRDRVFDKLTSMAINLSSGGSDSLGGQKANVAIE---TTGRGASLLS--SLIGQQSVTQRWLSGNISNFQYLMHLNTLAGRCYNDLSQYPIFPWVLADYTSSQLDFNNISTFRDFSKPMGAQSPDRLEQFLKRFREWDDPSGETPPYMYGTHYSSAMIVVSYLVRLEPFTQQFLSLQGGHFDLADRMFHSVGDAWTSASRNNMADVKELIPEFFTLPEMFTNTNHFDLGVKQNGIHVNDVLLPAWCHGDPREFIRLHRQALESDYVSSHLHEWIDLIFGYKQNGEEAVKNSNLFHHLFYEGSVDFERIDDPLTRNATIGFVNNFGQIPTQLFKKPHPQK 2869          
BLAST of Neurobeachin vs. Ensembl Celegans
Match: wdfy-3 (WD40 and FYVE domain protein [Source:UniProtKB/TrEMBL;Acc:H2FLM2])

HSP 1 Score: 348.591 bits (893), Expect = 1.313e-95
Identity = 176/383 (45.95%), Postives = 246/383 (64.23%), Query Frame = 3
Query: 6159 LHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIY------------------VLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSA--FHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQR-DTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKT-PEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPR 7241
            L  K+ ++ IR +  R++L + IALE+F ++    + AFP +  +R  ++                     +  + I+   +  R +SL S   +    ++TQRW    ISNF YLM+LNT+AGR YNDL+QYPIFPWVLA+Y S  +D ++ S +RD S P+GA +P R + F  RF+ WDD S     + YGTHYS+A  V++YLVR+EPFT  FL+LQ G FD ADR FHSV   W +  R + +DVKELIPEFF LPEMFTN+N +  G  ++G  V+DV+LP W    P +F+R++RQALES+ VS  LH WIDLIFGYKQ G EA++++N+F +L YEGSV+++ I DP+ R A    + +FGQ P+QL  +PHP +
Sbjct: 2496 LCSKFSYNMIREVHKRRYLLQPIALEVFSSDGRNYLLAFPKK--IRDRVFDKLTSMAINLSSGGSDSLGGQKANVAIE---TTGRGASLLS--SLIGQQSVTQRWLSGNISNFQYLMHLNTLAGRCYNDLSQYPIFPWVLADYTSSQLDFNNISTFRDFSKPMGAQSPDRLEQFLKRFREWDDPSGETPPYMYGTHYSSAMIVVSYLVRLEPFTQQFLSLQGGHFDLADRMFHSVGDAWTSASRNNMADVKELIPEFFTLPEMFTNTNHFDLGVKQNGIHVNDVLLPAWCHGDPREFIRLHRQALESDYVSSHLHEWIDLIFGYKQNGEEAVKNSNLFHHLFYEGSVDFERIDDPLTRNATIGFVNNFGQIPTQLFKKPHPQK 2871          
BLAST of Neurobeachin vs. Ensembl Celegans
Match: wdfy-3 (WD40 and FYVE domain protein [Source:UniProtKB/TrEMBL;Acc:H2FLM2])

HSP 1 Score: 348.206 bits (892), Expect = 1.502e-95
Identity = 176/383 (45.95%), Postives = 246/383 (64.23%), Query Frame = 3
Query: 6159 LHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIY------------------VLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSA--FHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQR-DTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKT-PEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPR 7241
            L  K+ ++ IR +  R++L + IALE+F ++    + AFP +  +R  ++                     +  + I+   +  R +SL S   +    ++TQRW    ISNF YLM+LNT+AGR YNDL+QYPIFPWVLA+Y S  +D ++ S +RD S P+GA +P R + F  RF+ WDD S     + YGTHYS+A  V++YLVR+EPFT  FL+LQ G FD ADR FHSV   W +  R + +DVKELIPEFF LPEMFTN+N +  G  ++G  V+DV+LP W    P +F+R++RQALES+ VS  LH WIDLIFGYKQ G EA++++N+F +L YEGSV+++ I DP+ R A    + +FGQ P+QL  +PHP +
Sbjct: 2494 LCSKFSYNMIREVHKRRYLLQPIALEVFSSDGRNYLLAFPKK--IRDRVFDKLTSMAINLSSGGSDSLGGQKANVAIE---TTGRGASLLS--SLIGQQSVTQRWLSGNISNFQYLMHLNTLAGRCYNDLSQYPIFPWVLADYTSSQLDFNNISTFRDFSKPMGAQSPDRLEQFLKRFREWDDPSGETPPYMYGTHYSSAMIVVSYLVRLEPFTQQFLSLQGGHFDLADRMFHSVGDAWTSASRNNMADVKELIPEFFTLPEMFTNTNHFDLGVKQNGIHVNDVLLPAWCHGDPREFIRLHRQALESDYVSSHLHEWIDLIFGYKQNGEEAVKNSNLFHHLFYEGSVDFERIDDPLTRNATIGFVNNFGQIPTQLFKKPHPQK 2869          
BLAST of Neurobeachin vs. Ensembl Celegans
Match: wdfy-3 (WD40 and FYVE domain protein [Source:UniProtKB/TrEMBL;Acc:H2FLM2])

HSP 1 Score: 348.206 bits (892), Expect = 1.527e-95
Identity = 176/383 (45.95%), Postives = 246/383 (64.23%), Query Frame = 3
Query: 6159 LHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIY------------------VLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSA--FHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQR-DTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKT-PEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPR 7241
            L  K+ ++ IR +  R++L + IALE+F ++    + AFP +  +R  ++                     +  + I+   +  R +SL S   +    ++TQRW    ISNF YLM+LNT+AGR YNDL+QYPIFPWVLA+Y S  +D ++ S +RD S P+GA +P R + F  RF+ WDD S     + YGTHYS+A  V++YLVR+EPFT  FL+LQ G FD ADR FHSV   W +  R + +DVKELIPEFF LPEMFTN+N +  G  ++G  V+DV+LP W    P +F+R++RQALES+ VS  LH WIDLIFGYKQ G EA++++N+F +L YEGSV+++ I DP+ R A    + +FGQ P+QL  +PHP +
Sbjct: 2492 LCSKFSYNMIREVHKRRYLLQPIALEVFSSDGRNYLLAFPKK--IRDRVFDKLTSMAINLSSGGSDSLGGQKANVAIE---TTGRGASLLS--SLIGQQSVTQRWLSGNISNFQYLMHLNTLAGRCYNDLSQYPIFPWVLADYTSSQLDFNNISTFRDFSKPMGAQSPDRLEQFLKRFREWDDPSGETPPYMYGTHYSSAMIVVSYLVRLEPFTQQFLSLQGGHFDLADRMFHSVGDAWTSASRNNMADVKELIPEFFTLPEMFTNTNHFDLGVKQNGIHVNDVLLPAWCHGDPREFIRLHRQALESDYVSSHLHEWIDLIFGYKQNGEEAVKNSNLFHHLFYEGSVDFERIDDPLTRNATIGFVNNFGQIPTQLFKKPHPQK 2867          
BLAST of Neurobeachin vs. Ensembl Fly
Match: rg (gene:FBgn0266098 transcript:FBtr0344668)

HSP 1 Score: 972.615 bits (2513), Expect = 0.000e+0
Identity = 453/879 (51.54%), Postives = 613/879 (69.74%), Query Frame = 3
Query: 5976 KPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLS------QTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            + +++D+TGPV +ST A L+APG+   G+VSIT +E++FE+D  +     +D +VL Y  HLHGKW+FSE+RAIFSR++L +N+ALEIF+A+R +++FAFPDQ TV+KVI  LPRVG+GIKY + Q R++S+ SPRQ+ + SNMTQ+WQ+REISNF+YLM+LNTIAGRTYNDLNQYPIFPWVL NYES+ +DLS PSNYRDLS PIGALNPSR+ +F+ R+++WD D+   FHYGTHYSTAAF LN+LVRVEPFTT+FL LQ GKFD+ DR F SV+ +WKNCQRDTSDVKELIPE+++LPEMF NS+ YR G  EDG +VDD+ LP WAK+PE+FVRINR ALESE VSCQLH WIDLIFGYKQRGPEAIR+TNVF YLTYEGSV+ D + DP++R+A+E+QIR+FGQTPSQL+ EPHPPR+SA+H+SP+MF+ +  DL  MLKF  NSP++ ++AN +PQ  L +V+TV+A + + VN+WN                                       N  +S+ S   S  +SP         S     PL++DP+L+       +   ++R LG+ F   ++  +  F  T D+R + A GFWD SFR+F+ ET +++Q+V+GHFGVV C+ARSEC    DCYI +GS DCT++LW W  R  +++G+ +      PR T+TGH+  +  V IS ELG++VS S +   LIHT  G+LLRSL     F  P  + +SREG+I++      V  YTINGK + H  ++D                      ++  M L++DG+Y+  + + G V + R  NL  ++++P C+A I SLA+T DQ+++L GL  G+I++F++DFN+WHHEY+ RY
Sbjct: 2434 RELDLDLTGPVNISTKARLIAPGLVAPGTVSITSTEMFFEVDEEHPEFQKIDGEVLKYCDHLHGKWYFSEVRAIFSRRYLLQNVALEIFLASRTSILFAFPDQHTVKKVIKALPRVGVGIKYGIPQTRRASMMSPRQLMRNSNMTQKWQRREISNFEYLMFLNTIAGRTYNDLNQYPIFPWVLTNYESKDLDLSLPSNYRDLSKPIGALNPSRRAYFEERYESWDSDTIPPFHYGTHYSTAAFTLNWLVRVEPFTTMFLALQGGKFDYPDRLFSSVSLSWKNCQRDTSDVKELIPEWYFLPEMFYNSSGYRLGHREDGALVDDIELPPWAKSPEEFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAIRATNVFYYLTYEGSVDLDGVLDPVMREAVENQIRNFGQTPSQLLMEPHPPRSSAMHLSPMMFSAMPEDLCQMLKFYQNSPVIHISANTYPQLSLPSVVTVTAGHQFAVNRWN--------------------------------------CNYTASVQS--PSYAESPQ--------SPGSNQPLTIDPVLAVHGTNNNSNAASRRHLGDNFSQMLKIRSNCFVTTVDSRFLIACGFWDNSFRVFATETAKIVQIVFGHFGVVTCMARSECNITSDCYIASGSADCTVLLWHWNARTQSIVGEGDV---PTPRATLTGHEQAVTSVVISAELGLVVSGSSNGPVLIHTTFGDLLRSLDPPAEFHSPELITMSREGFIVINYDKGNVAAYTINGKKLRHETHND----------------------NLQCMLLSRDGEYLMTAGDRGIVEVWRTFNLAPLYAFPACNAGIRSLALTHDQKYLLAGLSTGSIIVFHIDFNRWHHEYQQRY 3239          

HSP 2 Score: 511.146 bits (1315), Expect = 3.635e-145
Identity = 248/522 (47.51%), Postives = 364/522 (69.73%), Query Frame = 3
Query:  396 LIGLIKVNQIEVKEIVDAVLYL----LVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKL------CLS 1931
            L G   +    ++ I+  +++L    LV G FDME NF+I  +Q + HML+++      L+AE+ SVFI ++RKS  NL    +   IE  L  L+ ++ + ADLLIEMLG++AS+S++VKELK +F  +K +N  WP HS +LLNVL+QMP R+GPD FF+FPG  GSA+ +PP++KWPY+NG+TF  W  LDP ++VNI+R+KPYLYCF+T+KG+GY+ HFVG+ LV+T+MK+K KG QHCVKY  QPR+WYM+++VY+YNRWTKSEI+C ++G+L S  EM W ++TN+ FD+C+IGA+PE   E +  GQ+S IY F+E+L   QI A++ LGP YK  F+F+ EC  NL D+ ++  ++G+L ++++F YNPVA D QLCL  +PK N   F H+ HALM  +V+ V+T SI+ TL+S+GG+++LFPLFSQLD ++    D   I  D  P + ++L+  + EL+  S  ++  ++Q++G L+IS+ + RS+    L  E+L S + L      CLS
Sbjct:   74 LTGTFCLTGDTMEGIIQCLVFLKAFSLVGGEFDMELNFVIQDAQNIKHMLELLDHCPPNLQAEIWSVFIAILRKSVRNLQACTDVGLIEHVLVRLQRSETVVADLLIEMLGVLASYSITVKELKLLFGTMKATNGKWPRHSAKLLNVLRQMPHRNGPDVFFSFPGRKGSAMVLPPLAKWPYENGFTFTTWFRLDPINSVNIEREKPYLYCFKTSKGVGYTAHFVGNCLVLTSMKVKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCLVNGQLASSTEMAWFVSTNDPFDKCYIGATPELDEERVFCGQMSAIYLFSEALTTQQICAMHRLGPGYKSQFRFDNECYLNLPDNHKRVLYDGKLSNAIVFMYNPVATDGQLCLQSSPKGNVSYFVHTPHALMLQDVKAVVTHSIHCTLNSIGGIQVLFPLFSQLDMAHEGLGD---IKRD--PTLCSKLLGFICELVETSQTVQQHMIQNRGFLVISFMLQRSSRE-HLTLEVLGSFLNLTKYLVTCLS 589          

HSP 3 Score: 382.104 bits (980), Expect = 9.840e-106
Identity = 197/399 (49.37%), Postives = 290/399 (72.68%), Query Frame = 3
Query: 2136 LVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINT 3332
            L+K + D++L N A+WI+    VQ +L+ +LA +FLS+  +++  R ++ VLQ ++++KYYYW+VNPR +SGI+ K  +  P    + I  IR+ I  F+K+L++   NGV ++E+Q  LNYLT ++ED+N+  VL   ++LMSE PS+MVPAFD KHG++ IFKLLA+  + +R+ ALKLLGF+L RST+KRK D M PHNL+TL+ ERLLLY   L++  YN LYEIMTE ++ +I  T H  P+  + LENP +LKV+A LIRQSK T+ L+ V+K+FL D+  LCN+++ENRRTVLQMSVWQ+WL  +  + P++ +++++ D V +L R+LLHHA+K EYGGWRVW+DTLAI+HSKV+Y EF+    ++YE YE+  +D+ +   ++    I+T
Sbjct:  595 LLKQLLDHVLFNPALWIYTPANVQARLYSYLATEFLSDTQIYSNVRRVSTVLQTVHTLKYYYWVVNPRAKSGIIPKGLD-GPRPAQKDILAIRAYILLFLKQLIM-IGNGVKEDELQSILNYLTTMHEDENLHDVLQMLISLMSEHPSSMVPAFDVKHGVRSIFKLLAAESQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLYTLLAERLLLYEESLSLPTYNVLYEIMTEHISQQILYTRHPEPESHYRLENPMILKVVATLIRQSKQTESLIDVKKLFLQDMTLLCNSNRENRRTVLQMSVWQEWLIAMAYIHPKSSEEQKISDMVYSLFRMLLHHAIKHEYGGWRVWVDTLAIVHSKVSYEEFKLQFAQMYEHYERQRTDNITDPALRQARPIST 991          

HSP 4 Score: 286.189 bits (731), Expect = 1.512e-76
Identity = 155/289 (53.63%), Postives = 211/289 (73.01%), Query Frame = 3
Query: 3504 AQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            ++S +   +FSPGP   PFRIP F WS +HQRLL D+L S+E+D+Q+W+  + +++L+FVN++EN ++V+N VHL++ L+D+LI  CGGLLPLLA+ATSP+ ++D+LE   GM +  AV FL R++N+AD+++FA+SLNF ELE EK MS+GGILRQCLRLVCTCAVRNCLE +          E   Y   +   D     +L     Q L+RG +    ++ V  +  Q  P+ DPE LLQ+MD+NRLRAV+YRDVEE KQAQFL+L+IVYF+SVLMVS+YRD+LEP
Sbjct: 1660 SKSGSTRPMFSPGPTRPPFRIPEFKWSYIHQRLLSDVLFSLETDIQVWRSHSTKSVLDFVNSSENAIFVVNTVHLISQLADNLIIACGGLLPLLASATSPNSELDVLEPTQGMPLEVAVSFLQRLVNMADVLIFATSLNFGELEAEKNMSSGGILRQCLRLVCTCAVRNCLECK----------ERTRYNVGALARDVPGAAHL-----QALIRGAQASPKNI-VESITGQLSPVKDPEKLLQDMDVNRLRAVIYRDVEETKQAQFLSLAIVYFISVLMVSKYRDILEP 1932          

HSP 5 Score: 262.692 bits (670), Expect = 2.091e-69
Identity = 128/233 (54.94%), Postives = 168/233 (72.10%), Query Frame = 3
Query: 4953 TSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELV--SSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQN-----------EYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSG 5612
             SLT++LE ALG   PL+REI  DF+ +LS+TL+GSHGQEL+    GL T + S SVVE+VMLLCSQEWQNSLQKHAGLAFIEL+NEGRLL+HA  DH VRVANEA FIL+RMRA+DV KH++F   CA    ER+ EER+ +HLI +AR RD+ +A++L  +V +++ + HG W    +           + + +++LD WEDD+RRR+R V NP GS+HP+A L  A  +G
Sbjct: 2159 ASLTQKLEIALGPVCPLLREIMVDFAPFLSKTLVGSHGQELLMEGKGLTTFKNSHSVVELVMLLCSQEWQNSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFESQCAQTLLERREEERMCDHLITAARRRDNVIASRLLEKVRNIMCNRHGAWGDSSSTSSGGAIVGAVQKSPYWKLDAWEDDARRRKRMVQNPRGSSHPQATLKAALENG 2391          
BLAST of Neurobeachin vs. Ensembl Fly
Match: rg (gene:FBgn0266098 transcript:FBtr0344649)

HSP 1 Score: 972.615 bits (2513), Expect = 0.000e+0
Identity = 453/879 (51.54%), Postives = 613/879 (69.74%), Query Frame = 3
Query: 5976 KPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLS------QTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            + +++D+TGPV +ST A L+APG+   G+VSIT +E++FE+D  +     +D +VL Y  HLHGKW+FSE+RAIFSR++L +N+ALEIF+A+R +++FAFPDQ TV+KVI  LPRVG+GIKY + Q R++S+ SPRQ+ + SNMTQ+WQ+REISNF+YLM+LNTIAGRTYNDLNQYPIFPWVL NYES+ +DLS PSNYRDLS PIGALNPSR+ +F+ R+++WD D+   FHYGTHYSTAAF LN+LVRVEPFTT+FL LQ GKFD+ DR F SV+ +WKNCQRDTSDVKELIPE+++LPEMF NS+ YR G  EDG +VDD+ LP WAK+PE+FVRINR ALESE VSCQLH WIDLIFGYKQRGPEAIR+TNVF YLTYEGSV+ D + DP++R+A+E+QIR+FGQTPSQL+ EPHPPR+SA+H+SP+MF+ +  DL  MLKF  NSP++ ++AN +PQ  L +V+TV+A + + VN+WN                                       N  +S+ S   S  +SP         S     PL++DP+L+       +   ++R LG+ F   ++  +  F  T D+R + A GFWD SFR+F+ ET +++Q+V+GHFGVV C+ARSEC    DCYI +GS DCT++LW W  R  +++G+ +      PR T+TGH+  +  V IS ELG++VS S +   LIHT  G+LLRSL     F  P  + +SREG+I++      V  YTINGK + H  ++D                      ++  M L++DG+Y+  + + G V + R  NL  ++++P C+A I SLA+T DQ+++L GL  G+I++F++DFN+WHHEY+ RY
Sbjct: 2661 RELDLDLTGPVNISTKARLIAPGLVAPGTVSITSTEMFFEVDEEHPEFQKIDGEVLKYCDHLHGKWYFSEVRAIFSRRYLLQNVALEIFLASRTSILFAFPDQHTVKKVIKALPRVGVGIKYGIPQTRRASMMSPRQLMRNSNMTQKWQRREISNFEYLMFLNTIAGRTYNDLNQYPIFPWVLTNYESKDLDLSLPSNYRDLSKPIGALNPSRRAYFEERYESWDSDTIPPFHYGTHYSTAAFTLNWLVRVEPFTTMFLALQGGKFDYPDRLFSSVSLSWKNCQRDTSDVKELIPEWYFLPEMFYNSSGYRLGHREDGALVDDIELPPWAKSPEEFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAIRATNVFYYLTYEGSVDLDGVLDPVMREAVENQIRNFGQTPSQLLMEPHPPRSSAMHLSPMMFSAMPEDLCQMLKFYQNSPVIHISANTYPQLSLPSVVTVTAGHQFAVNRWN--------------------------------------CNYTASVQS--PSYAESPQ--------SPGSNQPLTIDPVLAVHGTNNNSNAASRRHLGDNFSQMLKIRSNCFVTTVDSRFLIACGFWDNSFRVFATETAKIVQIVFGHFGVVTCMARSECNITSDCYIASGSADCTVLLWHWNARTQSIVGEGDV---PTPRATLTGHEQAVTSVVISAELGLVVSGSSNGPVLIHTTFGDLLRSLDPPAEFHSPELITMSREGFIVINYDKGNVAAYTINGKKLRHETHND----------------------NLQCMLLSRDGEYLMTAGDRGIVEVWRTFNLAPLYAFPACNAGIRSLALTHDQKYLLAGLSTGSIIVFHIDFNRWHHEYQQRY 3466          

HSP 2 Score: 469.544 bits (1207), Expect = 2.234e-132
Identity = 263/621 (42.35%), Postives = 397/621 (63.93%), Query Frame = 3
Query: 1470 FEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINT 3332
            ++G+L ++++F YNPVA D QLCL  +PK N   F H+ HALM  +V+ V+T SI+ TL+S+GG+++LFPLFSQLD ++    D   I  D  P + ++L+  + EL+  S  ++  ++Q++G L+IS+ + RS+    L  E+L S     L+L++  +  LS   N      QL   +                                          L   + D++L N A+WI+    VQ +L+ +LA +FLS+  +++  R ++ VLQ ++++KYYYW+VNPR +SGI+ K  +  P    + I  IR+ I  F+K+L++   NGV ++E+Q  LNYLT ++ED+N+  VL   ++LMSE PS+MVPAFD KHG++ IFKLLA+  + +R+ ALKLLGF+L RST+KRK D M PHNL+TL+ ERLLLY   L++  YN LYEIMTE ++ +I  T H  P+  + LENP +LKV+A LIRQSK T+ L+ V+K+FL D+  LCN+++ENRRTVLQMSVWQ+WL  +  + P++ +++++ D V +L R+LLHHA+K EYGGWRVW+DTLAI+HSKV+Y EF+    ++YE YE+  +D+ +   ++    I+T
Sbjct:  597 YDGKLSNAIVFMYNPVATDGQLCLQSSPKGNVSYFVHTPHALMLQDVKAVVTHSIHCTLNSIGGIQVLFPLFSQLDMAHEGLGD---IKRD--PTLCSKLLGFICELVETSQTVQQHMIQNRGFLVISFMLQRSSRE-HLTLEVLGSF----LNLTKYLVTCLSA--NSDLLLKQLFCFSF-----------------------------------------LTWQLLDHVLFNPALWIYTPANVQARLYSYLATEFLSDTQIYSNVRRVSTVLQTVHTLKYYYWVVNPRAKSGIIPKGLD-GPRPAQKDILAIRAYILLFLKQLIM-IGNGVKEDELQSILNYLTTMHEDENLHDVLQMLISLMSEHPSSMVPAFDVKHGVRSIFKLLAAESQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLYTLLAERLLLYEESLSLPTYNVLYEIMTEHISQQILYTRHPEPESHYRLENPMILKVVATLIRQSKQTESLIDVKKLFLQDMTLLCNSNRENRRTVLQMSVWQEWLIAMAYIHPKSSEEQKISDMVYSLFRMLLHHAIKHEYGGWRVWVDTLAIVHSKVSYEEFKLQFAQMYEHYERQRTDNITDPALRQARPIST 1162          

HSP 3 Score: 424.091 bits (1089), Expect = 1.591e-118
Identity = 195/370 (52.70%), Postives = 276/370 (74.59%), Query Frame = 3
Query:  354 IKSMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRK 1463
            I  M    ++K+ +LIGLI+V Q+  +E+V+ VL+LLV G FDME NF+I  +Q + HML+++      L+AE+ SVFI ++RKS  NL    +   IE  L  L+ ++ + ADLLIEMLG++AS+S++VKELK +F  +K +N  WP HS +LLNVL+QMP R+GPD FF+FPG  GSA+ +PP++KWPY+NG+TF  W  LDP ++VNI+R+KPYLYCF+T+KG+GY+ HFVG+ LV+T+MK+K KG QHCVKY  QPR+WYM+++VY+YNRWTKSEI+C ++G+L S  EM W ++TN+ FD+C+IGA+PE   E +  GQ+S IY F+E+L   QI A++ LGP YK  F+F+ EC  NL D+ ++
Sbjct:   18 IVRMTTADNLKFAVLIGLIEVGQVTNREVVNTVLHLLVGGEFDMELNFVIQDAQNIKHMLELLDHCPPNLQAEIWSVFIAILRKSVRNLQACTDVGLIEHVLVRLQRSETVVADLLIEMLGVLASYSITVKELKLLFGTMKATNGKWPRHSAKLLNVLRQMPHRNGPDVFFSFPGRKGSAMVLPPLAKWPYENGFTFTTWFRLDPINSVNIEREKPYLYCFKTSKGVGYTAHFVGNCLVLTSMKVKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCLVNGQLASSTEMAWFVSTNDPFDKCYIGATPELDEERVFCGQMSAIYLFSEALTTQQICAMHRLGPGYKSQFRFDNECYLNLPDNHKR 387          

HSP 4 Score: 286.189 bits (731), Expect = 1.692e-76
Identity = 155/289 (53.63%), Postives = 211/289 (73.01%), Query Frame = 3
Query: 3504 AQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            ++S +   +FSPGP   PFRIP F WS +HQRLL D+L S+E+D+Q+W+  + +++L+FVN++EN ++V+N VHL++ L+D+LI  CGGLLPLLA+ATSP+ ++D+LE   GM +  AV FL R++N+AD+++FA+SLNF ELE EK MS+GGILRQCLRLVCTCAVRNCLE +          E   Y   +   D     +L     Q L+RG +    ++ V  +  Q  P+ DPE LLQ+MD+NRLRAV+YRDVEE KQAQFL+L+IVYF+SVLMVS+YRD+LEP
Sbjct: 1831 SKSGSTRPMFSPGPTRPPFRIPEFKWSYIHQRLLSDVLFSLETDIQVWRSHSTKSVLDFVNSSENAIFVVNTVHLISQLADNLIIACGGLLPLLASATSPNSELDVLEPTQGMPLEVAVSFLQRLVNMADVLIFATSLNFGELEAEKNMSSGGILRQCLRLVCTCAVRNCLECK----------ERTRYNVGALARDVPGAAHL-----QALIRGAQASPKNI-VESITGQLSPVKDPEKLLQDMDVNRLRAVIYRDVEETKQAQFLSLAIVYFISVLMVSKYRDILEP 2103          

HSP 5 Score: 262.692 bits (670), Expect = 1.982e-69
Identity = 128/233 (54.94%), Postives = 168/233 (72.10%), Query Frame = 3
Query: 4953 TSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELV--SSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQN-----------EYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSG 5612
             SLT++LE ALG   PL+REI  DF+ +LS+TL+GSHGQEL+    GL T + S SVVE+VMLLCSQEWQNSLQKHAGLAFIEL+NEGRLL+HA  DH VRVANEA FIL+RMRA+DV KH++F   CA    ER+ EER+ +HLI +AR RD+ +A++L  +V +++ + HG W    +           + + +++LD WEDD+RRR+R V NP GS+HP+A L  A  +G
Sbjct: 2386 ASLTQKLEIALGPVCPLLREIMVDFAPFLSKTLVGSHGQELLMEGKGLTTFKNSHSVVELVMLLCSQEWQNSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFESQCAQTLLERREEERMCDHLITAARRRDNVIASRLLEKVRNIMCNRHGAWGDSSSTSSGGAIVGAVQKSPYWKLDAWEDDARRRKRMVQNPRGSSHPQATLKAALENG 2618          
BLAST of Neurobeachin vs. Ensembl Fly
Match: rg (gene:FBgn0266098 transcript:FBtr0344650)

HSP 1 Score: 972.615 bits (2513), Expect = 0.000e+0
Identity = 453/879 (51.54%), Postives = 613/879 (69.74%), Query Frame = 3
Query: 5976 KPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLS------QTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            + +++D+TGPV +ST A L+APG+   G+VSIT +E++FE+D  +     +D +VL Y  HLHGKW+FSE+RAIFSR++L +N+ALEIF+A+R +++FAFPDQ TV+KVI  LPRVG+GIKY + Q R++S+ SPRQ+ + SNMTQ+WQ+REISNF+YLM+LNTIAGRTYNDLNQYPIFPWVL NYES+ +DLS PSNYRDLS PIGALNPSR+ +F+ R+++WD D+   FHYGTHYSTAAF LN+LVRVEPFTT+FL LQ GKFD+ DR F SV+ +WKNCQRDTSDVKELIPE+++LPEMF NS+ YR G  EDG +VDD+ LP WAK+PE+FVRINR ALESE VSCQLH WIDLIFGYKQRGPEAIR+TNVF YLTYEGSV+ D + DP++R+A+E+QIR+FGQTPSQL+ EPHPPR+SA+H+SP+MF+ +  DL  MLKF  NSP++ ++AN +PQ  L +V+TV+A + + VN+WN                                       N  +S+ S   S  +SP         S     PL++DP+L+       +   ++R LG+ F   ++  +  F  T D+R + A GFWD SFR+F+ ET +++Q+V+GHFGVV C+ARSEC    DCYI +GS DCT++LW W  R  +++G+ +      PR T+TGH+  +  V IS ELG++VS S +   LIHT  G+LLRSL     F  P  + +SREG+I++      V  YTINGK + H  ++D                      ++  M L++DG+Y+  + + G V + R  NL  ++++P C+A I SLA+T DQ+++L GL  G+I++F++DFN+WHHEY+ RY
Sbjct: 2595 RELDLDLTGPVNISTKARLIAPGLVAPGTVSITSTEMFFEVDEEHPEFQKIDGEVLKYCDHLHGKWYFSEVRAIFSRRYLLQNVALEIFLASRTSILFAFPDQHTVKKVIKALPRVGVGIKYGIPQTRRASMMSPRQLMRNSNMTQKWQRREISNFEYLMFLNTIAGRTYNDLNQYPIFPWVLTNYESKDLDLSLPSNYRDLSKPIGALNPSRRAYFEERYESWDSDTIPPFHYGTHYSTAAFTLNWLVRVEPFTTMFLALQGGKFDYPDRLFSSVSLSWKNCQRDTSDVKELIPEWYFLPEMFYNSSGYRLGHREDGALVDDIELPPWAKSPEEFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAIRATNVFYYLTYEGSVDLDGVLDPVMREAVENQIRNFGQTPSQLLMEPHPPRSSAMHLSPMMFSAMPEDLCQMLKFYQNSPVIHISANTYPQLSLPSVVTVTAGHQFAVNRWN--------------------------------------CNYTASVQS--PSYAESPQ--------SPGSNQPLTIDPVLAVHGTNNNSNAASRRHLGDNFSQMLKIRSNCFVTTVDSRFLIACGFWDNSFRVFATETAKIVQIVFGHFGVVTCMARSECNITSDCYIASGSADCTVLLWHWNARTQSIVGEGDV---PTPRATLTGHEQAVTSVVISAELGLVVSGSSNGPVLIHTTFGDLLRSLDPPAEFHSPELITMSREGFIVINYDKGNVAAYTINGKKLRHETHND----------------------NLQCMLLSRDGEYLMTAGDRGIVEVWRTFNLAPLYAFPACNAGIRSLALTHDQKYLLAGLSTGSIIVFHIDFNRWHHEYQQRY 3400          

HSP 2 Score: 424.476 bits (1090), Expect = 1.436e-118
Identity = 195/370 (52.70%), Postives = 276/370 (74.59%), Query Frame = 3
Query:  354 IKSMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRK 1463
            I  M    ++K+ +LIGLI+V Q+  +E+V+ VL+LLV G FDME NF+I  +Q + HML+++      L+AE+ SVFI ++RKS  NL    +   IE  L  L+ ++ + ADLLIEMLG++AS+S++VKELK +F  +K +N  WP HS +LLNVL+QMP R+GPD FF+FPG  GSA+ +PP++KWPY+NG+TF  W  LDP ++VNI+R+KPYLYCF+T+KG+GY+ HFVG+ LV+T+MK+K KG QHCVKY  QPR+WYM+++VY+YNRWTKSEI+C ++G+L S  EM W ++TN+ FD+C+IGA+PE   E +  GQ+S IY F+E+L   QI A++ LGP YK  F+F+ EC  NL D+ ++
Sbjct:   18 IVRMTTADNLKFAVLIGLIEVGQVTNREVVNTVLHLLVGGEFDMELNFVIQDAQNIKHMLELLDHCPPNLQAEIWSVFIAILRKSVRNLQACTDVGLIEHVLVRLQRSETVVADLLIEMLGVLASYSITVKELKLLFGTMKATNGKWPRHSAKLLNVLRQMPHRNGPDVFFSFPGRKGSAMVLPPLAKWPYENGFTFTTWFRLDPINSVNIEREKPYLYCFKTSKGVGYTAHFVGNCLVLTSMKVKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCLVNGQLASSTEMAWFVSTNDPFDKCYIGATPELDEERVFCGQMSAIYLFSEALTTQQICAMHRLGPGYKSQFRFDNECYLNLPDNHKR 387          

HSP 3 Score: 382.489 bits (981), Expect = 7.956e-106
Identity = 197/399 (49.37%), Postives = 290/399 (72.68%), Query Frame = 3
Query: 2136 LVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINT 3332
            L+K + D++L N A+WI+    VQ +L+ +LA +FLS+  +++  R ++ VLQ ++++KYYYW+VNPR +SGI+ K  +  P    + I  IR+ I  F+K+L++   NGV ++E+Q  LNYLT ++ED+N+  VL   ++LMSE PS+MVPAFD KHG++ IFKLLA+  + +R+ ALKLLGF+L RST+KRK D M PHNL+TL+ ERLLLY   L++  YN LYEIMTE ++ +I  T H  P+  + LENP +LKV+A LIRQSK T+ L+ V+K+FL D+  LCN+++ENRRTVLQMSVWQ+WL  +  + P++ +++++ D V +L R+LLHHA+K EYGGWRVW+DTLAI+HSKV+Y EF+    ++YE YE+  +D+ +   ++    I+T
Sbjct:  756 LLKQLLDHVLFNPALWIYTPANVQARLYSYLATEFLSDTQIYSNVRRVSTVLQTVHTLKYYYWVVNPRAKSGIIPKGLD-GPRPAQKDILAIRAYILLFLKQLIM-IGNGVKEDELQSILNYLTTMHEDENLHDVLQMLISLMSEHPSSMVPAFDVKHGVRSIFKLLAAESQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLYTLLAERLLLYEESLSLPTYNVLYEIMTEHISQQILYTRHPEPESHYRLENPMILKVVATLIRQSKQTESLIDVKKLFLQDMTLLCNSNRENRRTVLQMSVWQEWLIAMAYIHPKSSEEQKISDMVYSLFRMLLHHAIKHEYGGWRVWVDTLAIVHSKVSYEEFKLQFAQMYEHYERQRTDNITDPALRQARPIST 1152          

HSP 4 Score: 286.189 bits (731), Expect = 1.644e-76
Identity = 155/289 (53.63%), Postives = 211/289 (73.01%), Query Frame = 3
Query: 3504 AQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            ++S +   +FSPGP   PFRIP F WS +HQRLL D+L S+E+D+Q+W+  + +++L+FVN++EN ++V+N VHL++ L+D+LI  CGGLLPLLA+ATSP+ ++D+LE   GM +  AV FL R++N+AD+++FA+SLNF ELE EK MS+GGILRQCLRLVCTCAVRNCLE +          E   Y   +   D     +L     Q L+RG +    ++ V  +  Q  P+ DPE LLQ+MD+NRLRAV+YRDVEE KQAQFL+L+IVYF+SVLMVS+YRD+LEP
Sbjct: 1821 SKSGSTRPMFSPGPTRPPFRIPEFKWSYIHQRLLSDVLFSLETDIQVWRSHSTKSVLDFVNSSENAIFVVNTVHLISQLADNLIIACGGLLPLLASATSPNSELDVLEPTQGMPLEVAVSFLQRLVNMADVLIFATSLNFGELEAEKNMSSGGILRQCLRLVCTCAVRNCLECK----------ERTRYNVGALARDVPGAAHL-----QALIRGAQASPKNI-VESITGQLSPVKDPEKLLQDMDVNRLRAVIYRDVEETKQAQFLSLAIVYFISVLMVSKYRDILEP 2093          

HSP 5 Score: 262.692 bits (670), Expect = 1.945e-69
Identity = 128/233 (54.94%), Postives = 168/233 (72.10%), Query Frame = 3
Query: 4953 TSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELV--SSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQN-----------EYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSG 5612
             SLT++LE ALG   PL+REI  DF+ +LS+TL+GSHGQEL+    GL T + S SVVE+VMLLCSQEWQNSLQKHAGLAFIEL+NEGRLL+HA  DH VRVANEA FIL+RMRA+DV KH++F   CA    ER+ EER+ +HLI +AR RD+ +A++L  +V +++ + HG W    +           + + +++LD WEDD+RRR+R V NP GS+HP+A L  A  +G
Sbjct: 2320 ASLTQKLEIALGPVCPLLREIMVDFAPFLSKTLVGSHGQELLMEGKGLTTFKNSHSVVELVMLLCSQEWQNSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFESQCAQTLLERREEERMCDHLITAARRRDNVIASRLLEKVRNIMCNRHGAWGDSSSTSSGGAIVGAVQKSPYWKLDAWEDDARRRKRMVQNPRGSSHPQATLKAALENG 2552          

HSP 6 Score: 121.709 bits (304), Expect = 9.104e-27
Identity = 64/160 (40.00%), Postives = 102/160 (63.75%), Query Frame = 3
Query: 1470 FEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKL------CLS 1931
            ++G+L ++++F YNPVA D QLCL  +PK N   F H+ HALM  +V+ V+T SI+ TL+S+GG+++LFPLFSQLD ++    D   I  D  P + ++L+  + EL+  S  ++  ++Q++G L+IS+ + RS+    L  E+L S + L      CLS
Sbjct:  597 YDGKLSNAIVFMYNPVATDGQLCLQSSPKGNVSYFVHTPHALMLQDVKAVVTHSIHCTLNSIGGIQVLFPLFSQLDMAHEGLGD---IKRD--PTLCSKLLGFICELVETSQTVQQHMIQNRGFLVISFMLQRSSRE-HLTLEVLGSFLNLTKYLVTCLS 750          
BLAST of Neurobeachin vs. Ensembl Fly
Match: rg (gene:FBgn0266098 transcript:FBtr0344652)

HSP 1 Score: 972.615 bits (2513), Expect = 0.000e+0
Identity = 453/879 (51.54%), Postives = 613/879 (69.74%), Query Frame = 3
Query: 5976 KPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLS------QTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            + +++D+TGPV +ST A L+APG+   G+VSIT +E++FE+D  +     +D +VL Y  HLHGKW+FSE+RAIFSR++L +N+ALEIF+A+R +++FAFPDQ TV+KVI  LPRVG+GIKY + Q R++S+ SPRQ+ + SNMTQ+WQ+REISNF+YLM+LNTIAGRTYNDLNQYPIFPWVL NYES+ +DLS PSNYRDLS PIGALNPSR+ +F+ R+++WD D+   FHYGTHYSTAAF LN+LVRVEPFTT+FL LQ GKFD+ DR F SV+ +WKNCQRDTSDVKELIPE+++LPEMF NS+ YR G  EDG +VDD+ LP WAK+PE+FVRINR ALESE VSCQLH WIDLIFGYKQRGPEAIR+TNVF YLTYEGSV+ D + DP++R+A+E+QIR+FGQTPSQL+ EPHPPR+SA+H+SP+MF+ +  DL  MLKF  NSP++ ++AN +PQ  L +V+TV+A + + VN+WN                                       N  +S+ S   S  +SP         S     PL++DP+L+       +   ++R LG+ F   ++  +  F  T D+R + A GFWD SFR+F+ ET +++Q+V+GHFGVV C+ARSEC    DCYI +GS DCT++LW W  R  +++G+ +      PR T+TGH+  +  V IS ELG++VS S +   LIHT  G+LLRSL     F  P  + +SREG+I++      V  YTINGK + H  ++D                      ++  M L++DG+Y+  + + G V + R  NL  ++++P C+A I SLA+T DQ+++L GL  G+I++F++DFN+WHHEY+ RY
Sbjct: 2980 RELDLDLTGPVNISTKARLIAPGLVAPGTVSITSTEMFFEVDEEHPEFQKIDGEVLKYCDHLHGKWYFSEVRAIFSRRYLLQNVALEIFLASRTSILFAFPDQHTVKKVIKALPRVGVGIKYGIPQTRRASMMSPRQLMRNSNMTQKWQRREISNFEYLMFLNTIAGRTYNDLNQYPIFPWVLTNYESKDLDLSLPSNYRDLSKPIGALNPSRRAYFEERYESWDSDTIPPFHYGTHYSTAAFTLNWLVRVEPFTTMFLALQGGKFDYPDRLFSSVSLSWKNCQRDTSDVKELIPEWYFLPEMFYNSSGYRLGHREDGALVDDIELPPWAKSPEEFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAIRATNVFYYLTYEGSVDLDGVLDPVMREAVENQIRNFGQTPSQLLMEPHPPRSSAMHLSPMMFSAMPEDLCQMLKFYQNSPVIHISANTYPQLSLPSVVTVTAGHQFAVNRWN--------------------------------------CNYTASVQS--PSYAESPQ--------SPGSNQPLTIDPVLAVHGTNNNSNAASRRHLGDNFSQMLKIRSNCFVTTVDSRFLIACGFWDNSFRVFATETAKIVQIVFGHFGVVTCMARSECNITSDCYIASGSADCTVLLWHWNARTQSIVGEGDV---PTPRATLTGHEQAVTSVVISAELGLVVSGSSNGPVLIHTTFGDLLRSLDPPAEFHSPELITMSREGFIVINYDKGNVAAYTINGKKLRHETHND----------------------NLQCMLLSRDGEYLMTAGDRGIVEVWRTFNLAPLYAFPACNAGIRSLALTHDQKYLLAGLSTGSIIVFHIDFNRWHHEYQQRY 3785          

HSP 2 Score: 469.159 bits (1206), Expect = 3.409e-132
Identity = 263/621 (42.35%), Postives = 397/621 (63.93%), Query Frame = 3
Query: 1470 FEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINT 3332
            ++G+L ++++F YNPVA D QLCL  +PK N   F H+ HALM  +V+ V+T SI+ TL+S+GG+++LFPLFSQLD ++    D   I  D  P + ++L+  + EL+  S  ++  ++Q++G L+IS+ + RS+    L  E+L S     L+L++  +  LS   N      QL   +                                          L   + D++L N A+WI+    VQ +L+ +LA +FLS+  +++  R ++ VLQ ++++KYYYW+VNPR +SGI+ K  +  P    + I  IR+ I  F+K+L++   NGV ++E+Q  LNYLT ++ED+N+  VL   ++LMSE PS+MVPAFD KHG++ IFKLLA+  + +R+ ALKLLGF+L RST+KRK D M PHNL+TL+ ERLLLY   L++  YN LYEIMTE ++ +I  T H  P+  + LENP +LKV+A LIRQSK T+ L+ V+K+FL D+  LCN+++ENRRTVLQMSVWQ+WL  +  + P++ +++++ D V +L R+LLHHA+K EYGGWRVW+DTLAI+HSKV+Y EF+    ++YE YE+  +D+ +   ++    I+T
Sbjct:  597 YDGKLSNAIVFMYNPVATDGQLCLQSSPKGNVSYFVHTPHALMLQDVKAVVTHSIHCTLNSIGGIQVLFPLFSQLDMAHEGLGD---IKRD--PTLCSKLLGFICELVETSQTVQQHMIQNRGFLVISFMLQRSSRE-HLTLEVLGSF----LNLTKYLVTCLSA--NSDLLLKQLFCFSF-----------------------------------------LTWQLLDHVLFNPALWIYTPANVQARLYSYLATEFLSDTQIYSNVRRVSTVLQTVHTLKYYYWVVNPRAKSGIIPKGLD-GPRPAQKDILAIRAYILLFLKQLIM-IGNGVKEDELQSILNYLTTMHEDENLHDVLQMLISLMSEHPSSMVPAFDVKHGVRSIFKLLAAESQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLYTLLAERLLLYEESLSLPTYNVLYEIMTEHISQQILYTRHPEPESHYRLENPMILKVVATLIRQSKQTESLIDVKKLFLQDMTLLCNSNRENRRTVLQMSVWQEWLIAMAYIHPKSSEEQKISDMVYSLFRMLLHHAIKHEYGGWRVWVDTLAIVHSKVSYEEFKLQFAQMYEHYERQRTDNITDPALRQARPIST 1162          

HSP 3 Score: 424.476 bits (1090), Expect = 1.447e-118
Identity = 195/370 (52.70%), Postives = 276/370 (74.59%), Query Frame = 3
Query:  354 IKSMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRK 1463
            I  M    ++K+ +LIGLI+V Q+  +E+V+ VL+LLV G FDME NF+I  +Q + HML+++      L+AE+ SVFI ++RKS  NL    +   IE  L  L+ ++ + ADLLIEMLG++AS+S++VKELK +F  +K +N  WP HS +LLNVL+QMP R+GPD FF+FPG  GSA+ +PP++KWPY+NG+TF  W  LDP ++VNI+R+KPYLYCF+T+KG+GY+ HFVG+ LV+T+MK+K KG QHCVKY  QPR+WYM+++VY+YNRWTKSEI+C ++G+L S  EM W ++TN+ FD+C+IGA+PE   E +  GQ+S IY F+E+L   QI A++ LGP YK  F+F+ EC  NL D+ ++
Sbjct:   18 IVRMTTADNLKFAVLIGLIEVGQVTNREVVNTVLHLLVGGEFDMELNFVIQDAQNIKHMLELLDHCPPNLQAEIWSVFIAILRKSVRNLQACTDVGLIEHVLVRLQRSETVVADLLIEMLGVLASYSITVKELKLLFGTMKATNGKWPRHSAKLLNVLRQMPHRNGPDVFFSFPGRKGSAMVLPPLAKWPYENGFTFTTWFRLDPINSVNIEREKPYLYCFKTSKGVGYTAHFVGNCLVLTSMKVKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCLVNGQLASSTEMAWFVSTNDPFDKCYIGATPELDEERVFCGQMSAIYLFSEALTTQQICAMHRLGPGYKSQFRFDNECYLNLPDNHKR 387          

HSP 4 Score: 286.189 bits (731), Expect = 1.445e-76
Identity = 155/289 (53.63%), Postives = 211/289 (73.01%), Query Frame = 3
Query: 3504 AQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            ++S +   +FSPGP   PFRIP F WS +HQRLL D+L S+E+D+Q+W+  + +++L+FVN++EN ++V+N VHL++ L+D+LI  CGGLLPLLA+ATSP+ ++D+LE   GM +  AV FL R++N+AD+++FA+SLNF ELE EK MS+GGILRQCLRLVCTCAVRNCLE +          E   Y   +   D     +L     Q L+RG +    ++ V  +  Q  P+ DPE LLQ+MD+NRLRAV+YRDVEE KQAQFL+L+IVYF+SVLMVS+YRD+LEP
Sbjct: 1831 SKSGSTRPMFSPGPTRPPFRIPEFKWSYIHQRLLSDVLFSLETDIQVWRSHSTKSVLDFVNSSENAIFVVNTVHLISQLADNLIIACGGLLPLLASATSPNSELDVLEPTQGMPLEVAVSFLQRLVNMADVLIFATSLNFGELEAEKNMSSGGILRQCLRLVCTCAVRNCLECK----------ERTRYNVGALARDVPGAAHL-----QALIRGAQASPKNI-VESITGQLSPVKDPEKLLQDMDVNRLRAVIYRDVEETKQAQFLSLAIVYFISVLMVSKYRDILEP 2103          

HSP 5 Score: 262.692 bits (670), Expect = 2.353e-69
Identity = 128/233 (54.94%), Postives = 168/233 (72.10%), Query Frame = 3
Query: 4953 TSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELV--SSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQN-----------EYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSG 5612
             SLT++LE ALG   PL+REI  DF+ +LS+TL+GSHGQEL+    GL T + S SVVE+VMLLCSQEWQNSLQKHAGLAFIEL+NEGRLL+HA  DH VRVANEA FIL+RMRA+DV KH++F   CA    ER+ EER+ +HLI +AR RD+ +A++L  +V +++ + HG W    +           + + +++LD WEDD+RRR+R V NP GS+HP+A L  A  +G
Sbjct: 2705 ASLTQKLEIALGPVCPLLREIMVDFAPFLSKTLVGSHGQELLMEGKGLTTFKNSHSVVELVMLLCSQEWQNSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFESQCAQTLLERREEERMCDHLITAARRRDNVIASRLLEKVRNIMCNRHGAWGDSSSTSSGGAIVGAVQKSPYWKLDAWEDDARRRKRMVQNPRGSSHPQATLKAALENG 2937          
BLAST of Neurobeachin vs. Ensembl Fly
Match: rg (gene:FBgn0266098 transcript:FBtr0344647)

HSP 1 Score: 972.23 bits (2512), Expect = 0.000e+0
Identity = 453/879 (51.54%), Postives = 613/879 (69.74%), Query Frame = 3
Query: 5976 KPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLS------QTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            + +++D+TGPV +ST A L+APG+   G+VSIT +E++FE+D  +     +D +VL Y  HLHGKW+FSE+RAIFSR++L +N+ALEIF+A+R +++FAFPDQ TV+KVI  LPRVG+GIKY + Q R++S+ SPRQ+ + SNMTQ+WQ+REISNF+YLM+LNTIAGRTYNDLNQYPIFPWVL NYES+ +DLS PSNYRDLS PIGALNPSR+ +F+ R+++WD D+   FHYGTHYSTAAF LN+LVRVEPFTT+FL LQ GKFD+ DR F SV+ +WKNCQRDTSDVKELIPE+++LPEMF NS+ YR G  EDG +VDD+ LP WAK+PE+FVRINR ALESE VSCQLH WIDLIFGYKQRGPEAIR+TNVF YLTYEGSV+ D + DP++R+A+E+QIR+FGQTPSQL+ EPHPPR+SA+H+SP+MF+ +  DL  MLKF  NSP++ ++AN +PQ  L +V+TV+A + + VN+WN                                       N  +S+ S   S  +SP         S     PL++DP+L+       +   ++R LG+ F   ++  +  F  T D+R + A GFWD SFR+F+ ET +++Q+V+GHFGVV C+ARSEC    DCYI +GS DCT++LW W  R  +++G+ +      PR T+TGH+  +  V IS ELG++VS S +   LIHT  G+LLRSL     F  P  + +SREG+I++      V  YTINGK + H  ++D                      ++  M L++DG+Y+  + + G V + R  NL  ++++P C+A I SLA+T DQ+++L GL  G+I++F++DFN+WHHEY+ RY
Sbjct: 2914 RELDLDLTGPVNISTKARLIAPGLVAPGTVSITSTEMFFEVDEEHPEFQKIDGEVLKYCDHLHGKWYFSEVRAIFSRRYLLQNVALEIFLASRTSILFAFPDQHTVKKVIKALPRVGVGIKYGIPQTRRASMMSPRQLMRNSNMTQKWQRREISNFEYLMFLNTIAGRTYNDLNQYPIFPWVLTNYESKDLDLSLPSNYRDLSKPIGALNPSRRAYFEERYESWDSDTIPPFHYGTHYSTAAFTLNWLVRVEPFTTMFLALQGGKFDYPDRLFSSVSLSWKNCQRDTSDVKELIPEWYFLPEMFYNSSGYRLGHREDGALVDDIELPPWAKSPEEFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAIRATNVFYYLTYEGSVDLDGVLDPVMREAVENQIRNFGQTPSQLLMEPHPPRSSAMHLSPMMFSAMPEDLCQMLKFYQNSPVIHISANTYPQLSLPSVVTVTAGHQFAVNRWN--------------------------------------CNYTASVQS--PSYAESPQ--------SPGSNQPLTIDPVLAVHGTNNNSNAASRRHLGDNFSQMLKIRSNCFVTTVDSRFLIACGFWDNSFRVFATETAKIVQIVFGHFGVVTCMARSECNITSDCYIASGSADCTVLLWHWNARTQSIVGEGDV---PTPRATLTGHEQAVTSVVISAELGLVVSGSSNGPVLIHTTFGDLLRSLDPPAEFHSPELITMSREGFIVINYDKGNVAAYTINGKKLRHETHND----------------------NLQCMLLSRDGEYLMTAGDRGIVEVWRTFNLAPLYAFPACNAGIRSLALTHDQKYLLAGLSTGSIIVFHIDFNRWHHEYQQRY 3719          

HSP 2 Score: 424.476 bits (1090), Expect = 1.679e-118
Identity = 195/370 (52.70%), Postives = 276/370 (74.59%), Query Frame = 3
Query:  354 IKSMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRK 1463
            I  M    ++K+ +LIGLI+V Q+  +E+V+ VL+LLV G FDME NF+I  +Q + HML+++      L+AE+ SVFI ++RKS  NL    +   IE  L  L+ ++ + ADLLIEMLG++AS+S++VKELK +F  +K +N  WP HS +LLNVL+QMP R+GPD FF+FPG  GSA+ +PP++KWPY+NG+TF  W  LDP ++VNI+R+KPYLYCF+T+KG+GY+ HFVG+ LV+T+MK+K KG QHCVKY  QPR+WYM+++VY+YNRWTKSEI+C ++G+L S  EM W ++TN+ FD+C+IGA+PE   E +  GQ+S IY F+E+L   QI A++ LGP YK  F+F+ EC  NL D+ ++
Sbjct:   18 IVRMTTADNLKFAVLIGLIEVGQVTNREVVNTVLHLLVGGEFDMELNFVIQDAQNIKHMLELLDHCPPNLQAEIWSVFIAILRKSVRNLQACTDVGLIEHVLVRLQRSETVVADLLIEMLGVLASYSITVKELKLLFGTMKATNGKWPRHSAKLLNVLRQMPHRNGPDVFFSFPGRKGSAMVLPPLAKWPYENGFTFTTWFRLDPINSVNIEREKPYLYCFKTSKGVGYTAHFVGNCLVLTSMKVKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCLVNGQLASSTEMAWFVSTNDPFDKCYIGATPELDEERVFCGQMSAIYLFSEALTTQQICAMHRLGPGYKSQFRFDNECYLNLPDNHKR 387          

HSP 3 Score: 382.104 bits (980), Expect = 1.307e-105
Identity = 197/399 (49.37%), Postives = 290/399 (72.68%), Query Frame = 3
Query: 2136 LVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINT 3332
            L+K + D++L N A+WI+    VQ +L+ +LA +FLS+  +++  R ++ VLQ ++++KYYYW+VNPR +SGI+ K  +  P    + I  IR+ I  F+K+L++   NGV ++E+Q  LNYLT ++ED+N+  VL   ++LMSE PS+MVPAFD KHG++ IFKLLA+  + +R+ ALKLLGF+L RST+KRK D M PHNL+TL+ ERLLLY   L++  YN LYEIMTE ++ +I  T H  P+  + LENP +LKV+A LIRQSK T+ L+ V+K+FL D+  LCN+++ENRRTVLQMSVWQ+WL  +  + P++ +++++ D V +L R+LLHHA+K EYGGWRVW+DTLAI+HSKV+Y EF+    ++YE YE+  +D+ +   ++    I+T
Sbjct:  756 LLKQLLDHVLFNPALWIYTPANVQARLYSYLATEFLSDTQIYSNVRRVSTVLQTVHTLKYYYWVVNPRAKSGIIPKGLD-GPRPAQKDILAIRAYILLFLKQLIM-IGNGVKEDELQSILNYLTTMHEDENLHDVLQMLISLMSEHPSSMVPAFDVKHGVRSIFKLLAAESQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLYTLLAERLLLYEESLSLPTYNVLYEIMTEHISQQILYTRHPEPESHYRLENPMILKVVATLIRQSKQTESLIDVKKLFLQDMTLLCNSNRENRRTVLQMSVWQEWLIAMAYIHPKSSEEQKISDMVYSLFRMLLHHAIKHEYGGWRVWVDTLAIVHSKVSYEEFKLQFAQMYEHYERQRTDNITDPALRQARPIST 1152          

HSP 4 Score: 286.189 bits (731), Expect = 1.678e-76
Identity = 155/289 (53.63%), Postives = 211/289 (73.01%), Query Frame = 3
Query: 3504 AQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            ++S +   +FSPGP   PFRIP F WS +HQRLL D+L S+E+D+Q+W+  + +++L+FVN++EN ++V+N VHL++ L+D+LI  CGGLLPLLA+ATSP+ ++D+LE   GM +  AV FL R++N+AD+++FA+SLNF ELE EK MS+GGILRQCLRLVCTCAVRNCLE +          E   Y   +   D     +L     Q L+RG +    ++ V  +  Q  P+ DPE LLQ+MD+NRLRAV+YRDVEE KQAQFL+L+IVYF+SVLMVS+YRD+LEP
Sbjct: 1821 SKSGSTRPMFSPGPTRPPFRIPEFKWSYIHQRLLSDVLFSLETDIQVWRSHSTKSVLDFVNSSENAIFVVNTVHLISQLADNLIIACGGLLPLLASATSPNSELDVLEPTQGMPLEVAVSFLQRLVNMADVLIFATSLNFGELEAEKNMSSGGILRQCLRLVCTCAVRNCLECK----------ERTRYNVGALARDVPGAAHL-----QALIRGAQASPKNI-VESITGQLSPVKDPEKLLQDMDVNRLRAVIYRDVEETKQAQFLSLAIVYFISVLMVSKYRDILEP 2093          

HSP 5 Score: 262.307 bits (669), Expect = 2.559e-69
Identity = 128/233 (54.94%), Postives = 168/233 (72.10%), Query Frame = 3
Query: 4953 TSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELV--SSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQN-----------EYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSG 5612
             SLT++LE ALG   PL+REI  DF+ +LS+TL+GSHGQEL+    GL T + S SVVE+VMLLCSQEWQNSLQKHAGLAFIEL+NEGRLL+HA  DH VRVANEA FIL+RMRA+DV KH++F   CA    ER+ EER+ +HLI +AR RD+ +A++L  +V +++ + HG W    +           + + +++LD WEDD+RRR+R V NP GS+HP+A L  A  +G
Sbjct: 2639 ASLTQKLEIALGPVCPLLREIMVDFAPFLSKTLVGSHGQELLMEGKGLTTFKNSHSVVELVMLLCSQEWQNSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFESQCAQTLLERREEERMCDHLITAARRRDNVIASRLLEKVRNIMCNRHGAWGDSSSTSSGGAIVGAVQKSPYWKLDAWEDDARRRKRMVQNPRGSSHPQATLKAALENG 2871          

HSP 6 Score: 121.709 bits (304), Expect = 1.104e-26
Identity = 64/160 (40.00%), Postives = 102/160 (63.75%), Query Frame = 3
Query: 1470 FEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKL------CLS 1931
            ++G+L ++++F YNPVA D QLCL  +PK N   F H+ HALM  +V+ V+T SI+ TL+S+GG+++LFPLFSQLD ++    D   I  D  P + ++L+  + EL+  S  ++  ++Q++G L+IS+ + RS+    L  E+L S + L      CLS
Sbjct:  597 YDGKLSNAIVFMYNPVATDGQLCLQSSPKGNVSYFVHTPHALMLQDVKAVVTHSIHCTLNSIGGIQVLFPLFSQLDMAHEGLGD---IKRD--PTLCSKLLGFICELVETSQTVQQHMIQNRGFLVISFMLQRSSRE-HLTLEVLGSFLNLTKYLVTCLS 750          
BLAST of Neurobeachin vs. Ensembl Zebrafish
Match: lrba (LPS-responsive vesicle trafficking, beach and anchor containing [Source:ZFIN;Acc:ZDB-GENE-090311-19])

HSP 1 Score: 925.62 bits (2391), Expect = 0.000e+0
Identity = 434/869 (49.94%), Postives = 584/869 (67.20%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTP-VHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            ++TGPV LST A L+AP V V G++SIT  ELYFE+D  + +   +D K+L Y   LHGKW F+EIRA+FSR++L +N ALE+F+ANR AVMF FPD  TV+KV++ LPRVG+G    + Q R+ SLASP+Q++K SNMTQRWQ+REISNF+YLM+LNTI+GRT+NDLNQYP+FPWV+ NY+SE +DL+ PSNYRDLS PIGALNP R  FF  RF++W+D+    FHYGTHYST++F   +L+R+EPFTT FLN Q GKFDHADRTF SV++ W+NCQRDTSDVKELIPEF+YLPEMF NSN+Y  G  +DG +V DV LP WAK+PE+FVRINR ALESE VSCQLH WIDLIFGYKQ+GPEAIR+ NVF YLTYEG+VN   I DPM+R+A+E QIRSFGQTP QL+ EPHPPR+SA+ V+PLMFT  +  D++M+LKF SNSP+  + AN       +AV+TV+AN ++ VNKW+ +           QTS               ++Q+ Q                                QLP+ +DPL++     ++R + +  D  ++ +   F  T DNR I   GFWDKSFR++S +TG+L Q+V+GH  VV C+ARSE     DCY+++GS D T++LW W N +H+ +G+    E   PR  +TGH  E+ C  +  ELG+++S  ++  CL+H++ G+LLR+L   D  + P  ++ S EG+ ++        +++INGK +GH+   D                      +I AM L+KDG Y+    + G + + + H+L+ + +YP CDA I S+AI  DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct: 2070 NLTGPVNLSTSAQLVAPAVVVKGTLSITALELYFEVDEEDPSFKNIDPKILAYTEGLHGKWLFTEIRAVFSRRYLLQNTALEVFMANRTAVMFNFPDAATVKKVVHCLPRVGVGTNVGLPQTRRISLASPKQLYKASNMTQRWQRREISNFEYLMFLNTISGRTFNDLNQYPVFPWVITNYDSEELDLTLPSNYRDLSKPIGALNPKRAAFFSERFESWEDEQVPKFHYGTHYSTSSFTQMWLLRIEPFTTFFLNFQGGKFDHADRTFSSVSRAWRNCQRDTSDVKELIPEFYYLPEMFVNSNNYNLGVMDDGTVVSDVELPPWAKSPEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEAIRALNVFYYLTYEGAVNLSSISDPMLREAVESQIRSFGQTPCQLLIEPHPPRSSAMQVTPLMFTEQMQQDVIMVLKFPSNSPVTHVAANTQSGLTNAAVITVTANRLFAVNKWHGLTGH--------QTS---------------SVQDQQ-------------------------------YQLPVEIDPLIASNVGAHRRQISDLLDQSIQVNAQCFVITADNRFILLCGFWDKSFRVYSTDTGKLTQIVFGHLDVVTCLARSESYIGGDCYVLSGSRDATLLLWYW-NGKHSSIGESAGTEFVTPRAILTGHDCEVTCASVCAELGLVISGCREGPCLVHSMNGDLLRTLEGPDGCMRPRLVLSSTEGHCVIYYDKGHFCVFSINGKLLGHMEVED----------------------NIKAMLLSKDGQYLLCGGDAGVLNVWQIHDLKQLFTYPGCDAGIRSMAIAHDQRCIITGMASGSIVLFYNDFNRWHHEYQTRY 2861          

HSP 2 Score: 813.913 bits (2101), Expect = 0.000e+0
Identity = 409/986 (41.48%), Postives = 639/986 (64.81%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGIN 3329
             I +K+ +L GL++  ++  ++ V+ +  LLV G FD+E NF+I  ++ +I M++++   DS  +AE+ S+F  +++KS  NL    +   I+  L+ +  A+ M ADL+++MLG++AS+S++VKELK  F  LKG    WP H+V+LL+VL+ M  R+GPD FF+FPG   +AIA+PPI+KWPYQNG+TF+ W+ LDP + +N+D+DKPYLYCFRTNKGLGYS HFVG  L++T++K K KG QHCVKY+ +P++WYMV++V++YNRW  SEI CY++GEL S  E+ W +NT++ FD+CF+G+S       +  GQ+  +Y F+E+L+  QI AIY LGP YKG FK +AE     ++  +   ++G+L   + F YNP A D QLCL  +PK N  +F HS HALM  +V+ V+T S+ S +HS+GGV++LFPLF+QLDF   L + G  +   V       L++ + ELL GS A++ Q++  KG L+I Y + +S+  + +   +LD ++                     AFA  L +L TG                                      + L+K + D++L N  +WIHA  +VQL L+ +LA +F+S   ++N  R +  VLQ ++++KY+YW+VNP DRSGI  K  +  P  N ++I ++R+ +  F+K+L++K H G+ ++E+Q  LNYL  ++EDDN+  VL   V LMSE P +MV AFD ++GI+VIFKLLAS  E +R+ ALK+LG++L+  + KRK + M+ H LF+L+ ERL+L+S   T+  YN L+EI+TE++  ++    H  PD T  ++NP +LKVIA L++ +    E ++VR++FL+D+  L NNS+ENRR++LQ SVWQ+W+  L  ++P+  +++++ + V  + R+LL+HA+K E+GGWRVW+DTL+I HSKV + + + ++ +++ +Y++  S+  S S I+   G++
Sbjct:   15 GIRMKFAVLAGLLEAGEVSNRDTVETIFNLLVGGQFDLEMNFIIQETESIICMVELLDKCDSTCQAEVWSMFTAVLKKSLRNLQACTDIGLIQLVLQRIDRAETMIADLMVDMLGVLASYSITVKELKLYFSKLKGEQGQWPPHAVKLLSVLKSMAQRNGPDSFFSFPGKSAAAIALPPIAKWPYQNGFTFHTWLRLDPINNINVDKDKPYLYCFRTNKGLGYSAHFVGGCLIVTSLKSKAKGFQHCVKYDFKPQKWYMVTIVHIYNRWKNSEISCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQMGAVYLFSEALSAAQILAIYQLGPGYKGTFKHKAESDLLFAEHHKMLLYDGKLSACIAFTYNPRATDAQLCLESSPKDNASIFVHSPHALMLQDVKAVVTHSVQSAIHSIGGVQVLFPLFAQLDF---LQHSGDELDTSVC----CTLLSFVMELLKGSVAMQEQVLACKGFLVIGYSLEKSS-KVHVTRPVLDIVL---------------------AFARYLSNLPTG--------------------------------------VMLLKQLCDHILFNPTIWIHAPAKVQLVLYTYLATEFISTVTIYNAIRRVGTVLQVMHTLKYFYWVVNPLDRSGITPKGLD-GPRPNQKEIHSLRAFLLLFVKQLIMKDH-GIKEDELQSILNYLLTMHEDDNLMDVLQLLVALMSEHPGSMVQAFDQRNGIRVIFKLLASTSEGIRVQALKVLGYFLKYLSPKRKSEVMLAHGLFSLLTERLMLHSNQFTVTTYNVLFEILTEQICTQVIHKQHPDPDSTVKIQNPQILKVIAALLKNAPPEAESMEVRRIFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCFINPKNSEEQKITEMVYAIFRILLYHAIKYEWGGWRVWVDTLSITHSKVTFEQHKENLARMFLEYQRMGSEGGSESRIRTISGVS 931          

HSP 3 Score: 258.455 bits (659), Expect = 4.313e-68
Identity = 139/263 (52.85%), Postives = 185/263 (70.34%), Query Frame = 3
Query: 4956 SLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQ-NEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTS 5735
            S+++RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLLCSQEWQNS+QK+AGLAFIELVNEGRLL+H   DH VRVANEA FILSR RAED+QKH+EF   CA    E++ EE++ +HLI +A+ RD   + +L  ++ +++   HG W S   +   EF+RLDYWEDD RRRRRF+ NP+GSTH EA L  A+       ++  K K  I  + L   N +S ++     +D+T++S
Sbjct: 1805 SISERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSHTMKDHLVRVANEAEFILSRQRAEDIQKHAEFESHCAQYSAEKRDEEKMCDHLIRAAKYRDHVTSTQLIQKIVNILTDKHGAWGSSAFSRPREFWRLDYWEDDLRRRRRFIRNPFGSTHSEATLKAAAEHAPEEDVL--KGKQSIRSSVLGNQNSESELLLE---DDDTLSS 2062          

HSP 4 Score: 244.588 bits (623), Expect = 8.466e-64
Identity = 139/279 (49.82%), Postives = 192/279 (68.82%), Query Frame = 3
Query: 3534 SPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            S   RS  FRIP F WS +HQRLL DLL SIE+D+Q+W+  + + +++FVN++EN V+V N VHL++ + D+LI  CGG+LPLL+AATS S +++ +E   G+A+  ++ FL R++N+ D+++FASSLNF E+E EK MS+GGILRQCLRLVC  AVRNCLE +   L            + S  E S+          Q L+   +       V+ +     PI D + LLQ+MDINRLRAVV+RD+E++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1332 SSSARSTMFRIPEFKWSHMHQRLLTDLLFSIETDVQMWRSHSTKTVMDFVNSSENVVFVHNTVHLISQVVDNLIMACGGILPLLSAATSSSHELENIEPSQGLAVEASLMFLQRLINLVDVLIFASSLNFTEIEAEKNMSSGGILRQCLRLVCAMAVRNCLECQQHTL------------SKSGAESSR--------GQQSLLGAAKSIPAQSPVDIVTGGMSPIRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEP 1590          
BLAST of Neurobeachin vs. Ensembl Zebrafish
Match: nbeaa (neurobeachin a [Source:ZFIN;Acc:ZDB-GENE-050320-68])

HSP 1 Score: 884.404 bits (2284), Expect = 0.000e+0
Identity = 422/874 (48.28%), Postives = 574/874 (65.68%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHV-----SPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            ++ GPV LSTPA L+AP +   G++SIT +E+YFE+D ++     +D KVL Y   LHGKW FSEIRA+FSR++L +N  LE+F+ANR +VMF FPDQ TV+KV+Y LPRVG+G  Y + Q R+ SLA+PRQ+FK SNMTQRWQ+REISNF+YLM+LNTIAGRTYNDLNQYP+FPWVL NYESE +DL+ P N+RDLS PIGALNP R  F+  R++ W+DD  +  HY + YSTAA  L +LVR+EPFTT FLN    KFDH DRTF  +A++W++CQRDTSDV+ELIPEF+YLPEMF NS+ Y  G  ED   V DV LP WAK PEDFVRINR ALESE VSCQLH WIDLIFGYKQRGPEA+R+ NVF YL+YEGS+N D I DP +R+++E QI+SFGQ PSQL+ EPHPPR+SA+H+     SPLMF   +  D++M+LKF SNSP+  + AN  P   + A +TV+ + ++ VN+W++                   L GA                           S++  H             LP+ MD L++  + I+KR + +  D  ++ +   F  T DNR I A GFWDKSFR++S ETG+L Q+V+GH+ VV C+ARSE     DCYIV+GS D T++LW W  R H +  + N  +   PR  +TGH  E+VCV +  ELG+++S +K+  CL+HTI G+LLR+L   ++ + P  + +S EG+ ++  +      ++INGK             L   ME++          S  A+ L+ DG  +    ++G V + +  + + ++ YP CDA I ++ ++ DQR ++ G+ +G+IV FN+DFN+WH+E+++RY
Sbjct: 1556 NLAGPVVLSTPAQLVAPVIVARGTLSITTTEIYFEVDEDDPTFKKIDAKVLGYTEGLHGKWMFSEIRAVFSRRYLLQNTGLEVFMANRTSVMFNFPDQATVKKVVYSLPRVGVGTSYGLPQARRISLATPRQLFKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEDLDLTLPGNFRDLSKPIGALNPKRAVFYAERYETWEDDGAAPHHYSSLYSTAASTLYWLVRIEPFTTFFLNCNENKFDHPDRTFSGIARSWRSCQRDTSDVRELIPEFYYLPEMFVNSSGYDLGVREDRTAVCDVELPVWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFHYLSYEGSINLDTITDPQLRESMEAQIQSFGQAPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLSIPAAVTVTCSRLFAVNRWHNTVG----------------LRGAPGY------------------------SLEQAH------------HLPIEMDSLIANNSGISKRQITDLVDQSIQINTHCFVVTADNRYILACGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNNSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLRPRLISVSSEGHCIIYYERGQFCNFSINGK-------------LLAQMEIN---------DSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQNRY 2355          

HSP 2 Score: 321.242 bits (822), Expect = 3.339e-87
Identity = 157/352 (44.60%), Postives = 253/352 (71.88%), Query Frame = 3
Query: 2202 VQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKV 3257
            VQL L+ +L+ +F+    +++  R +  VLQ ++++KYYYW  NP + SGI  K  +  P  + ++I ++R+ +  F+K+L+LK   GV ++E+Q  LNYL  ++ED+NI  VL   V LMSE P++M+PAFD ++GI+VI+KLLAS  E++R+ ALK+LG++L+   +KRK + M  H+LFTL+GERL++++  +T+  YNTLYEI+TE++  ++    H  PD T  ++NP +LKV+A L++ S  + EL++VR++FL+D+  L +NS+ENRR +LQ SVWQDW+F L  ++P+ P+++++ + V N+ R+LL+HA+K E+GGWRVW+DTL+I HSKV Y   +  + K+
Sbjct:    1 VQLSLYTYLSAEFIGTATIYSTIRRVGTVLQLMHTLKYYYWASNPLESSGITPKGLD-GPRPSQKEIISLRAFMLLFLKQLILK-DRGVKEDELQSILNYLLTMHEDENIHDVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIRVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMMHTSTVTITTYNTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKSSSPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLGYINPKNPEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKM 350          

HSP 3 Score: 259.225 bits (661), Expect = 2.173e-68
Identity = 129/215 (60.00%), Postives = 169/215 (78.60%), Query Frame = 3
Query: 4956 SLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELV--SSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWAS-DQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAIL 5591
            S+T +LE+AL   APL+REIF DF+ +LSRTL+GSHGQEL+   +GLV ++ STSVVE+VMLLCSQEWQNS+QK+AGLAFIEL+NEGRLL HA  DH VRVANEA FIL+R RAEDV KH+EF   CA    +R+ EE++ +HLI++A+ RD   AN+LK ++ +++ + HG W +  Q++ ++F+RLDYWEDD RRRRRFV N +GSTH +  L
Sbjct: 1289 SITTKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEFESNCAQYAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGTMSQSQLHDFWRLDYWEDDLRRRRRFVRNAFGSTHTDVTL 1503          

HSP 4 Score: 252.677 bits (644), Expect = 2.298e-66
Identity = 141/280 (50.36%), Postives = 195/280 (69.64%), Query Frame = 3
Query: 3531 FSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            FSPGPR+  FRIP F WS +HQRLL DLL ++ESD+ +W+  + +++++FVN+ EN ++V N +HL++ + D++I  CGG+LPLL+AATSPS +++ +E   GM+   AV FL R+M + D++VFASSLNF E+E EK MS+GG++RQCLRLVC  AVRNCLE R R                    D     +LP    QE ++     S  V +  +     PI DP+ LLQ++DINRLRAVV+RDV+++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct:  709 FSPGPRTTMFRIPEFKWSPMHQRLLTDLLFALESDVHMWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPSTELENVEATQGMSSETAVTFLSRLMAMVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQR------------------QRDRGSKTSLPISKTQENLQTAASASKTV-IQNVPRNLSPIKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEP 969          
BLAST of Neurobeachin vs. Ensembl Zebrafish
Match: nbeaa (neurobeachin a [Source:ZFIN;Acc:ZDB-GENE-050320-68])

HSP 1 Score: 883.634 bits (2282), Expect = 0.000e+0
Identity = 422/874 (48.28%), Postives = 574/874 (65.68%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHV-----SPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            ++ GPV LSTPA L+AP +   G++SIT +E+YFE+D ++     +D KVL Y   LHGKW FSEIRA+FSR++L +N  LE+F+ANR +VMF FPDQ TV+KV+Y LPRVG+G  Y + Q R+ SLA+PRQ+FK SNMTQRWQ+REISNF+YLM+LNTIAGRTYNDLNQYP+FPWVL NYESE +DL+ P N+RDLS PIGALNP R  F+  R++ W+DD  +  HY + YSTAA  L +LVR+EPFTT FLN    KFDH DRTF  +A++W++CQRDTSDV+ELIPEF+YLPEMF NS+ Y  G  ED   V DV LP WAK PEDFVRINR ALESE VSCQLH WIDLIFGYKQRGPEA+R+ NVF YL+YEGS+N D I DP +R+++E QI+SFGQ PSQL+ EPHPPR+SA+H+     SPLMF   +  D++M+LKF SNSP+  + AN  P   + A +TV+ + ++ VN+W++                   L GA                           S++  H             LP+ MD L++  + I+KR + +  D  ++ +   F  T DNR I A GFWDKSFR++S ETG+L Q+V+GH+ VV C+ARSE     DCYIV+GS D T++LW W  R H +  + N  +   PR  +TGH  E+VCV +  ELG+++S +K+  CL+HTI G+LLR+L   ++ + P  + +S EG+ ++  +      ++INGK             L   ME++ S           A+ L+ DG  +    ++G V + +  + + ++ YP CDA I ++ ++ DQR ++ G+ +G+IV FN+DFN+WH+E+++RY
Sbjct: 2199 NLAGPVVLSTPAQLVAPVIVARGTLSITTTEIYFEVDEDDPTFKKIDAKVLGYTEGLHGKWMFSEIRAVFSRRYLLQNTGLEVFMANRTSVMFNFPDQATVKKVVYSLPRVGVGTSYGLPQARRISLATPRQLFKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEDLDLTLPGNFRDLSKPIGALNPKRAVFYAERYETWEDDGAAPHHYSSLYSTAASTLYWLVRIEPFTTFFLNCNENKFDHPDRTFSGIARSWRSCQRDTSDVRELIPEFYYLPEMFVNSSGYDLGVREDRTAVCDVELPVWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFHYLSYEGSINLDTITDPQLRESMEAQIQSFGQAPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLSIPAAVTVTCSRLFAVNRWHNTVG----------------LRGAPGY------------------------SLEQAH------------HLPIEMDSLIANNSGISKRQITDLVDQSIQINTHCFVVTADNRYILACGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNNSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLRPRLISVSSEGHCIIYYERGQFCNFSINGK-------------LLAQMEINDST---------RAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQNRY 2998          

HSP 2 Score: 843.573 bits (2178), Expect = 0.000e+0
Identity = 417/962 (43.35%), Postives = 638/962 (66.32%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKV 3257
            NI +K+ +LIGLI+V ++  ++IV+ VL LLV G FD+E NF+I  ++ +  M+++++  D   +AE+ S+F  ++RKS  NL  + E   I++ L+ +   D M ADLL++MLG++AS+S++VKELK +F +L+G    WP H+++LL+VL QMP R GPD FFNFPG   +AIA+PPI+KWPYQNG+T N W  +DP + +N+D+DKPYLYCFRT+KG+GYS HFVG+ L++T++K K KG QHCVKY+ QPR+WYM+S+V++YNRW  SEIRCY++G+L+S  +M W +NTN+ +D+CF+G+S       +  GQ+  +Y F+E+LNP QI AI+ LGP YK  FKF++E   +L++  ++  ++G+L  S+ F YN  A D QLCL  +P+ N  +F HS HALM  +V+ ++T SI+S +HS+GG+++LFPLFSQLD  YR PND     + V   + A L+  L ELL  S A++ Q++  KG L+I Y + +S                     S++HI      Q   +FA  L  LT                                      H   L+K + D++L N A+WIH   +VQL L+ +L+ +F+    +++  R +  VLQ ++++KYYYW  NP + SGI  K  +  P  + ++I ++R+ +  F+K+L+LK   GV ++E+Q  LNYL  ++ED+NI  VL   V LMSE P++M+PAFD ++GI+VI+KLLAS  E++R+ ALK+LG++L+   +KRK + M  H+LFTL+GERL++++  +T+  YNTLYEI+TE++  ++    H  PD T  ++NP +LKV+A L++ S  + EL++VR++FL+D+  L +NS+ENRR +LQ SVWQDW+F L  ++P+ P+++++ + V N+ R+LL+HA+K E+GGWRVW+DTL+I HSKV Y   +  + K+
Sbjct:   65 NIKMKFAVLIGLIQVGEVSNRDIVETVLNLLVGGEFDLEMNFIIQDAESIACMVELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIQQVLQKMSAVDDMIADLLVDMLGVLASYSITVKELKLLFSMLRGDAGVWPRHAIKLLSVLNQMPQRHGPDTFFNFPGRSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKPYLYCFRTSKGIGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHVNTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSISFTYNAKATDAQLCLESSPRENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFSQLD--YRQPND-----SPVETTVCATLLAFLVELLKSSVAMQEQMLGGKGFLVIGYLLEKS---------------------SRVHITRAVLEQF-LSFAKYLDGLT--------------------------------------HGAPLLKQLCDHVLFNAAIWIHTPAKVQLSLYTYLSAEFIGTATIYSTIRRVGTVLQLMHTLKYYYWASNPLESSGITPKGLD-GPRPSQKEIISLRAFMLLFLKQLILK-DRGVKEDELQSILNYLLTMHEDENIHDVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIRVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMMHTSTVTITTYNTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKSSSPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLGYINPKNPEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKM 957          

HSP 3 Score: 259.225 bits (661), Expect = 2.602e-68
Identity = 129/215 (60.00%), Postives = 169/215 (78.60%), Query Frame = 3
Query: 4956 SLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELV--SSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWAS-DQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAIL 5591
            S+T +LE+AL   APL+REIF DF+ +LSRTL+GSHGQEL+   +GLV ++ STSVVE+VMLLCSQEWQNS+QK+AGLAFIEL+NEGRLL HA  DH VRVANEA FIL+R RAEDV KH+EF   CA    +R+ EE++ +HLI++A+ RD   AN+LK ++ +++ + HG W +  Q++ ++F+RLDYWEDD RRRRRFV N +GSTH +  L
Sbjct: 1932 SITTKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEFESNCAQYAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGTMSQSQLHDFWRLDYWEDDLRRRRRFVRNAFGSTHTDVTL 2146          

HSP 4 Score: 235.343 bits (599), Expect = 4.739e-61
Identity = 129/316 (40.82%), Postives = 183/316 (57.91%), Query Frame = 3
Query: 3531 FSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLI------------------------------------XXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            FSPGPR+  FRIP F WS +HQRLL DLL ++ESD+ +W+  + +++++FVN+ EN ++V N +HL++ + D++I                                              ++ T    +++ +E   GM+   AV FL R+M + D++VFASSLNF E+E EK MS+GG++RQCLRLVC  AVRNCLE R R                    D     +LP    QE ++     S  V +  +     PI DP+ LLQ++DINRLRAVV+RDV+++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1316 FSPGPRTTMFRIPEFKWSPMHQRLLTDLLFALESDVHMWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPSSSKVSANPTQGSSCLQKGAKSSEVNSLPGSSGTGVETELENVEATQGMSSETAVTFLSRLMAMVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQR------------------QRDRGSKTSLPISKTQENLQTAASASKTV-IQNVPRNLSPIKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEP 1612          
BLAST of Neurobeachin vs. Ensembl Zebrafish
Match: nbeab (neurobeachin b [Source:ZFIN;Acc:ZDB-GENE-120329-2])

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 429/870 (49.31%), Postives = 574/870 (65.98%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEI-KDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            ++ GPV LSTPA L+AP     G++SIT +E+YFE+D ++     +D KVL Y   LHGKW FSEIRA+F+R+FL +N ALEIF+ANR +VMF FPDQ TV+KV+Y LP VG+G  Y + Q R+ SLASPRQ+FK SNMTQRWQ+REISNF+YLM+LNTIAGRTYNDLNQYP+FPWVL N+ESE +DL+ PSN+RDLS PIGALNP R  F+ +R+++WD+++    HY THYSTA   L++LVR+EPFTT FLN    KFDH +RTF S+A++W++CQRDT+DVKELIPEF+YLPEMF NSN Y  G  +DG  V DV LP WAK PEDFVRINR ALESE VSCQLH WIDLIFGYKQRGPEA R+ NVF +LTYEGSVN D +  DP +R+A E QI+S GQ+PSQL+ EPHPPR+SA+H+SPLMF   +  D++M+LKF SNSP+  + AN  P   L AV+TV+ + ++ VN+W++                   L GA                           S++  H             LP+ MD L++  +  NKR + +  D  ++ +   F  T DNR I   GFWDKSFR++S +TG+L Q+V+GH+ VV C+ARSE     DCYIV+GS D T++LW W  R H +  + N  +   PR  +TGH  E+VCV +  ELGII+S +K+  CL+HTI G+LLR+L   DS V P  + +S EG+ ++         ++INGK             L   ME++ S           A+ L+ DG  +    ++G V + +  + + ++ YP CDA + ++ ++ DQR ++ G+ +G+IV FN+DFN+WH E+++RY
Sbjct: 1999 NLAGPVVLSTPAQLIAPVTVARGTLSITTTEIYFEVDEDDPAFRRIDAKVLVYSEGLHGKWMFSEIRAVFTRRFLLQNTALEIFMANRTSVMFNFPDQPTVKKVVYSLPCVGVGTSYGLPQARRISLASPRQLFKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNFESEELDLTVPSNFRDLSKPIGALNPKRAVFYADRYESWDEETPPC-HYTTHYSTANSTLHWLVRIEPFTTFFLNANGNKFDHPNRTFSSIARSWRHCQRDTADVKELIPEFYYLPEMFVNSNGYCLGDRDDGVPVCDVELPAWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAARALNVFHHLTYEGSVNLDSLASDPPLREATEAQIQSVGQSPSQLLIEPHPPRSSAMHLSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLTLPAVVTVTCSRLFAVNRWHNTVG----------------LRGAPGY------------------------SLEQAH------------HLPIEMDSLIANNSGTNKRQITDLVDQSIQINTQCFVVTADNRYILVCGFWDKSFRVYSSDTGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNNSDYPAPRAVLTGHDFEVVCVSVCAELGIIISGAKEGPCLVHTITGDLLRALEGPDSCVLPRLICVSSEGHCIIYFDRGQFCSFSINGK-------------LLAQMEINDST---------RAIVLSSDGQNLVTGGDNGVVEVWQACDFKQLYVYPGCDAGVRAMDLSHDQRTLVTGMASGSIVAFNIDFNRWHFEHQNRY 2793          

HSP 2 Score: 797.349 bits (2058), Expect = 0.000e+0
Identity = 398/932 (42.70%), Postives = 616/932 (66.09%), Query Frame = 3
Query:  462 LVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKV 3257
            LV G FD+E NF+I  ++ +I ML++++  +   +AE+ S+F  ++RKS  NL  + E   I++ L  + + D M ADLL++MLG++AS+S++VKELK +F +L+G    WP H+V+LL+VL QM  R GPD FFNFPG   +AIA+PPI+KWPYQNG+T N W  +DP + +N+D+DKPYLYCFRT+KG+GYS HFVG+ L++T++K K KG QHCVKY+ QPR+WYMVS+V++YNRW  SEIRCY++G+L+S  +M W +NTN+ +D+CF+G+S       +  GQ+  IY F+E+LNP QI AI+ LGP YK  FKF++E   +L+D  ++  ++G+L +S+ F YN  A D QLCL  +P+ N  +F HS HALM  +V+ ++T SI+S +HS+GG+++LFPLF+QLDF     N+ Q     V   + + L+  L ELL  S A++ Q++  KG L+I Y + +S                     S++H+          A  DQ +S       +Y                            G +H   L+K + D++L N A+WIH   +VQL L+ +L+++F+    +++  R +  VLQ ++ +KYYYW VNP + SGI  K  +  P  + ++I+++R+ +  F+K+L+LK   GV ++E+Q  LNYL  ++ED+N+  VL   V LMSE P++M+PAFD ++GI+V++KLLAS  E++R+ ALK+L ++L+   +KRK + M  ++LFTL+GERL+L+S  +++  YNTLYEI+TE++  ++    H  PD T  ++NP +LKV+A L++ S  + +L++VR++FL+D+  L +NS+ENRR +LQ SVWQDW+F L  ++P+  +++++ + V N+ R+LL+HA+K E+GGWRVW+DTL+I HSKV Y   +  + K+
Sbjct:    1 LVGGEFDLEMNFIIQDAEAIICMLELLEHCEVTCQAEIWSMFTAILRKSVRNLQTSSEVGLIQRLLIKMSSVDDMIADLLVDMLGVLASYSITVKELKLLFSMLRGEGGLWPRHAVKLLSVLSQMAQRHGPDTFFNFPGRSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKPYLYCFRTSKGIGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMVSIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHVNTNDSYDKCFLGSSETADANRVFCGQLGAIYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLADHHKQVLYDGKLANSISFTYNAKATDAQLCLESSPRENPSIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDFHQH--NESQ-----VETTVCSTLLAFLMELLKSSVAMQEQMLGGKGFLVIGYLLEKS---------------------SRVHVTR--------AVLDQFLSFA-----KYLD--------------------------GLTHGAPLLKQLCDHILFNAAIWIHIPAKVQLSLYTYLSSEFIGTTTIYSTIRRVGTVLQIMHILKYYYWAVNPNNTSGITPKGLD-GPRPSQKEISSLRAFMLLFLKQLILK-DRGVKEDELQSILNYLLTMHEDENLHDVLQLLVALMSEHPASMIPAFDQRNGIRVVYKLLASKSESIRVQALKVLAYFLKHLGHKRKVEIMHTNSLFTLLGERLMLHSNTVSITTYNTLYEILTEQVCTQVVHKPHVEPDSTVKIQNPMILKVVATLLKNSTPSADLMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLGYINPKNSEEQKITEMVYNIFRILLYHAIKHEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKM 863          

HSP 3 Score: 259.225 bits (661), Expect = 2.350e-68
Identity = 129/219 (58.90%), Postives = 165/219 (75.34%), Query Frame = 3
Query: 4956 SLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWA------------SDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTH 5576
            S+T +LE+AL   APL+REIF DF+ +LSRTL+GSHGQEL+  GLV ++ STSVVE+VMLLCSQEWQNS+QK+AGLAFIEL+NEGRLL HA  DH VRVANEA FIL+R RAEDV KH+EF   CA    +R+ EE + +HLI++A+ RD   AN+LK ++ +++ + HG W             S Q + ++F+RLDYWEDD RRRRRF+ NP+GSTH
Sbjct: 1723 SITTKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEFESSCAQYAADRKEEETMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAAAQRSSCLFPFSSQQQQHDFWRLDYWEDDLRRRRRFIRNPFGSTH 1941          

HSP 4 Score: 250.366 bits (638), Expect = 1.327e-65
Identity = 144/296 (48.65%), Postives = 201/296 (67.91%), Query Frame = 3
Query: 3498 AVAQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNY-----PISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            A+  +  + + FSPGPR+  FRIP F WS +HQRLL DLL ++ESD+ IW+  + ++I++FVN+ EN ++V N +HL++ + D++I  CGG+LPLL+AATSPS +++ LE   GM+   AV FL R+M I D++VFASSLNF E+E EK MS+GG++RQCLRLVC  AVRNCLE R R                    D     +L     QE ++ +   S      +  ++N+     PI DP+ LLQ++DINRLRA V+RDV+++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1190 AMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFALESDVHIWRSHSTKSIMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPSSEMEGLEVTQGMSSETAVIFLTRLMAIVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQR------------------QRDRSLKSSLSCSKSQEGLQSVSTAS------KTTIENFPSNVSPIKDPDRLLQDVDINRLRAAVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEP 1461          
BLAST of Neurobeachin vs. Ensembl Zebrafish
Match: nbeaa (neurobeachin a [Source:ZFIN;Acc:ZDB-GENE-050320-68])

HSP 1 Score: 872.463 bits (2253), Expect = 0.000e+0
Identity = 422/874 (48.28%), Postives = 574/874 (65.68%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHV-----SPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            ++ GPV LSTPA L+AP +   G++SIT +E+YFE+D ++     +D KVL Y   LHGKW FSEIRA+FSR++L +N  LE+F+ANR +VMF FPDQ TV+KV+Y LPRVG+G  Y + Q R+ SLA+PRQ+FK SNMTQRWQ+REISNF+YLM+LNTIAGRTYNDLNQYP+FPWVL NYESE +DL+ P N+RDLS PIGALNP R  F+  R++ W+DD  +  HY + YSTAA  L +LVR+EPFTT FLN    KFDH DRTF  +A++W++CQRDTSDV+ELIPEF+YLPEMF NS+ Y  G  ED   V DV LP WAK PEDFVRINR ALESE VSCQLH WIDLIFGYKQRGPEA+R+ NVF YL+YEGS+N D I DP +R+++E QI+SFGQ PSQL+ EPHPPR+SA+H+     SPLMF   +  D++M+LKF SNSP+  + AN  P   + A +TV+ + ++ VN+W++                   L GA                           S++  H             LP+ MD L++  + I+KR + +  D  ++ +   F  T DNR I A GFWDKSFR++S ETG+L Q+V+GH+ VV C+ARSE     DCYIV+GS D T++LW W  R H +  + N  +   PR  +TGH  E+VCV +  ELG+++S +K+  CL+HTI G+LLR+L   ++ + P  + +S EG+ ++  +      ++INGK             L   ME++ S           A+ L+ DG  +    ++G V + +  + + ++ YP CDA I ++ ++ DQR ++ G+ +G+IV FN+DFN+WH+E+++RY
Sbjct:  309 NLAGPVVLSTPAQLVAPVIVARGTLSITTTEIYFEVDEDDPTFKKIDAKVLGYTEGLHGKWMFSEIRAVFSRRYLLQNTGLEVFMANRTSVMFNFPDQATVKKVVYSLPRVGVGTSYGLPQARRISLATPRQLFKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEDLDLTLPGNFRDLSKPIGALNPKRAVFYAERYETWEDDGAAPHHYSSLYSTAASTLYWLVRIEPFTTFFLNCNENKFDHPDRTFSGIARSWRSCQRDTSDVRELIPEFYYLPEMFVNSSGYDLGVREDRTAVCDVELPVWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFHYLSYEGSINLDTITDPQLRESMEAQIQSFGQAPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLSIPAAVTVTCSRLFAVNRWHNTVG----------------LRGAPGY------------------------SLEQAH------------HLPIEMDSLIANNSGISKRQITDLVDQSIQINTHCFVVTADNRYILACGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNNSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLRPRLISVSSEGHCIIYYERGQFCNFSINGK-------------LLAQMEINDST---------RAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQNRY 1108          

HSP 2 Score: 257.684 bits (657), Expect = 3.565e-69
Identity = 129/215 (60.00%), Postives = 169/215 (78.60%), Query Frame = 3
Query: 4956 SLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELV--SSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWAS-DQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAIL 5591
            S+T +LE+AL   APL+REIF DF+ +LSRTL+GSHGQEL+   +GLV ++ STSVVE+VMLLCSQEWQNS+QK+AGLAFIEL+NEGRLL HA  DH VRVANEA FIL+R RAEDV KH+EF   CA    +R+ EE++ +HLI++A+ RD   AN+LK ++ +++ + HG W +  Q++ ++F+RLDYWEDD RRRRRFV N +GSTH +  L
Sbjct:   42 SITTKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEFESNCAQYAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGTMSQSQLHDFWRLDYWEDDLRRRRRFVRNAFGSTHTDVTL 256          
BLAST of Neurobeachin vs. Ensembl Xenopus
Match: LRBA (LPS-responsive vesicle trafficking, beach and anchor containing [Source:NCBI gene;Acc:734030])

HSP 1 Score: 939.873 bits (2428), Expect = 0.000e+0
Identity = 439/868 (50.58%), Postives = 595/868 (68.55%), Query Frame = 3
Query: 5994 ITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            +TGPV LSTPA L+AP V + G++S+T SELYFE++ ++     +D K+L Y   LHGKW F+EIRA+FSR++L +N A+EIF+ANR++VMF FPDQ TV+KVI+ LPRVGIG  + + Q R+ SLA+P+QIFK SNMTQRWQ REISNF+YLM+LNTIAGRT+NDLNQYP+FPWV+ NYESE +DL+ PSN+RDLS PIGALNP R  FFD R+K+W+DD    FHYGTHYSTA+FVL++L+R+EPFTT FLNLQ GKFDHADR F S+A+ W+N QRDTSD+KELIPEF+YLPEMF N+N+Y  G  +DG +V DV LP WAK+PE+FVRINR ALESE VSCQLH WIDLIFGYKQ+GPEA+R+ N+F YLTYEG+VN   I DP++R+ +E QIRSFGQTPSQL+ EPHPPR+SA+ V+PLMFT     D++M+LKF SNSPI  + AN  P     A +TV+AN ++ VNKW+ + A                                  G +Q           D P+            QLP+ +DPL++  T +++R + +  D  ++ H+  F  T DNR I   GFWDKSFR++S +TG+L QVV+GH+ VV C+ARSE     DCY+++GS D T++LW W  + +  +GD    E A PR  +TGH   I C  +  ELG+++S SKD  CLIH++ G+LLR+L  +++ + P  + +SREG+ ++  +     +++INGK             L+ +ME++ +           A+ L++DG Y+    ++G V + +  +L+ + +YP CDA I S+ ++ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct: 1992 LTGPVNLSTPAQLVAPSVVLKGTLSVTSSELYFEVEEDDPGFKKMDAKILAYTEGLHGKWLFTEIRAVFSRRYLLQNTAVEIFMANRVSVMFNFPDQSTVKKVIHCLPRVGIGTNFGLPQTRRISLATPKQIFKASNMTQRWQHREISNFEYLMFLNTIAGRTFNDLNQYPVFPWVITNYESEQLDLTLPSNFRDLSKPIGALNPKRADFFDERYKSWEDDQVPKFHYGTHYSTASFVLSWLLRIEPFTTFFLNLQGGKFDHADRAFSSIARAWRNSQRDTSDIKELIPEFYYLPEMFVNANNYSLGVMDDGTVVSDVDLPPWAKSPEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNMFYYLTYEGAVNLSSITDPVLREGVEAQIRSFGQTPSQLLIEPHPPRSSAMQVTPLMFTDQAQHDVIMVLKFPSNSPITHVAANTQPGLATPAAITVTANRLFAVNKWHGLPA--------------------------------HQGAVQ-----------DQPY------------QLPVEIDPLIASNTGMHRRQISDLLDQSIQVHSQCFVITADNRFILVCGFWDKSFRVYSTDTGKLTQVVFGHWDVVTCLARSESYIGGDCYVLSGSRDATLLLWYWNGKSNG-IGDHPSTEFATPRAILTGHDCAITCATVCAELGLVISGSKDGPCLIHSMNGDLLRTLEAAENCLRPKLIQVSREGHCVVYYEKGIFCVFSINGK-------------LQASMEIEDNT---------RAILLSRDGQYLLTGGDNGVVMVWQVSDLKQLFAYPGCDAGIRSMTMSFDQRCIMTGMASGSIVLFYNDFNRWHHEYQTRY 2781          

HSP 2 Score: 779.245 bits (2011), Expect = 0.000e+0
Identity = 391/967 (40.43%), Postives = 606/967 (62.67%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYE 3272
             I +K+ +L GL++V ++  +++VD V  LLV G FD+E NF+I  ++ +I M++++   D   +AE+ S+F  +++KS  NL++  E   +E  L+ +   D M ADLL+EMLGI+AS+S++V+ELK  F  L+G    W +           +P                      P++KWPYQNG+TF+ W+ +DP + +N+D+ KPYLYCFRTNKGLGYS HFVGS L++T++K K KG QHCVKY+ +P++WYMVS+V++YNRW  SE+RCY++GEL S  E+ W +NT++ FD+CF+G+S    +  +  GQ++ +Y F+E+LN  QI A+Y LGP YKG FKF+AE    L++  +   ++G+L  S+ F YNP A D QLCL  +PK N  +F HS HALM  +V+ VLT SI S +HS+GGV++LFP+F+QLDF        Q  S+ V  ++ + L   + ELL  S A++ Q++ SKG L+I Y + +S+      S +  ++++L L                 AFA  L SL  G                              VP        L+K + D++L N A+WIH    VQL L+ F++ +F+S   ++N  R    VL  ++++KYYYW VNP+DRSGI  K  +  P  N ++I ++R+ +  FIK+L++K H GV ++E+Q  LNYL  ++EDDN+  VL   V LMSE P +M+PAFD ++G+++++KLLAS  E +R+ ALK+LG++L+  + KRK + M  H LF+L+ ERL+L++  +TM  YN L+EI+ E++  ++    H  PD T  ++NP +LKVIA L+R      E+++V+++FL+D+  L NNS+ENRR++LQ SVWQ+W+  L   +P+  +++++ + V  + R+LL+HA+K E+GGWRVW+DT++I HSKV +   R  + +V+ +Y+
Sbjct:   38 GIRMKFAVLSGLLEVGEVSTRDLVDTVFNLLVGGQFDLEMNFIIQEAESIICMIELLDKCDVTCQAEIWSIFSAILKKSIRNLLICTEVGLVEHVLKRIDKVDSMIADLLVEMLGILASYSITVRELKLFFSKLRGEKGQWAI----------ALP----------------------PVAKWPYQNGFTFHTWLRMDPINNINVDKAKPYLYCFRTNKGLGYSAHFVGSCLIVTSVKSKGKGFQHCVKYDFKPQKWYMVSLVHIYNRWKNSELRCYVNGELASYGEITWLVNTSDTFDKCFLGSSETADSNRVFCGQMAAVYLFSEALNAAQIFAVYQLGPGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSSIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPVFAQLDFR-------QYGSDHVDASVCSTLFAFILELLKNSLAMQEQMLSSKGFLVIGYSLEKSS-----KSHVTRTVLELSL-----------------AFAKYLSSLHNG------------------------------VP--------LLKQLCDHILLNPAIWIHTPATVQLALYTFMSTEFISSVSIYNAVRRTGTVLLVMHTLKYYYWTVNPQDRSGITPKGLD-GPRPNPKEILSLRAMLLIFIKQLVMKDH-GVKEDELQAILNYLLTIHEDDNLMDVLQLLVALMSEHPGSMIPAFDQRNGLRIVYKLLASKTEGIRVQALKVLGYFLKHLSAKRKSEVMQAHGLFSLLAERLMLHTNLITMTTYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPLILKVIATLLRNCPQHPEVIEVKRVFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNTEEQKITEMVYAIFRILLYHAVKYEWGGWRVWVDTISITHSKVTFEMHRESLARVFNEYQ 903          

HSP 3 Score: 233.032 bits (593), Expect = 3.381e-60
Identity = 132/277 (47.65%), Postives = 187/277 (67.51%), Query Frame = 3
Query: 3546 RSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNE--SNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            RS  FRIP F WS +HQRLL DLL SIE+D+Q+W+  + + I++FVN+ +N ++V N +HL++ ++D++I  CGG+LPLL+AATS + +++ +E   G+++  ++ FL R +++ D+++FASSL F ++E EK MS GGILRQCLRLVC  AVRNCLE + + L  +   E   N    HS     K     P D +   M                    P+ D + LLQ+MDINRLRAVV+RDVE++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1241 RSTMFRIPEFRWSTMHQRLLTDLLFSIETDIQMWRSHSTKTIMDFVNSNDNVIFVHNTIHLISQITDNMIMACGGILPLLSAATSATHELEHIEPTQGLSLETSISFLQRAISLVDVLIFASSLGFADIEAEKNMSPGGILRQCLRLVCAVAVRNCLECQ-QHLKLKTTGEPIKNQKGVHSLVGTGKPAAKSPIDIITGGMS-------------------PVRDHDRLLQDMDINRLRAVVFRDVEDSKQAQFLALAVVYFISVLMVSKYRDILEP 1497          

HSP 4 Score: 204.912 bits (520), Expect = 1.147e-51
Identity = 124/268 (46.27%), Postives = 169/268 (63.06%), Query Frame = 3
Query: 4947 SSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQ-NEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAG-VSINDNTMTSE 5738
            S  S+T+RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLL S    N+   H    FI L+   RLL+    DH VRVANEA FILSR RAE++ +H+EF   CA    +++ EE++ +HLI +A+ RD+  A +L  ++ +++   HG W S   +   EF+RLDYWEDD RRRRRFV NP GSTHPEA L +A        I H+  +  + K    + ++K  VV G +S  D+ +  E
Sbjct: 1726 SHMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLFS----NTCSIHHN-QFITLICNCRLLSQTMKDHLVRVANEAEFILSRQRAEEIHRHAEFESQCAQYTADKREEEKMCDHLIRAAKYRDNVTATQLVQKIINILTDKHGAWGSSSISRPCEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLRSA--------IEHDPDEDALVKG---KQSIKGQVVGGQISEGDSLLDGE 1977          
BLAST of Neurobeachin vs. Ensembl Xenopus
Match: LRBA (LPS-responsive vesicle trafficking, beach and anchor containing [Source:NCBI gene;Acc:734030])

HSP 1 Score: 939.488 bits (2427), Expect = 0.000e+0
Identity = 439/868 (50.58%), Postives = 595/868 (68.55%), Query Frame = 3
Query: 5994 ITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            +TGPV LSTPA L+AP V + G++S+T SELYFE++ ++     +D K+L Y   LHGKW F+EIRA+FSR++L +N A+EIF+ANR++VMF FPDQ TV+KVI+ LPRVGIG  + + Q R+ SLA+P+QIFK SNMTQRWQ REISNF+YLM+LNTIAGRT+NDLNQYP+FPWV+ NYESE +DL+ PSN+RDLS PIGALNP R  FFD R+K+W+DD    FHYGTHYSTA+FVL++L+R+EPFTT FLNLQ GKFDHADR F S+A+ W+N QRDTSD+KELIPEF+YLPEMF N+N+Y  G  +DG +V DV LP WAK+PE+FVRINR ALESE VSCQLH WIDLIFGYKQ+GPEA+R+ N+F YLTYEG+VN   I DP++R+ +E QIRSFGQTPSQL+ EPHPPR+SA+ V+PLMFT     D++M+LKF SNSPI  + AN  P     A +TV+AN ++ VNKW+ + A                                  G +Q           D P+            QLP+ +DPL++  T +++R + +  D  ++ H+  F  T DNR I   GFWDKSFR++S +TG+L QVV+GH+ VV C+ARSE     DCY+++GS D T++LW W  + +  +GD    E A PR  +TGH   I C  +  ELG+++S SKD  CLIH++ G+LLR+L  +++ + P  + +SREG+ ++  +     +++INGK             L+ +ME++ +           A+ L++DG Y+    ++G V + +  +L+ + +YP CDA I S+ ++ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct: 2024 LTGPVNLSTPAQLVAPSVVLKGTLSVTSSELYFEVEEDDPGFKKMDAKILAYTEGLHGKWLFTEIRAVFSRRYLLQNTAVEIFMANRVSVMFNFPDQSTVKKVIHCLPRVGIGTNFGLPQTRRISLATPKQIFKASNMTQRWQHREISNFEYLMFLNTIAGRTFNDLNQYPVFPWVITNYESEQLDLTLPSNFRDLSKPIGALNPKRADFFDERYKSWEDDQVPKFHYGTHYSTASFVLSWLLRIEPFTTFFLNLQGGKFDHADRAFSSIARAWRNSQRDTSDIKELIPEFYYLPEMFVNANNYSLGVMDDGTVVSDVDLPPWAKSPEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNMFYYLTYEGAVNLSSITDPVLREGVEAQIRSFGQTPSQLLIEPHPPRSSAMQVTPLMFTDQAQHDVIMVLKFPSNSPITHVAANTQPGLATPAAITVTANRLFAVNKWHGLPA--------------------------------HQGAVQ-----------DQPY------------QLPVEIDPLIASNTGMHRRQISDLLDQSIQVHSQCFVITADNRFILVCGFWDKSFRVYSTDTGKLTQVVFGHWDVVTCLARSESYIGGDCYVLSGSRDATLLLWYWNGKSNG-IGDHPSTEFATPRAILTGHDCAITCATVCAELGLVISGSKDGPCLIHSMNGDLLRTLEAAENCLRPKLIQVSREGHCVVYYEKGIFCVFSINGK-------------LQASMEIEDNT---------RAILLSRDGQYLLTGGDNGVVMVWQVSDLKQLFAYPGCDAGIRSMTMSFDQRCIMTGMASGSIVLFYNDFNRWHHEYQTRY 2813          

HSP 2 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 410/967 (42.40%), Postives = 630/967 (65.15%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYE 3272
             I +K+ +L GL++V ++  +++VD V  LLV G FD+E NF+I  ++ +I M++++   D   +AE+ S+F  +++KS  NL++  E   +E  L+ +   D M ADLL+EMLGI+AS+S++V+ELK  F  L+G    WP  + +LL+VL+ MP + GPD FFNFPG   +AIA+PP++KWPYQNG+TF+ W+ +DP + +N+D+ KPYLYCFRTNKGLGYS HFVGS L++T++K K KG QHCVKY+ +P++WYMVS+V++YNRW  SE+RCY++GEL S  E+ W +NT++ FD+CF+G+S    +  +  GQ++ +Y F+E+LN  QI A+Y LGP YKG FKF+AE    L++  +   ++G+L  S+ F YNP A D QLCL  +PK N  +F HS HALM  +V+ VLT SI S +HS+GGV++LFP+F+QLDF        Q  S+ V  ++ + L   + ELL  S A++ Q++ SKG L+I Y + +S+      S +  ++++L L                 AFA  L SL  G                              VP        L+K + D++L N A+WIH    VQL L+ F++ +F+S   ++N  R    VL  ++++KYYYW VNP+DRSGI  K  +  P  N ++I ++R+ +  FIK+L++K H GV ++E+Q  LNYL  ++EDDN+  VL   V LMSE P +M+PAFD ++G+++++KLLAS  E +R+ ALK+LG++L+  + KRK + M  H LF+L+ ERL+L++  +TM  YN L+EI+ E++  ++    H  PD T  ++NP +LKVIA L+R      E+++V+++FL+D+  L NNS+ENRR++LQ SVWQ+W+  L   +P+  +++++ + V  + R+LL+HA+K E+GGWRVW+DT++I HSKV +   R  + +V+ +Y+
Sbjct:   38 GIRMKFAVLSGLLEVGEVSTRDLVDTVFNLLVGGQFDLEMNFIIQEAESIICMIELLDKCDVTCQAEIWSIFSAILKKSIRNLLICTEVGLVEHVLKRIDKVDSMIADLLVEMLGILASYSITVRELKLFFSKLRGEKGQWPPQAAKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPVAKWPYQNGFTFHTWLRMDPINNINVDKAKPYLYCFRTNKGLGYSAHFVGSCLIVTSVKSKGKGFQHCVKYDFKPQKWYMVSLVHIYNRWKNSELRCYVNGELASYGEITWLVNTSDTFDKCFLGSSETADSNRVFCGQMAAVYLFSEALNAAQIFAVYQLGPGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSSIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPVFAQLDFR-------QYGSDHVDASVCSTLFAFILELLKNSLAMQEQMLSSKGFLVIGYSLEKSS-----KSHVTRTVLELSL-----------------AFAKYLSSLHNG------------------------------VP--------LLKQLCDHILLNPAIWIHTPATVQLALYTFMSTEFISSVSIYNAVRRTGTVLLVMHTLKYYYWTVNPQDRSGITPKGLD-GPRPNPKEILSLRAMLLIFIKQLVMKDH-GVKEDELQAILNYLLTIHEDDNLMDVLQLLVALMSEHPGSMIPAFDQRNGLRIVYKLLASKTEGIRVQALKVLGYFLKHLSAKRKSEVMQAHGLFSLLAERLMLHTNLITMTTYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPLILKVIATLLRNCPQHPEVIEVKRVFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNTEEQKITEMVYAIFRILLYHAVKYEWGGWRVWVDTISITHSKVTFEMHRESLARVFNEYQ 935          

HSP 3 Score: 233.032 bits (593), Expect = 3.522e-60
Identity = 132/277 (47.65%), Postives = 187/277 (67.51%), Query Frame = 3
Query: 3546 RSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNE--SNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            RS  FRIP F WS +HQRLL DLL SIE+D+Q+W+  + + I++FVN+ +N ++V N +HL++ ++D++I  CGG+LPLL+AATS + +++ +E   G+++  ++ FL R +++ D+++FASSL F ++E EK MS GGILRQCLRLVC  AVRNCLE + + L  +   E   N    HS     K     P D +   M                    P+ D + LLQ+MDINRLRAVV+RDVE++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1273 RSTMFRIPEFRWSTMHQRLLTDLLFSIETDIQMWRSHSTKTIMDFVNSNDNVIFVHNTIHLISQITDNMIMACGGILPLLSAATSATHELEHIEPTQGLSLETSISFLQRAISLVDVLIFASSLGFADIEAEKNMSPGGILRQCLRLVCAVAVRNCLECQ-QHLKLKTTGEPIKNQKGVHSLVGTGKPAAKSPIDIITGGMS-------------------PVRDHDRLLQDMDINRLRAVVFRDVEDSKQAQFLALAVVYFISVLMVSKYRDILEP 1529          

HSP 4 Score: 204.912 bits (520), Expect = 1.276e-51
Identity = 124/268 (46.27%), Postives = 169/268 (63.06%), Query Frame = 3
Query: 4947 SSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQ-NEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAG-VSINDNTMTSE 5738
            S  S+T+RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLL S    N+   H    FI L+   RLL+    DH VRVANEA FILSR RAE++ +H+EF   CA    +++ EE++ +HLI +A+ RD+  A +L  ++ +++   HG W S   +   EF+RLDYWEDD RRRRRFV NP GSTHPEA L +A        I H+  +  + K    + ++K  VV G +S  D+ +  E
Sbjct: 1758 SHMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLFS----NTCSIHHN-QFITLICNCRLLSQTMKDHLVRVANEAEFILSRQRAEEIHRHAEFESQCAQYTADKREEEKMCDHLIRAAKYRDNVTATQLVQKIINILTDKHGAWGSSSISRPCEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLRSA--------IEHDPDEDALVKG---KQSIKGQVVGGQISEGDSLLDGE 2009          
BLAST of Neurobeachin vs. Ensembl Xenopus
Match: LRBA (LPS-responsive vesicle trafficking, beach and anchor containing [Source:NCBI gene;Acc:734030])

HSP 1 Score: 939.102 bits (2426), Expect = 0.000e+0
Identity = 439/868 (50.58%), Postives = 595/868 (68.55%), Query Frame = 3
Query: 5994 ITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            +TGPV LSTPA L+AP V + G++S+T SELYFE++ ++     +D K+L Y   LHGKW F+EIRA+FSR++L +N A+EIF+ANR++VMF FPDQ TV+KVI+ LPRVGIG  + + Q R+ SLA+P+QIFK SNMTQRWQ REISNF+YLM+LNTIAGRT+NDLNQYP+FPWV+ NYESE +DL+ PSN+RDLS PIGALNP R  FFD R+K+W+DD    FHYGTHYSTA+FVL++L+R+EPFTT FLNLQ GKFDHADR F S+A+ W+N QRDTSD+KELIPEF+YLPEMF N+N+Y  G  +DG +V DV LP WAK+PE+FVRINR ALESE VSCQLH WIDLIFGYKQ+GPEA+R+ N+F YLTYEG+VN   I DP++R+ +E QIRSFGQTPSQL+ EPHPPR+SA+ V+PLMFT     D++M+LKF SNSPI  + AN  P     A +TV+AN ++ VNKW+ + A                                  G +Q           D P+            QLP+ +DPL++  T +++R + +  D  ++ H+  F  T DNR I   GFWDKSFR++S +TG+L QVV+GH+ VV C+ARSE     DCY+++GS D T++LW W  + +  +GD    E A PR  +TGH   I C  +  ELG+++S SKD  CLIH++ G+LLR+L  +++ + P  + +SREG+ ++  +     +++INGK             L+ +ME++ +           A+ L++DG Y+    ++G V + +  +L+ + +YP CDA I S+ ++ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct: 2015 LTGPVNLSTPAQLVAPSVVLKGTLSVTSSELYFEVEEDDPGFKKMDAKILAYTEGLHGKWLFTEIRAVFSRRYLLQNTAVEIFMANRVSVMFNFPDQSTVKKVIHCLPRVGIGTNFGLPQTRRISLATPKQIFKASNMTQRWQHREISNFEYLMFLNTIAGRTFNDLNQYPVFPWVITNYESEQLDLTLPSNFRDLSKPIGALNPKRADFFDERYKSWEDDQVPKFHYGTHYSTASFVLSWLLRIEPFTTFFLNLQGGKFDHADRAFSSIARAWRNSQRDTSDIKELIPEFYYLPEMFVNANNYSLGVMDDGTVVSDVDLPPWAKSPEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNMFYYLTYEGAVNLSSITDPVLREGVEAQIRSFGQTPSQLLIEPHPPRSSAMQVTPLMFTDQAQHDVIMVLKFPSNSPITHVAANTQPGLATPAAITVTANRLFAVNKWHGLPA--------------------------------HQGAVQ-----------DQPY------------QLPVEIDPLIASNTGMHRRQISDLLDQSIQVHSQCFVITADNRFILVCGFWDKSFRVYSTDTGKLTQVVFGHWDVVTCLARSESYIGGDCYVLSGSRDATLLLWYWNGKSNG-IGDHPSTEFATPRAILTGHDCAITCATVCAELGLVISGSKDGPCLIHSMNGDLLRTLEAAENCLRPKLIQVSREGHCVVYYEKGIFCVFSINGK-------------LQASMEIEDNT---------RAILLSRDGQYLLTGGDNGVVMVWQVSDLKQLFAYPGCDAGIRSMTMSFDQRCIMTGMASGSIVLFYNDFNRWHHEYQTRY 2804          

HSP 2 Score: 822.772 bits (2124), Expect = 0.000e+0
Identity = 410/967 (42.40%), Postives = 630/967 (65.15%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYE 3272
             I +K+ +L GL++V ++  +++VD V  LLV G FD+E NF+I  ++ +I M++++   D   +AE+ S+F  +++KS  NL++  E   +E  L+ +   D M ADLL+EMLGI+AS+S++V+ELK  F  L+G    WP  + +LL+VL+ MP + GPD FFNFPG   +AIA+PP++KWPYQNG+TF+ W+ +DP + +N+D+ KPYLYCFRTNKGLGYS HFVGS L++T++K K KG QHCVKY+ +P++WYMVS+V++YNRW  SE+RCY++GEL S  E+ W +NT++ FD+CF+G+S    +  +  GQ++ +Y F+E+LN  QI A+Y LGP YKG FKF+AE    L++  +   ++G+L  S+ F YNP A D QLCL  +PK N  +F HS HALM  +V+ VLT SI S +HS+GGV++LFP+F+QLDF        Q  S+ V  ++ + L   + ELL  S A++ Q++ SKG L+I Y + +S+      S +  ++++L L                 AFA  L SL  G                              VP        L+K + D++L N A+WIH    VQL L+ F++ +F+S   ++N  R    VL  ++++KYYYW VNP+DRSGI  K  +  P  N ++I ++R+ +  FIK+L++K H GV ++E+Q  LNYL  ++EDDN+  VL   V LMSE P +M+PAFD ++G+++++KLLAS  E +R+ ALK+LG++L+  + KRK + M  H LF+L+ ERL+L++  +TM  YN L+EI+ E++  ++    H  PD T  ++NP +LKVIA L+R      E+++V+++FL+D+  L NNS+ENRR++LQ SVWQ+W+  L   +P+  +++++ + V  + R+LL+HA+K E+GGWRVW+DT++I HSKV +   R  + +V+ +Y+
Sbjct:   38 GIRMKFAVLSGLLEVGEVSTRDLVDTVFNLLVGGQFDLEMNFIIQEAESIICMIELLDKCDVTCQAEIWSIFSAILKKSIRNLLICTEVGLVEHVLKRIDKVDSMIADLLVEMLGILASYSITVRELKLFFSKLRGEKGQWPPQAAKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPVAKWPYQNGFTFHTWLRMDPINNINVDKAKPYLYCFRTNKGLGYSAHFVGSCLIVTSVKSKGKGFQHCVKYDFKPQKWYMVSLVHIYNRWKNSELRCYVNGELASYGEITWLVNTSDTFDKCFLGSSETADSNRVFCGQMAAVYLFSEALNAAQIFAVYQLGPGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSSIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPVFAQLDFR-------QYGSDHVDASVCSTLFAFILELLKNSLAMQEQMLSSKGFLVIGYSLEKSS-----KSHVTRTVLELSL-----------------AFAKYLSSLHNG------------------------------VP--------LLKQLCDHILLNPAIWIHTPATVQLALYTFMSTEFISSVSIYNAVRRTGTVLLVMHTLKYYYWTVNPQDRSGITPKGLD-GPRPNPKEILSLRAMLLIFIKQLVMKDH-GVKEDELQAILNYLLTIHEDDNLMDVLQLLVALMSEHPGSMIPAFDQRNGLRIVYKLLASKTEGIRVQALKVLGYFLKHLSAKRKSEVMQAHGLFSLLAERLMLHTNLITMTTYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPLILKVIATLLRNCPQHPEVIEVKRVFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNTEEQKITEMVYAIFRILLYHAVKYEWGGWRVWVDTISITHSKVTFEMHRESLARVFNEYQ 935          

HSP 3 Score: 233.032 bits (593), Expect = 3.457e-60
Identity = 132/277 (47.65%), Postives = 187/277 (67.51%), Query Frame = 3
Query: 3546 RSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNE--SNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            RS  FRIP F WS +HQRLL DLL SIE+D+Q+W+  + + I++FVN+ +N ++V N +HL++ ++D++I  CGG+LPLL+AATS + +++ +E   G+++  ++ FL R +++ D+++FASSL F ++E EK MS GGILRQCLRLVC  AVRNCLE + + L  +   E   N    HS     K     P D +   M                    P+ D + LLQ+MDINRLRAVV+RDVE++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1273 RSTMFRIPEFRWSTMHQRLLTDLLFSIETDIQMWRSHSTKTIMDFVNSNDNVIFVHNTIHLISQITDNMIMACGGILPLLSAATSATHELEHIEPTQGLSLETSISFLQRAISLVDVLIFASSLGFADIEAEKNMSPGGILRQCLRLVCAVAVRNCLECQ-QHLKLKTTGEPIKNQKGVHSLVGTGKPAAKSPIDIITGGMS-------------------PVRDHDRLLQDMDINRLRAVVFRDVEDSKQAQFLALAVVYFISVLMVSKYRDILEP 1529          

HSP 4 Score: 208.764 bits (530), Expect = 7.371e-53
Identity = 120/244 (49.18%), Postives = 160/244 (65.57%), Query Frame = 3
Query: 4878 VTDNRKHEIIDRDDEDYPKSNFPSSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQ-NEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTA 5600
             TD+ +    DR+   + K N  S  S+T+RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLL S    N+   H    FI L+   RLL+    DH VRVANEA FILSR RAE++ +H+EF   CA    +++ EE++ +HLI +A+ RD+  A +L  ++ +++   HG W S   +   EF+RLDYWEDD RRRRRFV NP GSTHPEA L +A
Sbjct: 1717 ATDSSQAADADRESSGF-KVNLSSYISITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLFS----NTCSIHHN-QFITLICNCRLLSQTMKDHLVRVANEAEFILSRQRAEEIHRHAEFESQCAQYTADKREEEKMCDHLIRAAKYRDNVTATQLVQKIINILTDKHGAWGSSSISRPCEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLRSA 1954          
BLAST of Neurobeachin vs. Ensembl Xenopus
Match: LRBA (LPS-responsive vesicle trafficking, beach and anchor containing [Source:NCBI gene;Acc:734030])

HSP 1 Score: 938.717 bits (2425), Expect = 0.000e+0
Identity = 439/868 (50.58%), Postives = 595/868 (68.55%), Query Frame = 3
Query: 5994 ITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            +TGPV LSTPA L+AP V + G++S+T SELYFE++ ++     +D K+L Y   LHGKW F+EIRA+FSR++L +N A+EIF+ANR++VMF FPDQ TV+KVI+ LPRVGIG  + + Q R+ SLA+P+QIFK SNMTQRWQ REISNF+YLM+LNTIAGRT+NDLNQYP+FPWV+ NYESE +DL+ PSN+RDLS PIGALNP R  FFD R+K+W+DD    FHYGTHYSTA+FVL++L+R+EPFTT FLNLQ GKFDHADR F S+A+ W+N QRDTSD+KELIPEF+YLPEMF N+N+Y  G  +DG +V DV LP WAK+PE+FVRINR ALESE VSCQLH WIDLIFGYKQ+GPEA+R+ N+F YLTYEG+VN   I DP++R+ +E QIRSFGQTPSQL+ EPHPPR+SA+ V+PLMFT     D++M+LKF SNSPI  + AN  P     A +TV+AN ++ VNKW+ + A                                  G +Q           D P+            QLP+ +DPL++  T +++R + +  D  ++ H+  F  T DNR I   GFWDKSFR++S +TG+L QVV+GH+ VV C+ARSE     DCY+++GS D T++LW W  + +  +GD    E A PR  +TGH   I C  +  ELG+++S SKD  CLIH++ G+LLR+L  +++ + P  + +SREG+ ++  +     +++INGK             L+ +ME++ +           A+ L++DG Y+    ++G V + +  +L+ + +YP CDA I S+ ++ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct: 1993 LTGPVNLSTPAQLVAPSVVLKGTLSVTSSELYFEVEEDDPGFKKMDAKILAYTEGLHGKWLFTEIRAVFSRRYLLQNTAVEIFMANRVSVMFNFPDQSTVKKVIHCLPRVGIGTNFGLPQTRRISLATPKQIFKASNMTQRWQHREISNFEYLMFLNTIAGRTFNDLNQYPVFPWVITNYESEQLDLTLPSNFRDLSKPIGALNPKRADFFDERYKSWEDDQVPKFHYGTHYSTASFVLSWLLRIEPFTTFFLNLQGGKFDHADRAFSSIARAWRNSQRDTSDIKELIPEFYYLPEMFVNANNYSLGVMDDGTVVSDVDLPPWAKSPEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNMFYYLTYEGAVNLSSITDPVLREGVEAQIRSFGQTPSQLLIEPHPPRSSAMQVTPLMFTDQAQHDVIMVLKFPSNSPITHVAANTQPGLATPAAITVTANRLFAVNKWHGLPA--------------------------------HQGAVQ-----------DQPY------------QLPVEIDPLIASNTGMHRRQISDLLDQSIQVHSQCFVITADNRFILVCGFWDKSFRVYSTDTGKLTQVVFGHWDVVTCLARSESYIGGDCYVLSGSRDATLLLWYWNGKSNG-IGDHPSTEFATPRAILTGHDCAITCATVCAELGLVISGSKDGPCLIHSMNGDLLRTLEAAENCLRPKLIQVSREGHCVVYYEKGIFCVFSINGK-------------LQASMEIEDNT---------RAILLSRDGQYLLTGGDNGVVMVWQVSDLKQLFAYPGCDAGIRSMTMSFDQRCIMTGMASGSIVLFYNDFNRWHHEYQTRY 2782          

HSP 2 Score: 775.393 bits (2001), Expect = 0.000e+0
Identity = 396/967 (40.95%), Postives = 606/967 (62.67%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYE 3272
             I +K+ +L GL++V ++  +++VD V  LLV G FD+E NF+I  ++ +I M++++   D   +AE+ S+F  +++KS  NL++  E   +E  L+ +   D M ADLL+EMLGI+AS+S++V+ELK  F  L+G    WP  + +LL+VL+ MP + GPD FFNFPG   +AIA+PP++KWPYQNG+TF+ W+ +DP + +N+D+ KPYLYCFRTNKGLGYS HFVGS L++T++K K KG QHCVKY+ +P++WYMVS+V++YNRW  SE+RCY++GEL S  E+ W +NT++ FD+CF+G+S    +  +  GQ++ +Y F+E+LN  QI A+Y LGP YKG FKF+AE    L++  +   ++G+L  S+ F YNP A D QLCL  +PK N  +F HS HALM  +V+ VLT SI S +HS+GGV++LFP+F+QLDF        Q  S+ V  ++ + L   + ELL  S A++ Q++ SKG L+I Y + +S+      S +  ++++L L                 AFA  L SL  G                              VP        L+K + D++L N A+WIH    VQL L+ F++ +F+S   ++N  R    VL  ++++KYYYW VNP+DRSGI  K  +  P  N ++I ++R+ +  FIK+L++K H GV ++E+Q  LNYL  ++EDDN+  VL   V LMSE P +M+PAFD ++G+                               +RK + M  H LF+L+ ERL+L++  +TM  YN L+EI+ E++  ++    H  PD T  ++NP +LKVIA L+R      E+++V+++FL+D+  L NNS+ENRR++LQ SVWQ+W+  L   +P+  +++++ + V  + R+LL+HA+K E+GGWRVW+DT++I HSKV +   R  + +V+ +Y+
Sbjct:   38 GIRMKFAVLSGLLEVGEVSTRDLVDTVFNLLVGGQFDLEMNFIIQEAESIICMIELLDKCDVTCQAEIWSIFSAILKKSIRNLLICTEVGLVEHVLKRIDKVDSMIADLLVEMLGILASYSITVRELKLFFSKLRGEKGQWPPQAAKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPVAKWPYQNGFTFHTWLRMDPINNINVDKAKPYLYCFRTNKGLGYSAHFVGSCLIVTSVKSKGKGFQHCVKYDFKPQKWYMVSLVHIYNRWKNSELRCYVNGELASYGEITWLVNTSDTFDKCFLGSSETADSNRVFCGQMAAVYLFSEALNAAQIFAVYQLGPGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSSIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPVFAQLDFR-------QYGSDHVDASVCSTLFAFILELLKNSLAMQEQMLSSKGFLVIGYSLEKSS-----KSHVTRTVLELSL-----------------AFAKYLSSLHNG------------------------------VP--------LLKQLCDHILLNPAIWIHTPATVQLALYTFMSTEFISSVSIYNAVRRTGTVLLVMHTLKYYYWTVNPQDRSGITPKGLD-GPRPNPKEILSLRAMLLIFIKQLVMKDH-GVKEDELQAILNYLLTIHEDDNLMDVLQLLVALMSEHPGSMIPAFDQRNGL-------------------------------RRKSEVMQAHGLFSLLAERLMLHTNLITMTTYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPLILKVIATLLRNCPQHPEVIEVKRVFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNTEEQKITEMVYAIFRILLYHAVKYEWGGWRVWVDTISITHSKVTFEMHRESLARVFNEYQ 904          

HSP 3 Score: 232.646 bits (592), Expect = 4.502e-60
Identity = 132/277 (47.65%), Postives = 187/277 (67.51%), Query Frame = 3
Query: 3546 RSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNE--SNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            RS  FRIP F WS +HQRLL DLL SIE+D+Q+W+  + + I++FVN+ +N ++V N +HL++ ++D++I  CGG+LPLL+AATS + +++ +E   G+++  ++ FL R +++ D+++FASSL F ++E EK MS GGILRQCLRLVC  AVRNCLE + + L  +   E   N    HS     K     P D +   M                    P+ D + LLQ+MDINRLRAVV+RDVE++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1242 RSTMFRIPEFRWSTMHQRLLTDLLFSIETDIQMWRSHSTKTIMDFVNSNDNVIFVHNTIHLISQITDNMIMACGGILPLLSAATSATHELEHIEPTQGLSLETSISFLQRAISLVDVLIFASSLGFADIEAEKNMSPGGILRQCLRLVCAVAVRNCLECQ-QHLKLKTTGEPIKNQKGVHSLVGTGKPAAKSPIDIITGGMS-------------------PVRDHDRLLQDMDINRLRAVVFRDVEDSKQAQFLALAVVYFISVLMVSKYRDILEP 1498          

HSP 4 Score: 204.527 bits (519), Expect = 1.501e-51
Identity = 124/268 (46.27%), Postives = 169/268 (63.06%), Query Frame = 3
Query: 4947 SSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQ-NEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAG-VSINDNTMTSE 5738
            S  S+T+RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLL S    N+   H    FI L+   RLL+    DH VRVANEA FILSR RAE++ +H+EF   CA    +++ EE++ +HLI +A+ RD+  A +L  ++ +++   HG W S   +   EF+RLDYWEDD RRRRRFV NP GSTHPEA L +A        I H+  +  + K    + ++K  VV G +S  D+ +  E
Sbjct: 1727 SHMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLFS----NTCSIHHN-QFITLICNCRLLSQTMKDHLVRVANEAEFILSRQRAEEIHRHAEFESQCAQYTADKREEEKMCDHLIRAAKYRDNVTATQLVQKIINILTDKHGAWGSSSISRPCEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLRSA--------IEHDPDEDALVKG---KQSIKGQVVGGQISEGDSLLDGE 1978          
BLAST of Neurobeachin vs. Ensembl Xenopus
Match: LRBA (LPS-responsive vesicle trafficking, beach and anchor containing [Source:NCBI gene;Acc:734030])

HSP 1 Score: 938.717 bits (2425), Expect = 0.000e+0
Identity = 439/868 (50.58%), Postives = 595/868 (68.55%), Query Frame = 3
Query: 5994 ITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            +TGPV LSTPA L+AP V + G++S+T SELYFE++ ++     +D K+L Y   LHGKW F+EIRA+FSR++L +N A+EIF+ANR++VMF FPDQ TV+KVI+ LPRVGIG  + + Q R+ SLA+P+QIFK SNMTQRWQ REISNF+YLM+LNTIAGRT+NDLNQYP+FPWV+ NYESE +DL+ PSN+RDLS PIGALNP R  FFD R+K+W+DD    FHYGTHYSTA+FVL++L+R+EPFTT FLNLQ GKFDHADR F S+A+ W+N QRDTSD+KELIPEF+YLPEMF N+N+Y  G  +DG +V DV LP WAK+PE+FVRINR ALESE VSCQLH WIDLIFGYKQ+GPEA+R+ N+F YLTYEG+VN   I DP++R+ +E QIRSFGQTPSQL+ EPHPPR+SA+ V+PLMFT     D++M+LKF SNSPI  + AN  P     A +TV+AN ++ VNKW+ + A                                  G +Q           D P+            QLP+ +DPL++  T +++R + +  D  ++ H+  F  T DNR I   GFWDKSFR++S +TG+L QVV+GH+ VV C+ARSE     DCY+++GS D T++LW W  + +  +GD    E A PR  +TGH   I C  +  ELG+++S SKD  CLIH++ G+LLR+L  +++ + P  + +SREG+ ++  +     +++INGK             L+ +ME++ +           A+ L++DG Y+    ++G V + +  +L+ + +YP CDA I S+ ++ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct: 2003 LTGPVNLSTPAQLVAPSVVLKGTLSVTSSELYFEVEEDDPGFKKMDAKILAYTEGLHGKWLFTEIRAVFSRRYLLQNTAVEIFMANRVSVMFNFPDQSTVKKVIHCLPRVGIGTNFGLPQTRRISLATPKQIFKASNMTQRWQHREISNFEYLMFLNTIAGRTFNDLNQYPVFPWVITNYESEQLDLTLPSNFRDLSKPIGALNPKRADFFDERYKSWEDDQVPKFHYGTHYSTASFVLSWLLRIEPFTTFFLNLQGGKFDHADRAFSSIARAWRNSQRDTSDIKELIPEFYYLPEMFVNANNYSLGVMDDGTVVSDVDLPPWAKSPEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNMFYYLTYEGAVNLSSITDPVLREGVEAQIRSFGQTPSQLLIEPHPPRSSAMQVTPLMFTDQAQHDVIMVLKFPSNSPITHVAANTQPGLATPAAITVTANRLFAVNKWHGLPA--------------------------------HQGAVQ-----------DQPY------------QLPVEIDPLIASNTGMHRRQISDLLDQSIQVHSQCFVITADNRFILVCGFWDKSFRVYSTDTGKLTQVVFGHWDVVTCLARSESYIGGDCYVLSGSRDATLLLWYWNGKSNG-IGDHPSTEFATPRAILTGHDCAITCATVCAELGLVISGSKDGPCLIHSMNGDLLRTLEAAENCLRPKLIQVSREGHCVVYYEKGIFCVFSINGK-------------LQASMEIEDNT---------RAILLSRDGQYLLTGGDNGVVMVWQVSDLKQLFAYPGCDAGIRSMTMSFDQRCIMTGMASGSIVLFYNDFNRWHHEYQTRY 2792          

HSP 2 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 400/967 (41.37%), Postives = 615/967 (63.60%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYE 3272
             I +K+ +L GL++V ++  +++VD V  LLV G FD+E NF+I  ++ +I M++++   D   +AE+ S+F  +++KS  NL++  E   +E  L+ +   D M ADLL+EMLGI+AS+S++V+ELK  F  L+G    WP  + +LL+VL+ MP + GPD FFNFPG   +AIA+PP++KWPYQNG+TF+ W+ +DP + +N+D+ KPYLYCFRTNKGLGYS HFVGS L++T++K K KG QHCVKY+ +P++WYMVS+V++YNRW  SE+RCY++GEL S  E+ W +NT++ FD+CF+G+S    +  +  GQ++ +Y F+E+LN  QI A+Y LGP YKG FKF+AE    L++  +   ++G+L  S+ F YNP A D QLCL  +PK N  +F HS HALM  +V+ VLT SI S +HS+GGV++LFP+F+QLDF        Q  S+ V  ++ + L   + ELL  S A++ Q++ SKG L+I Y + +S+      S +  ++++L L                 AFA  L SL  G                              VP        L+K + D++L N A+WIH    VQL L+ F++ +F+S   ++N  R    VL  ++++KYYYW VNP+DRSGI  K  +  P  N ++I ++R+ +  FIK+L++K                      DDN+  VL   V LMSE P +M+PAFD ++G+++++KLLAS  E +R+ ALK+LG++L+  + KRK + M  H LF+L+ ERL+L++  +TM  YN L+EI+ E++  ++    H  PD T  ++NP +LKVIA L+R      E+++V+++FL+D+  L NNS+ENRR++LQ SVWQ+W+  L   +P+  +++++ + V  + R+LL+HA+K E+GGWRVW+DT++I HSKV +   R  + +V+ +Y+
Sbjct:   38 GIRMKFAVLSGLLEVGEVSTRDLVDTVFNLLVGGQFDLEMNFIIQEAESIICMIELLDKCDVTCQAEIWSIFSAILKKSIRNLLICTEVGLVEHVLKRIDKVDSMIADLLVEMLGILASYSITVRELKLFFSKLRGEKGQWPPQAAKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPVAKWPYQNGFTFHTWLRMDPINNINVDKAKPYLYCFRTNKGLGYSAHFVGSCLIVTSVKSKGKGFQHCVKYDFKPQKWYMVSLVHIYNRWKNSELRCYVNGELASYGEITWLVNTSDTFDKCFLGSSETADSNRVFCGQMAAVYLFSEALNAAQIFAVYQLGPGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSSIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPVFAQLDFR-------QYGSDHVDASVCSTLFAFILELLKNSLAMQEQMLSSKGFLVIGYSLEKSS-----KSHVTRTVLELSL-----------------AFAKYLSSLHNG------------------------------VP--------LLKQLCDHILLNPAIWIHTPATVQLALYTFMSTEFISSVSIYNAVRRTGTVLLVMHTLKYYYWTVNPQDRSGITPKGLD-GPRPNPKEILSLRAMLLIFIKQLVMK----------------------DDNLMDVLQLLVALMSEHPGSMIPAFDQRNGLRIVYKLLASKTEGIRVQALKVLGYFLKHLSAKRKSEVMQAHGLFSLLAERLMLHTNLITMTTYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPLILKVIATLLRNCPQHPEVIEVKRVFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNTEEQKITEMVYAIFRILLYHAVKYEWGGWRVWVDTISITHSKVTFEMHRESLARVFNEYQ 914          

HSP 3 Score: 233.032 bits (593), Expect = 3.781e-60
Identity = 132/277 (47.65%), Postives = 187/277 (67.51%), Query Frame = 3
Query: 3546 RSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNE--SNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            RS  FRIP F WS +HQRLL DLL SIE+D+Q+W+  + + I++FVN+ +N ++V N +HL++ ++D++I  CGG+LPLL+AATS + +++ +E   G+++  ++ FL R +++ D+++FASSL F ++E EK MS GGILRQCLRLVC  AVRNCLE + + L  +   E   N    HS     K     P D +   M                    P+ D + LLQ+MDINRLRAVV+RDVE++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1252 RSTMFRIPEFRWSTMHQRLLTDLLFSIETDIQMWRSHSTKTIMDFVNSNDNVIFVHNTIHLISQITDNMIMACGGILPLLSAATSATHELEHIEPTQGLSLETSISFLQRAISLVDVLIFASSLGFADIEAEKNMSPGGILRQCLRLVCAVAVRNCLECQ-QHLKLKTTGEPIKNQKGVHSLVGTGKPAAKSPIDIITGGMS-------------------PVRDHDRLLQDMDINRLRAVVFRDVEDSKQAQFLALAVVYFISVLMVSKYRDILEP 1508          

HSP 4 Score: 204.527 bits (519), Expect = 1.454e-51
Identity = 124/268 (46.27%), Postives = 169/268 (63.06%), Query Frame = 3
Query: 4947 SSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQ-NEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAG-VSINDNTMTSE 5738
            S  S+T+RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLL S    N+   H    FI L+   RLL+    DH VRVANEA FILSR RAE++ +H+EF   CA    +++ EE++ +HLI +A+ RD+  A +L  ++ +++   HG W S   +   EF+RLDYWEDD RRRRRFV NP GSTHPEA L +A        I H+  +  + K    + ++K  VV G +S  D+ +  E
Sbjct: 1737 SHMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLFS----NTCSIHHN-QFITLICNCRLLSQTMKDHLVRVANEAEFILSRQRAEEIHRHAEFESQCAQYTADKREEEKMCDHLIRAAKYRDNVTATQLVQKIINILTDKHGAWGSSSISRPCEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLRSA--------IEHDPDEDALVKG---KQSIKGQVVGGQISEGDSLLDGE 1988          
BLAST of Neurobeachin vs. Ensembl Mouse
Match: Lrba (LPS-responsive beige-like anchor [Source:MGI Symbol;Acc:MGI:1933162])

HSP 1 Score: 931.013 bits (2405), Expect = 0.000e+0
Identity = 443/869 (50.98%), Postives = 593/869 (68.24%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            ++ GPV LSTPA L+AP V V G++S+T SELYFE+D  + N   +D K+L Y   LHGKW F+EIR+IFSR++L +N ALEIF+ANR+AVMF FPD  TV+KV+  LPRVG+G  + + Q R+ SLA+PRQ+FK SNMTQRWQ REISNF+YLM+LNTIAGR+YNDLNQYP+FPWV+ NYESE +DL+ PSN+RDLS PIGALNP R  FF  RF++W+DD    FHYGTHYSTA+FVL +L+R+EPFTT FLNLQ GKFDHADRTF SV++ W+N QRDTSD+KELIPEF+YLPEMF N N+Y  G  +DG +V DV LP WAKT E+FVRINR ALESE VSCQLH WIDLIFGYKQ+GPEA+R+ NVF YLTYEG+VN + I DP++R+A+E QIRSFGQTPSQL+ EPHPPR SA+  SPLMFT     D++M+LKF SNSP+  + AN  P   + AV+TV+AN ++ VNKW+++ A                                  G +Q           D P+            QLP+ +DPL++  T  ++R + +  D  ++ H+  F  T DNR I   GFWDKSFR++S +TG+L+QVV+GH+ VV C+ARSE     +CYI++GS D T++LW W N + + +GD    E+A PR  +TGH  EI C  +  ELG+++S S++  CLIH++ G+LLR+L   ++ + P  +  SREG+ ++  +      +++NGK             L+  +E D           I A+ L++DG Y+    ++G V +R+  +L+ + +YP CDA I ++A++ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct: 2064 NLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPKILAYTEGLHGKWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFGLPQTRRISLATPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPSNFRDLSKPIGALNPKRAAFFAERFESWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSVSRAWRNSQRDTSDIKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEPHPPRGSAMQASPLMFTDQAQQDVIMVLKFPSNSPVTHVAANTQPGLAMPAVITVTANRLFAVNKWHNLPA--------------------------------HQGAVQ-----------DQPY------------QLPVEIDPLIACGTGTHRRQVTDLLDQSIQVHSQCFVITSDNRYILVCGFWDKSFRVYSTDTGKLIQVVFGHWDVVTCLARSESYIGGNCYILSGSRDATLLLWYW-NGKSSGIGDNPGGETATPRAILTGHDYEITCAAVCAELGLVLSGSQEGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGCFCTFSVNGK-------------LQATVETD---------DHIRAIQLSRDGQYLLTGGDNGVVIVRQVSDLKQLFAYPGCDAGIRAMALSFDQRCIISGMASGSIVLFYNDFNRWHHEYQTRY 2854          

HSP 2 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 407/981 (41.49%), Postives = 635/981 (64.73%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVY--EQYEQDHSDHPSYSNI 3308
             I +K+ +L GL++V ++  ++IV+ V  LLV G FD+E NF+I   + ++ M+++++  D   +AE+ S+F  +++KS  NL +  E   +EK L  ++  D M ADLL++MLG++AS++++V+ELK  F  L+G    WP H+ +LL+VL+ MP + GPD FFNFPG   +AIA+PPI++WPYQNG+TF+ W+ +DP + +N+D+DKPYLYCFRT+KGLGYS HFVG  L+IT++K K KG QHCVK++ +P++WYMV++V++YNRW  SE+RCY++GEL S  E+ W +NT++ FD+CF+G+S       +  GQ++ +Y F+++LN  QI AIY LG  YKG FKF+AE    L++  +   ++G+L  ++ F YNP A D QLCL  +PK N  +F HS HALM  +V+ VLT SI S +HS+GGV++LFPLF+QLD+        Q +S++V   I   L+  + ELL  S A++ Q++  KG L+I Y + +S+      S +  ++++LCL+ S+    +LS  QN                                                    + L+K + D++L N A+WIH   +VQL L+ +L+ +F+    ++N  R +  VL  ++++KYYYW VNP+DRSGI  K  +  P  N ++I ++R+ +  FIK+L++K  +GV ++E+Q  LNYL  ++EDDN+  VL   V LM+E P++M+PAFD ++G++VI+KLLAS  E +R+ ALK LG++L+    KRK + M+ H LF+L+ ERL+L +  +TM MYN L+EI+ E++  ++    H  PD T  ++NP +LKVIA L+R S    E ++VR+ FL+D+  L NNS+ENRR++LQ SVWQ+W+  L   +P+  D++++ + V  + R+LL+HA+K E+GGWRVW+DTL+I HSKV +   + ++  ++  EQ + D    P  S++
Sbjct:   43 GIRMKFAVLTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESIMCMVELLEKCDVTCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDSMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGQWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIARWPYQNGFTFHTWLRMDPVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFDFKPQKWYMVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQMTAVYLFSDALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSAIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLFAQLDYK-------QYLSDEVDLTICTTLLAFIMELLKNSIAMQEQMLACKGFLVIGYSLEKSS-----KSHVSRAVLELCLAFSK----YLSNLQN---------------------------------------------------GMPLLKQLCDHILLNPAVWIHTPAKVQLMLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLD-GPRPNQKEILSLRAFLLMFIKQLVMK-DSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMAEHPNSMIPAFDQRNGLRVIYKLLASKSEGIRVQALKALGYFLKHLAPKRKAEVMLGHGLFSLLAERLMLQTNLITMTMYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPQILKVIATLLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREEQRKGDEETGPCSSSL 954          

HSP 3 Score: 259.996 bits (663), Expect = 1.872e-68
Identity = 133/218 (61.01%), Postives = 165/218 (75.69%), Query Frame = 3
Query: 4956 SLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQ-NEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTA 5600
            S+T+RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLLCSQEWQNS+QK+AGLAFIELVNEGRLL+    DH VRVANEA FILSR RAED+ +H+EF  LCA    +++ EE++ +HLI +A+ RD   A +L  ++ +L+   HG W S   +   EF+RLDYWEDD RRRRRFV NP GSTHPEA L TA
Sbjct: 1797 SITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREEEKMCDHLIRAAKYRDHVTATQLIQKIINLLTDKHGAWGSSAVSRPREFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTA 2014          

HSP 4 Score: 238.81 bits (608), Expect = 5.083e-62
Identity = 134/293 (45.73%), Postives = 199/293 (67.92%), Query Frame = 3
Query: 3546 RSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETN 4424
            RS  FRIP F WSQ+HQRLL DLL SIE+D+Q+W+  + + +++FVN+++N ++V N +HL++ + D+++  CGG+LPLL+AATS + +++ +E   G+++  +V FL R++++ D+++FASSL F E+E EK MS+GGILRQCLRLVC  AVRNCLE +           S L     + + SK   +L P     + +       D+    +     P+ D + LLQ+MDINRLRAVV+RD+E++KQAQFLAL++VYF+SVLMVS+YRD+LEP     S SL+ + +   N
Sbjct: 1297 RSTMFRIPEFKWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKNMSSGGILRQCLRLVCAVAVRNCLECQ---------QHSQLKARGDTAKSSKTIHSLIP-----MGKSAAKSPVDIVTGGI----SPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEPQDERHSQSLKETSSDNGN 1571          
BLAST of Neurobeachin vs. Ensembl Mouse
Match: Nbea (neurobeachin [Source:MGI Symbol;Acc:MGI:1347075])

HSP 1 Score: 904.434 bits (2336), Expect = 0.000e+0
Identity = 432/874 (49.43%), Postives = 581/874 (66.48%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHV-----SPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            ++ GPV LSTPA L+AP V   G++SIT +E+YFE+D ++     +D KVL Y   LHGKW FSEIRA+FSR++L +N ALE+F+ANR +VMF FPDQ TV+KV+Y LPRVG+G  Y + Q R+ SLA+PRQ++K SNMTQRWQ+REISNF+YLM+LNTIAGRTYNDLNQYP+FPWVL NYESE +DL+ P N+RDLS PIGALNP R  F+  R++ W++D    FHY THYSTA   L++LVR+EPFTT FLN   GKFDH DRTF S+A++W+  QRDTSDVKELIPEF+YLPEMF NSN Y  G  ED  +V+DV LP WAK PEDFVRINR ALESE VSCQLH WIDLIFGYKQRGPEA+R+ NVF YLTYEGSVN D I DP++R+A+E QI++FGQTPSQL+ EPHPPR+SA+H+     SPLMF   +  D++M+LKF SNSP+  + AN  P   + AV+TV+ + ++ VN+W++                   L GA                           S+D  H             LP+ MDPL++  + +NKR + +  D  ++ +   F  T DNR I   GFWDKSFR++S ETG+L Q+V+GH+ VV C+ARSE     DCYIV+GS D T++LW W  R H +  + N  +   PR  +TGH  E+VCV +  ELG+++S +K+  CL+HTI G+LLR+L   ++ + P  + +S EG+ ++  +      ++INGK             L   ME++ S           A+ L+ DG  +    ++G V + +  + + ++ YP CDA I ++ ++ DQR ++ G+ +G+IV FN+DFN+WH+E+++RY
Sbjct: 2137 NLAGPVVLSTPAQLIAPVVVAKGTLSITTTEIYFEVDEDDAAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQATVKKVVYSLPRVGVGTSYGLPQARRISLATPRQLYKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEELDLTLPGNFRDLSKPIGALNPKRAVFYAERYETWEEDQSPPFHYNTHYSTATSALSWLVRIEPFTTFFLNANDGKFDHPDRTFSSIARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYHLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVG----------------LRGAPGY------------------------SLDQAH------------HLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSINGK-------------LLAQMEINDST---------RAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQNRY 2936          

HSP 2 Score: 820.076 bits (2117), Expect = 0.000e+0
Identity = 414/962 (43.04%), Postives = 640/962 (66.53%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKV 3257
            NI +K+ +LIGLI+V ++  ++IV+ VL LLV G FD+E NF+I  ++ +  M ++++  D   +AE+ S+F  ++RKS  NL  + E   IE+ L  +   D M ADLL++MLG++AS+S++VKELK +F +L+G +  WP H+V+LL+VL QMP R GPD FFNFPG   +AIA+PPI+KWPYQNG+T N W  +DP + +N+D+DKPYLYCFRT+KG+GYS HFVG+ L++T++K K KG QHCVKY+ QPR+WYM+S+V++YNRW  SEIRCY++G+L+S  +M W +NTN+ +D+CF+G+S       +  GQ+  +Y F+E+LNP QI A++ LGP YK  FKF++E   +L++  ++  ++G+L  S+ F+YN  A D QLCL  +PK N  +F HS HALM  +V+ ++T SI+S +HS+GG+++LFPLF+QLD   R  ND Q     V   + A L+  L ELL  S A++ Q++  KG L+I Y + +S                     S++HI          A  +Q +S             +  +  +++G+                    L+K + D++L N A+WIH   +VQL L+ +L+ +F+    ++   R +  VLQ ++++KYYYW++NP D SGI  K  +  P  + ++I ++R+ +  F+K+L+LK   GV ++E+Q  LNYL  ++ED+NI  VL   V LMSE P++M+PAFD ++GI+VI+KLLAS  E++ + ALK+LG++L+   +KRK + M  H+LFTL+GERL+L++  +T+  YNTLYEI+TE++  ++    H  PD T  ++NP +LKV+A L++ S  + EL++VR++FL+D+  L +NS+ENRR +LQ SVWQDW+F L  ++P++ +++++ + V N+ R+LL+HA+K E+GGWRVW+DTL+I HSKV Y   +  + K+
Sbjct:   59 NIRMKFAVLIGLIQVGEVSNRDIVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVDMLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHVNTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAVHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFSYNAKATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLD--NRQLNDSQ-----VETTVCATLLAFLVELLKSSVAMQEQMLGGKGFLVIGYLLEKS---------------------SRVHITR--------AVLEQFLSF------------AKYLDGLSHGA-------------------PLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATIYTTIRRVGTVLQLMHTLKYYYWVINPADSSGIAPKGLD-GPRPSQKEIISLRAFMLLFLKQLILK-DRGVKEDELQSILNYLLTMHEDENIHDVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTYNTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLGYINPKSSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKM 951          

HSP 3 Score: 270.396 bits (690), Expect = 1.125e-71
Identity = 139/251 (55.38%), Postives = 187/251 (74.50%), Query Frame = 3
Query: 4956 SLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVW-ASDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNK----SKTEIFKNTLKELNLKSN 5693
            S+T +LE+AL   APL+REIF DF+ +LSRTL+GSHGQEL+  GLV ++ STSVVE+VMLLCSQEWQNS+QK+AGLAFIEL+NEGRLL HA  DH VRVANEA FIL+R RAEDV KH+EF   CA    +R+ EE++ +HLI++A+ RD   AN+LK ++ +++ + HG W A   ++ ++F+RLDYWEDD RRRRRFV N +GSTH EA+L +A   G    ++ +K    S+  + +N+  EL L+ +
Sbjct: 1873 SITAKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEFESQCAQYAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFWRLDYWEDDLRRRRRFVRNAFGSTHAEALLKSAVEYGTEEDVVKSKKAFRSQAIVNQNSETELMLEGD 2123          

HSP 4 Score: 240.736 bits (613), Expect = 1.208e-62
Identity = 141/284 (49.65%), Postives = 191/284 (67.25%), Query Frame = 3
Query: 3531 FSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLEN---GNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNY-PISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            FSPGPR+  FRIP F WS +HQRLL DLL ++E+D+ +W+  + +++++FVN+ EN ++V N +HL++ + D++I  CGG+LPLL+AATSP+G    LEN     GM+   AV FL R+M + D++VFASSLNF E+E EK MS+GG++RQCLRLVC  AVRNCLE R R                    D     +      QE    +   S      E +  N  PI DP+ LLQ++DINRLRAVV+RDV+++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1310 FSPGPRTTMFRIPEFKWSPMHQRLLTDLLFALETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTGSKTELENIEVTQGMSAETAVTFLSRLMAMVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQR------------------QRDRGSKSSHGSSKPQEAPHSVTAASASKTPLENVPGNLSPIKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEP 1575          
BLAST of Neurobeachin vs. Ensembl Mouse
Match: Lrba (LPS-responsive beige-like anchor [Source:MGI Symbol;Acc:MGI:1933162])

HSP 1 Score: 864.374 bits (2232), Expect = 0.000e+0
Identity = 417/821 (50.79%), Postives = 559/821 (68.09%), Query Frame = 3
Query: 6135 KVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            ++L Y   LHGKW F+EIR+IFSR++L +N ALEIF+ANR+AVMF FPD  TV+KV+  LPRVG+G  + + Q R+ SLA+PRQ+FK SNMTQRWQ REISNF+YLM+LNTIAGR+YNDLNQYP+FPWV+ NYESE +DL+ PSN+RDLS PIGALNP R  FF  RF++W+DD    FHYGTHYSTA+FVL +L+R+EPFTT FLNLQ GKFDHADRTF SV++ W+N QRDTSD+KELIPEF+YLPEMF N N+Y  G  +DG +V DV LP WAKT E+FVRINR ALESE VSCQLH WIDLIFGYKQ+GPEA+R+ NVF YLTYEG+VN + I DP++R+A+E QIRSFGQTPSQL+ EPHPPR SA+  SPLMFT     D++M+LKF SNSP+  + AN  P   + AV+TV+AN ++ VNKW+++ A                                  G +Q           D P+            QLP+ +DPL++  T  ++R + +  D  ++ H+  F  T DNR I   GFWDKSFR++S +TG+L+QVV+GH+ VV C+ARSE     +CYI++GS D T++LW W N + + +GD    E+A PR  +TGH  EI C  +  ELG+++S S++  CLIH++ G+LLR+L   ++ + P  +  SREG+ ++  +      +++NGK             L+  +E D           I A+ L++DG Y+    ++G V +R+  +L+ + +YP CDA I ++A++ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct:   16 EILAYTEGLHGKWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFGLPQTRRISLATPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPSNFRDLSKPIGALNPKRAAFFAERFESWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSVSRAWRNSQRDTSDIKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEPHPPRGSAMQASPLMFTDQAQQDVIMVLKFPSNSPVTHVAANTQPGLAMPAVITVTANRLFAVNKWHNLPA--------------------------------HQGAVQ-----------DQPY------------QLPVEIDPLIACGTGTHRRQVTDLLDQSIQVHSQCFVITSDNRYILVCGFWDKSFRVYSTDTGKLIQVVFGHWDVVTCLARSESYIGGNCYILSGSRDATLLLWYW-NGKSSGIGDNPGGETATPRAILTGHDYEITCAAVCAELGLVLSGSQEGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGCFCTFSVNGK-------------LQATVETD---------DHIRAIQLSRDGQYLLTGGDNGVVIVRQVSDLKQLFAYPGCDAGIRAMALSFDQRCIISGMASGSIVLFYNDFNRWHHEYQTRY 758          
BLAST of Neurobeachin vs. Ensembl Mouse
Match: Lrba (LPS-responsive beige-like anchor [Source:MGI Symbol;Acc:MGI:1933162])

HSP 1 Score: 857.44 bits (2214), Expect = 0.000e+0
Identity = 404/755 (53.51%), Postives = 529/755 (70.07%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGK 8252
            ++ GPV LSTPA L+AP V V G++S+T SELYFE+D  + N   +D K+L Y   LHGKW F+EIR+IFSR++L +N ALEIF+ANR+AVMF FPD  TV+KV+  LPRVG+G  + + Q R+ SLA+PRQ+FK SNMTQRWQ REISNF+YLM+LNTIAGR+YNDLNQYP+FPWV+ NYESE +DL+ PSN+RDLS PIGALNP R  FF  RF++W+DD    FHYGTHYSTA+FVL +L+R+EPFTT FLNLQ GKFDHADRTF SV++ W+N QRDTSD+KELIPEF+YLPEMF N N+Y  G  +DG +V DV LP WAKT E+FVRINR ALESE VSCQLH WIDLIFGYKQ+GPEA+R+ NVF YLTYEG+VN + I DP++R+A+E QIRSFGQTPSQL+ EPHPPR SA+  SPLMFT     D++M+LKF SNSP+  + AN  P   + AV+TV+AN ++ VNKW+++ A                                  G +Q           D P+            QLP+ +DPL++  T  ++R + +  D  ++ H+  F  T DNR I   GFWDKSFR++S +TG+L+QVV+GH+ VV C+ARSE     +CYI++GS D T++LW W N + + +GD    E+A PR  +TGH  EI C  +  ELG+++S S++  CLIH++ G+LLR+L   ++ + P  +  SREG+ ++  +      +++NGK
Sbjct: 2064 NLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPKILAYTEGLHGKWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFGLPQTRRISLATPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPSNFRDLSKPIGALNPKRAAFFAERFESWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSVSRAWRNSQRDTSDIKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEPHPPRGSAMQASPLMFTDQAQQDVIMVLKFPSNSPVTHVAANTQPGLAMPAVITVTANRLFAVNKWHNLPA--------------------------------HQGAVQ-----------DQPY------------QLPVEIDPLIACGTGTHRRQVTDLLDQSIQVHSQCFVITSDNRYILVCGFWDKSFRVYSTDTGKLIQVVFGHWDVVTCLARSESYIGGNCYILSGSRDATLLLWYW-NGKSSGIGDNPGGETATPRAILTGHDYEITCAAVCAELGLVLSGSQEGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGCFCTFSVNGK 2762          

HSP 2 Score: 812.757 bits (2098), Expect = 0.000e+0
Identity = 407/981 (41.49%), Postives = 635/981 (64.73%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVY--EQYEQDHSDHPSYSNI 3308
             I +K+ +L GL++V ++  ++IV+ V  LLV G FD+E NF+I   + ++ M+++++  D   +AE+ S+F  +++KS  NL +  E   +EK L  ++  D M ADLL++MLG++AS++++V+ELK  F  L+G    WP H+ +LL+VL+ MP + GPD FFNFPG   +AIA+PPI++WPYQNG+TF+ W+ +DP + +N+D+DKPYLYCFRT+KGLGYS HFVG  L+IT++K K KG QHCVK++ +P++WYMV++V++YNRW  SE+RCY++GEL S  E+ W +NT++ FD+CF+G+S       +  GQ++ +Y F+++LN  QI AIY LG  YKG FKF+AE    L++  +   ++G+L  ++ F YNP A D QLCL  +PK N  +F HS HALM  +V+ VLT SI S +HS+GGV++LFPLF+QLD+        Q +S++V   I   L+  + ELL  S A++ Q++  KG L+I Y + +S+      S +  ++++LCL+ S+    +LS  QN                                                    + L+K + D++L N A+WIH   +VQL L+ +L+ +F+    ++N  R +  VL  ++++KYYYW VNP+DRSGI  K  +  P  N ++I ++R+ +  FIK+L++K  +GV ++E+Q  LNYL  ++EDDN+  VL   V LM+E P++M+PAFD ++G++VI+KLLAS  E +R+ ALK LG++L+    KRK + M+ H LF+L+ ERL+L +  +TM MYN L+EI+ E++  ++    H  PD T  ++NP +LKVIA L+R S    E ++VR+ FL+D+  L NNS+ENRR++LQ SVWQ+W+  L   +P+  D++++ + V  + R+LL+HA+K E+GGWRVW+DTL+I HSKV +   + ++  ++  EQ + D    P  S++
Sbjct:   43 GIRMKFAVLTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESIMCMVELLEKCDVTCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDSMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGQWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIARWPYQNGFTFHTWLRMDPVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFDFKPQKWYMVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQMTAVYLFSDALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSAIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLFAQLDYK-------QYLSDEVDLTICTTLLAFIMELLKNSIAMQEQMLACKGFLVIGYSLEKSS-----KSHVSRAVLELCLAFSK----YLSNLQN---------------------------------------------------GMPLLKQLCDHILLNPAVWIHTPAKVQLMLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLD-GPRPNQKEILSLRAFLLMFIKQLVMK-DSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMAEHPNSMIPAFDQRNGLRVIYKLLASKSEGIRVQALKALGYFLKHLAPKRKAEVMLGHGLFSLLAERLMLQTNLITMTMYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPQILKVIATLLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREEQRKGDEETGPCSSSL 954          

HSP 3 Score: 259.996 bits (663), Expect = 1.542e-68
Identity = 133/218 (61.01%), Postives = 165/218 (75.69%), Query Frame = 3
Query: 4956 SLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQ-NEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTA 5600
            S+T+RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLLCSQEWQNS+QK+AGLAFIELVNEGRLL+    DH VRVANEA FILSR RAED+ +H+EF  LCA    +++ EE++ +HLI +A+ RD   A +L  ++ +L+   HG W S   +   EF+RLDYWEDD RRRRRFV NP GSTHPEA L TA
Sbjct: 1797 SITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREEEKMCDHLIRAAKYRDHVTATQLIQKIINLLTDKHGAWGSSAVSRPREFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTA 2014          

HSP 4 Score: 238.81 bits (608), Expect = 4.059e-62
Identity = 134/293 (45.73%), Postives = 199/293 (67.92%), Query Frame = 3
Query: 3546 RSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETN 4424
            RS  FRIP F WSQ+HQRLL DLL SIE+D+Q+W+  + + +++FVN+++N ++V N +HL++ + D+++  CGG+LPLL+AATS + +++ +E   G+++  +V FL R++++ D+++FASSL F E+E EK MS+GGILRQCLRLVC  AVRNCLE +           S L     + + SK   +L P     + +       D+    +     P+ D + LLQ+MDINRLRAVV+RD+E++KQAQFLAL++VYF+SVLMVS+YRD+LEP     S SL+ + +   N
Sbjct: 1297 RSTMFRIPEFKWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKNMSSGGILRQCLRLVCAVAVRNCLECQ---------QHSQLKARGDTAKSSKTIHSLIP-----MGKSAAKSPVDIVTGGI----SPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEPQDERHSQSLKETSSDNGN 1571          
BLAST of Neurobeachin vs. Ensembl Mouse
Match: Lrba (LPS-responsive beige-like anchor [Source:MGI Symbol;Acc:MGI:1933162])

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 407/981 (41.49%), Postives = 635/981 (64.73%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVY--EQYEQDHSDHPSYSNI 3308
             I +K+ +L GL++V ++  ++IV+ V  LLV G FD+E NF+I   + ++ M+++++  D   +AE+ S+F  +++KS  NL +  E   +EK L  ++  D M ADLL++MLG++AS++++V+ELK  F  L+G    WP H+ +LL+VL+ MP + GPD FFNFPG   +AIA+PPI++WPYQNG+TF+ W+ +DP + +N+D+DKPYLYCFRT+KGLGYS HFVG  L+IT++K K KG QHCVK++ +P++WYMV++V++YNRW  SE+RCY++GEL S  E+ W +NT++ FD+CF+G+S       +  GQ++ +Y F+++LN  QI AIY LG  YKG FKF+AE    L++  +   ++G+L  ++ F YNP A D QLCL  +PK N  +F HS HALM  +V+ VLT SI S +HS+GGV++LFPLF+QLD+        Q +S++V   I   L+  + ELL  S A++ Q++  KG L+I Y + +S+      S +  ++++LCL+ S+    +LS  QN                                                    + L+K + D++L N A+WIH   +VQL L+ +L+ +F+    ++N  R +  VL  ++++KYYYW VNP+DRSGI  K  +  P  N ++I ++R+ +  FIK+L++K  +GV ++E+Q  LNYL  ++EDDN+  VL   V LM+E P++M+PAFD ++G++VI+KLLAS  E +R+ ALK LG++L+    KRK + M+ H LF+L+ ERL+L +  +TM MYN L+EI+ E++  ++    H  PD T  ++NP +LKVIA L+R S    E ++VR+ FL+D+  L NNS+ENRR++LQ SVWQ+W+  L   +P+  D++++ + V  + R+LL+HA+K E+GGWRVW+DTL+I HSKV +   + ++  ++  EQ + D    P  S++
Sbjct:   43 GIRMKFAVLTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESIMCMVELLEKCDVTCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDSMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGQWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIARWPYQNGFTFHTWLRMDPVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFDFKPQKWYMVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQMTAVYLFSDALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSAIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLFAQLDYK-------QYLSDEVDLTICTTLLAFIMELLKNSIAMQEQMLACKGFLVIGYSLEKSS-----KSHVSRAVLELCLAFSK----YLSNLQN---------------------------------------------------GMPLLKQLCDHILLNPAVWIHTPAKVQLMLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLD-GPRPNQKEILSLRAFLLMFIKQLVMK-DSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMAEHPNSMIPAFDQRNGLRVIYKLLASKSEGIRVQALKALGYFLKHLAPKRKAEVMLGHGLFSLLAERLMLQTNLITMTMYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPQILKVIATLLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREEQRKGDEETGPCSSSL 954          

HSP 2 Score: 261.151 bits (666), Expect = 5.797e-69
Identity = 133/218 (61.01%), Postives = 165/218 (75.69%), Query Frame = 3
Query: 4956 SLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQ-NEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTA 5600
            S+T+RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLLCSQEWQNS+QK+AGLAFIELVNEGRLL+    DH VRVANEA FILSR RAED+ +H+EF  LCA    +++ EE++ +HLI +A+ RD   A +L  ++ +L+   HG W S   +   EF+RLDYWEDD RRRRRFV NP GSTHPEA L TA
Sbjct: 1797 SITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREEEKMCDHLIRAAKYRDHVTATQLIQKIINLLTDKHGAWGSSAVSRPREFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTA 2014          

HSP 3 Score: 239.965 bits (611), Expect = 1.750e-62
Identity = 134/293 (45.73%), Postives = 199/293 (67.92%), Query Frame = 3
Query: 3546 RSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETN 4424
            RS  FRIP F WSQ+HQRLL DLL SIE+D+Q+W+  + + +++FVN+++N ++V N +HL++ + D+++  CGG+LPLL+AATS + +++ +E   G+++  +V FL R++++ D+++FASSL F E+E EK MS+GGILRQCLRLVC  AVRNCLE +           S L     + + SK   +L P     + +       D+    +     P+ D + LLQ+MDINRLRAVV+RD+E++KQAQFLAL++VYF+SVLMVS+YRD+LEP     S SL+ + +   N
Sbjct: 1297 RSTMFRIPEFKWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKNMSSGGILRQCLRLVCAVAVRNCLECQ---------QHSQLKARGDTAKSSKTIHSLIP-----MGKSAAKSPVDIVTGGI----SPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEPQDERHSQSLKETSSDNGN 1571          

HSP 4 Score: 55.0694 bits (131), Expect = 2.288e-6
Identity = 26/49 (53.06%), Postives = 35/49 (71.43%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQK 6137
            ++ GPV LSTPA L+AP V V G++S+T SELYFE+D  + N   +D K
Sbjct: 2076 NLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPK 2124          
BLAST of Neurobeachin vs. UniProt/SwissProt
Match: sp|P50851|LRBA_HUMAN (Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA PE=1 SV=4)

HSP 1 Score: 1152.5 bits (2980), Expect = 0.000e+0
Identity = 595/1224 (48.61%), Postives = 792/1224 (64.71%), Query Frame = 3
Query: 4947 SSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWA-SDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEPRSNEDNXXXXXXXXXXXXXXXXYKIPDNKDSNQNKI----SDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            S+ S+T+RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLLCSQEWQNS+QK+AGLAFIELVNEGRLL+    DH VRVANEA FILSR RAED+ +H+EF  LCA    +++ +E++ +HLI +A+ RD   A +L  ++ +++   HG W  S  +   EF+RLDYWEDD RRRRRFV NP GSTHPEA L TA                 IFK       L+ N  A                 TDE++    K   RS                     +   N++S +N+I     DDT S+   K +         +LA P++        LSTPA L+AP V V G++S+T SELYFE+D  + N   +D K+L Y   LHGKW F+EIR+IFSR++L +N ALEIF+ANR+AVMF FPD  TV+KV+  LPRVG+G  + + Q R+ SLASPRQ+FK SNMTQRWQ REISNF+YLM+LNTIAGR+YNDLNQYP+FPWV+ NYESE +DL+ P+N+RDLS PIGALNP R  FF  R+++W+DD    FHYGTHYSTA+FVL +L+R+EPFTT FLNLQ GKFDHADRTF S+++ W+N QRDTSD+KELIPEF+YLPEMF N N+Y  G  +DG +V DV LP WAKT E+FV INR ALESE VSCQLH WIDLIFGYKQ+GPEA+R+ NVF YLTYEG+VN + I DP++R+A+E QIRSFGQTPSQL+ EPHPPR SA+ VSPLMFT     D++M+LKF SNSP+  + AN  P     AV+TV+AN ++ VNKW+++ A                                  G +Q           D P+            QLP+ +DPL++  T +++R + +  D  ++ H+  F  T DNR I   GFWDKSFR++S +TGRL+QVV+GH+ VV C+ARSE     +CYI++GS D T++LW W N + + +GD    E+A PR  +TGH  E+ C  +  ELG+++S S++  CLIH++ G+LLR+L   ++ + P  +  SREG+ ++  +      +++NGK             L+  ME D          +I A+ L++DG Y+    + G V +R+  +L+ + +YP CDA I ++A++ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct: 1792 SNMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREDEKMCDHLIRAAKYRDHVTATQLIQKIINILTDKHGAWGNSAVSRPLEFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTAV------------EHVCIFK-------LRENSKA-----------------TDEDILAKGKQSIRS---------------------QALGNQNS-ENEILLEGDDDTLSSVDEKDL--------ENLAGPVS--------LSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPKILAYTEGLHGKWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFGLPQTRRISLASPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPTNFRDLSKPIGALNPKRAAFFAERYESWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSISRAWRNSQRDTSDIKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVHINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEPHPPRGSAMQVSPLMFTDKAQQDVIMVLKFPSNSPVTHVAANTQPGLATPAVITVTANRLFAVNKWHNLPA--------------------------------HQGAVQ-----------DQPY------------QLPVEIDPLIASNTGMHRRQITDLLDQSIQVHSQCFVITSDNRYILVCGFWDKSFRVYSTDTGRLIQVVFGHWDVVTCLARSESYIGGNCYILSGSRDATLLLWYW-NGKCSGIGDNPGSETAAPRAILTGHDYEVTCAAVCAELGLVLSGSQEGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGLFCTFSVNGK-------------LQATMETD---------DNIRAIQLSRDGQYLLTGGDRGVVVVRQVSDLKQLFAYPGCDAGIRAMALSYDQRCIISGMASGSIVLFYNDFNRWHHEYQTRY 2863          

HSP 2 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 402/967 (41.57%), Postives = 629/967 (65.05%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYE 3272
             I +K+ +L GL++V ++  ++IV+ V  LLV G FD+E NF+I   + +  M+D+++  D   +AE+ S+F  +++KS  NL +  E   +EK L  ++  D M ADLL++MLG++AS++++V+ELK  F  L+G    WP H+ +LL+VL+ MP + GPD FFNFPG   +AIA+PPI+KWPYQNG+TF+ W+ +DP + +N+D+DKPYLYCFRT+KGLGYS HFVG  L++T++K K KG QHCVK++ +P++WYMV++V++YNRW  SE+RCY++GEL S  E+ W +NT++ FD+CF+G+S       +  GQ++ +Y F+E+LN  QI AIY LG  YKG FKF+AE    L++  +   ++G+L  ++ F YNP A D QLCL  +PK N  +F HS HALM  +V+ VLT SI S +HS+GGV++LFPLF+QLD  YR     Q +S+++   I + L+  + ELL  S A++ Q++  KG L+I Y + +S+      S +  ++++LCL+ S+    +LS  QN                                                    + L+K + D++L N A+WIH   +VQL L+ +L+ +F+    ++N  R +  VL  ++++KYYYW VNP+DRSGI  K  +  P  N +++ ++R+ +  FIK+L++K  +GV ++E+Q  LNYL  ++EDDN+  VL   V LMSE P++M+PAFD ++G++VI+KLLAS  E +R+ ALK +G++L+    KRK + M+ H LF+L+ ERL+L +  +TM  YN L+EI+ E++  ++    H  PD +  ++NP +LKVIA L+R S    E ++VR+ FL+D+  L NNS+ENRR++LQ SVWQ+W+  L   +P+  D++++ + V  + R+LL+HA+K E+GGWRVW+DTL+I HSKV +   + ++  ++ + +
Sbjct:   43 GIRMKFAVLTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESINCMVDLLEKCDITCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDNMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGRWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIVTSIKSKGKGFQHCVKFDFKPQKWYMVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQMTAVYLFSEALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSAIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLFAQLD--YR-----QYLSDEIDLTICSTLLAFIMELLKNSIAMQEQMLACKGFLVIGYSLEKSS-----KSHVSRAVLELCLAFSK----YLSNLQN---------------------------------------------------GMPLLKQLCDHVLLNPAIWIHTPAKVQLMLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLD-GPRPNQKEMLSLRAFLLMFIKQLVMK-DSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMSEHPNSMIPAFDQRNGLRVIYKLLASKSEGIRVQALKAMGYFLKHLAPKRKAEVMLGHGLFSLLAERLMLQTNLITMTTYNVLFEILIEQIGTQVIHKQHPDPDSSVKIQNPQILKVIATLLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREQQ 940          

HSP 3 Score: 238.424 bits (607), Expect = 4.509e-61
Identity = 133/275 (48.36%), Postives = 195/275 (70.91%), Query Frame = 3
Query: 3546 RSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            RS  FRIP F WSQ+HQRLL DLL SIE+D+Q+W+  + + +++FVN+++N ++V N +HL++ + D+++  CGG+LPLL+AATS + +++ +E   G+++  +V FL R++++ D+++FASSL F E+E EK+MS+GGILRQCLRLVC  AVRNCLE +    H QL               ++ D  L   PM  L+  L   +    V+ +     P+ D + LLQ+MDINRLRAVV+RD+E++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1300 RSTVFRIPEFNWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKSMSSGGILRQCLRLVCAVAVRNCLECQ---QHSQL--------------KTRGDKAL--KPMHSLIP-LGKSAAKSPVDIVTGGISPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEP 1554          
BLAST of Neurobeachin vs. UniProt/SwissProt
Match: sp|A8XSV3|NBEA_CAEBR (Putative neurobeachin homolog OS=Caenorhabditis briggsae OX=6238 GN=sel-2 PE=3 SV=1)

HSP 1 Score: 996.882 bits (2576), Expect = 0.000e+0
Identity = 535/1230 (43.50%), Postives = 728/1230 (59.19%), Query Frame = 3
Query: 4929 PKSNFPSSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLV--TLR-QSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEPRSNEDNXXXXXXXXXXXXXXXXYKIPDNKDSNQNKISDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQS-GNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLL---SQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFN-CRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            P+        LT +L+ AL   APL+RE+  DF  YL +TL+G+HGQE+++   V  TLR ++ SV+E+VMLLCSQEWQ SLQKHAGLAFIELVNEGRL+AHA+ DH +RVANEA FIL+R+RAEDV KH++F          R  E    + LI S R RD   A +L  ++ +++         D    ++F++LD WEDDSRRR+RFV NPYGS H EA LP      + P I    S+ E  +  LK L          S    T TS  G  + DE                                              SD  K AQ +     S++                    ST A L+ PGV V G++S+T S+L+F+ + ++ N      +VL Y   LH +W+  EIRAIF R++L +N ALE+F+A+R A+MFAF  ++TVRKV+Y LPRVG+G+KY + Q RK+SL +PRQ+FK S+M  +WQ+REISNFDYLM+LNT+AGRT+NDL+QYP+FPW+L NY S+T+DLS  SN+RDLS PIGALN +R+KFF +R+ +WDDD   AFHYGTHYST AF LN+L+R+EPF ++F+NL  GKFDH DR  HS+  +W  CQRD+ DVKELIPE FYLPEMF NS+ +  G+  DG +VDDV+LP WA++PE FV ++RQALES+LVSCQL+ WIDLIFGYKQRG EA+R+TNVF +LTYEG+V     + P    A+E QI SFGQTPSQL+ E HPPR+S + ++P MF     DL MM+K++SNSP+V++ AN   Q P   V+ V+ N V+ +NKW+                                  NS S G+ Q S  S   S+V+              V LPL+ DP L   + TT I +R LG+ FD  ++     F  T D++ IFA G+ D SFRI   ++GR+ Q VYGH  VV CIARSE     DCY+VTGS DCT++LW W      + G++N   E   PR  +TGH+A I  + +S E G++VS  +D   LIHT   +LLR +    +     +L +SRE  +L+      +  Y+   + +  +L+ ++                      I  + +T+DG++    + +G + I R   L  +++Y   ++A+ S+A+    RFIL GL +G IV+FN DFN+WH+EY+ RY
Sbjct: 1439 PQQTAERRAYLTTKLQTALETCAPLLREMMSDFRGYLQKTLVGTHGQEIMNDTKVLETLRNRNASVIELVMLLCSQEWQTSLQKHAGLAFIELVNEGRLMAHATRDHVLRVANEADFILNRLRAEDVSKHAQFEAESREQLNARYEEYSRCDLLIVSGRLRDSLNATRLLDKMSAILTD-----GDDSKSGSQFWKLDVWEDDSRRRKRFVPNPYGSRHEEANLPEGE-KNEEPEI----SEQERIRKILKGL---------FSQRHATTTSTGGQELVDE----------------------------------------------SDIDKWAQEVDPTPSSQSAC-----------------FSTAAKLIVPGVVVPGTLSVTASDLFFDANESDPNYKKQCAQVLRYCEALHARWNLQEIRAIFLRRYLLQNTALEMFLASRTAIMFAFDSEDTVRKVVYQLPRVGVGVKYGLPQSRKTSLMTPRQLFKHSDMCAKWQKREISNFDYLMFLNTVAGRTFNDLSQYPVFPWILTNYTSDTLDLSVASNFRDLSKPIGALNEARRKFFTDRYASWDDDLVPAFHYGTHYSTPAFTLNWLLRLEPFASMFINLHDGKFDHPDRITHSIKDSWDRCQRDSHDVKELIPELFYLPEMFRNSSKFNLGRRADGTLVDDVVLPPWAESPEHFVLMHRQALESDLVSCQLNQWIDLIFGYKQRGAEAVRATNVFYHLTYEGTVTQKMAETPGQVSAIEQQILSFGQTPSQLLAEAHPPRHSIMTMAPTMFRRHDDDLCMMMKYISNSPVVYLAANTFHQLPHPTVVGVAQNLVFSLNKWD----------------------------------NSYSYGSTQRSALSMDPSNVE------------GQVALPLTADPQLATAASTTPIARRHLGDAFDQRLQVQCSNFVTTTDSKYIFACGYPDYSFRIVDTDSGRVRQAVYGHGDVVTCIARSETSLFSDCYVVTGSMDCTVVLWHWNGTTGFIAGEYNQPGEVPSPRSILTGHEASISALCVSAEHGLVVSGCEDGVILIHTTASDLLRRIRGHGTVT---QLSMSRECILLVLFDSKRMTTYSSTARKLNEVLSEEK----------------------IECVTVTRDGEFAVTGAVNGRITIWRMFPLNKLYTYQPLNSAVRSVAVVASHRFILGGLDSGAIVVFNADFNRWHYEYKHRY 2515          

HSP 2 Score: 577.015 bits (1486), Expect = 1.770e-165
Identity = 356/984 (36.18%), Postives = 540/984 (54.88%), Query Frame = 3
Query:  342 KIYLIKSMKENIDIKYGLLIGLIKVNQ--IEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEK------TLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKI-NNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHAL-ELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHN-----GVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDM 3248
            K  LI S +E  D     LI  +  N   ++  +IVD +  LLV G FD E  F+I     V HML ++   D  L+ E+ S+F+ +++KS  NL        I K       L++L  A  + ADLL++++  + ++S++VK+ K + + L+ +   WP +S++LL+VL++MP     D FF+FPG   S I +PPI   PYQ GWTF  W+ ++P ++V  ++++P LY FRT+KG+GYS H  G+ LV+   K K K    CVK  L  R+W+ +++ + Y+RW +S+I+C+IDG+L   +E+ W + +   +DRC IG S +    T   GQ+  +Y FAESL+  Q  +++ LGP+Y+  FK ++E   +L +  +K  F+G L  SL+FAY P  C  QLCL   PK   N  F    HA+M   V  + T SI+ +L S+GG++IL PLF+Q+D      N    I  DV   + + +  LL         + H    SKG L+IS  +  ++    L+ ++L+ II         HI     R   PA          GP  ++                  + DY +  P     A  E+  H+Y YL ++                 FLAN+  S+ +     R +  V++  +++K++YWL  P+  S     + E      T +I +IRS+I  FI ++++  ++        D+E+   LN L  V EDDN+  VL     L++E P+ M+PA D    + +IF LLA+ +E +RI ALK+LGF+L RST KRK +SM   NLF+LIGERLL +   +++  YN L E++ E+MT   +   H         ENP LLKVIAH+I Q + T+ L+Q++K FL D+ +LC  SKENRRT+LQMSVWQDWL  L  +   +  Q ++ + V     +LLHHA++ EYGGWRVW+DTLAI HSKV+Y +F+R +
Sbjct:  131 KTTLIHSNEEGADETIQRLISSLHSNSPNMDRTQIVDHLFNLLVGGHFDQESKFVIEHVANVDHMLTLLSHCDCDLQNEIWSLFLAVMKKSNRNLEACTRVGLISKNFFLNLVLDLLPEAPPLLADLLVQIIAALVAYSINVKQTKHLLRALRSTKDQWPPNSLKLLHVLKEMPQHDSADVFFSFPGKDQSGIILPPIKTMPYQQGWTFATWLRMEPLNSVTFEKEQPVLYSFRTSKGIGYSCHIFGNCLVVNVEKAKGKEQSRCVKAELGARKWHHIAIAHCYSRWGRSDIKCFIDGQLAETIELSWVVTSTTSWDRCSIGVSADGAVNTAFCGQMGAMYLFAESLSLQQANSLFCLGPAYQSTFKHDSET--SLPEGYKKHLFDGHLHSSLVFAYCPKNCHGQLCLFTPPKTAANTYFVQIPHAVMKEGVEVITTHSIHKSLQSVGGIQILLPLFAQIDLPSSHDN---TIDGDVCQTLLSLISLLLSSSQSSQQQLFH----SKGFLIISSCLQEASPS-HLSMKVLEQII---------HIAKFLLR--CPA---------GGPLLKH------------------LFDYILFNPKLWIRARPEVQVHLYQYLATD-----------------FLANNNFSQML-----RRVPTVIEMCHTLKHFYWLALPQTVSDY--TVEERPENFATAEIVSIRSAILTFINRIIISSNSPDEEEKARDQEIHTLLNLLATVREDDNLYDVLALVTRLLAEHPAIMIPAIDKNKALGIIFNLLAAPNELIRIPALKILGFFLSRSTLKRKTESMGSQNLFSLIGERLLSHKRTISLPTYNVLLEVLVEQMTPTFTYAAHQPAQPDWKFENPHLLKVIAHVISQCEETESLVQIKKCFLIDIINLCRESKENRRTILQMSVWQDWLIGLAYVFHTSESQNEVSELVWEAFSILLHHALRHEYGGWRVWVDTLAIAHSKVSYEKFKRRL 1042          

HSP 3 Score: 179.489 bits (454), Expect = 3.025e-43
Identity = 124/303 (40.92%), Postives = 185/303 (61.06%), Query Frame = 3
Query: 3558 FRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLEN-GNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRD-VEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETNDQDRDKFEKLNH 4460
            +R P F WS++H RLL DLL  IE  ++ WK +    I +  NA+ENQV+V N+VH+++ L+DSLI  CGGLLPLLA+AT+P+ D+++++     + +S A  FL+R   + D  V AS ++F ELEQEK M  GG+LRQ LR+  T  VR+ L +R +        ++  YE +S+ ++    D +     +E +    P           L+N      E L+Q+ DI R++ VVYRD VEE +QAQFLALS++Y +SVLMVSRYRD+LEP P+  S   +S+  ++ N +  +K  + +H
Sbjct: 1066 YRAPEFAWSEVHIRLLADLLSGIERTVEEWK-TQEGGISDQCNASENQVFVGNVVHVISQLADSLIMACGGLLPLLASATAPNNDMEIVDPCQQQLPISVAASFLMRFAKLVDTFVLASGVSFSELEQEKNMPAGGVLRQSLRISATVTVRHILASRIQQ------PDTPRYETNSAKKNQCIMDFV-----KEALENFSPEG---------LENV-----ERLVQDSDITRIKGVVYRDMVEENRQAQFLALSVIYLVSVLMVSRYRDILEP-PSSPSPFFDSTTTKQENAERGEKLFEFSH 1341          
BLAST of Neurobeachin vs. UniProt/SwissProt
Match: sp|Q9W4E2|NBEA_DROME (Neurobeachin OS=Drosophila melanogaster OX=7227 GN=rg PE=1 SV=4)

HSP 1 Score: 972.615 bits (2513), Expect = 0.000e+0
Identity = 453/879 (51.54%), Postives = 613/879 (69.74%), Query Frame = 3
Query: 5976 KPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLS------QTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            + +++D+TGPV +ST A L+APG+   G+VSIT +E++FE+D  +     +D +VL Y  HLHGKW+FSE+RAIFSR++L +N+ALEIF+A+R +++FAFPDQ TV+KVI  LPRVG+GIKY + Q R++S+ SPRQ+ + SNMTQ+WQ+REISNF+YLM+LNTIAGRTYNDLNQYPIFPWVL NYES+ +DLS PSNYRDLS PIGALNPSR+ +F+ R+++WD D+   FHYGTHYSTAAF LN+LVRVEPFTT+FL LQ GKFD+ DR F SV+ +WKNCQRDTSDVKELIPE+++LPEMF NS+ YR G  EDG +VDD+ LP WAK+PE+FVRINR ALESE VSCQLH WIDLIFGYKQRGPEAIR+TNVF YLTYEGSV+ D + DP++R+A+E+QIR+FGQTPSQL+ EPHPPR+SA+H+SP+MF+ +  DL  MLKF  NSP++ ++AN +PQ  L +V+TV+A + + VN+WN                                       N  +S+ S   S  +SP         S     PL++DP+L+       +   ++R LG+ F   ++  +  F  T D+R + A GFWD SFR+F+ ET +++Q+V+GHFGVV C+ARSEC    DCYI +GS DCT++LW W  R  +++G+ +      PR T+TGH+  +  V IS ELG++VS S +   LIHT  G+LLRSL     F  P  + +SREG+I++      V  YTINGK + H  ++D                      ++  M L++DG+Y+  + + G V + R  NL  ++++P C+A I SLA+T DQ+++L GL  G+I++F++DFN+WHHEY+ RY
Sbjct: 2661 RELDLDLTGPVNISTKARLIAPGLVAPGTVSITSTEMFFEVDEEHPEFQKIDGEVLKYCDHLHGKWYFSEVRAIFSRRYLLQNVALEIFLASRTSILFAFPDQHTVKKVIKALPRVGVGIKYGIPQTRRASMMSPRQLMRNSNMTQKWQRREISNFEYLMFLNTIAGRTYNDLNQYPIFPWVLTNYESKDLDLSLPSNYRDLSKPIGALNPSRRAYFEERYESWDSDTIPPFHYGTHYSTAAFTLNWLVRVEPFTTMFLALQGGKFDYPDRLFSSVSLSWKNCQRDTSDVKELIPEWYFLPEMFYNSSGYRLGHREDGALVDDIELPPWAKSPEEFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAIRATNVFYYLTYEGSVDLDGVLDPVMREAVENQIRNFGQTPSQLLMEPHPPRSSAMHLSPMMFSAMPEDLCQMLKFYQNSPVIHISANTYPQLSLPSVVTVTAGHQFAVNRWN--------------------------------------CNYTASVQS--PSYAESPQ--------SPGSNQPLTIDPVLAVHGTNNNSNAASRRHLGDNFSQMLKIRSNCFVTTVDSRFLIACGFWDNSFRVFATETAKIVQIVFGHFGVVTCMARSECNITSDCYIASGSADCTVLLWHWNARTQSIVGEGDV---PTPRATLTGHEQAVTSVVISAELGLVVSGSSNGPVLIHTTFGDLLRSLDPPAEFHSPELITMSREGFIVINYDKGNVAAYTINGKKLRHETHND----------------------NLQCMLLSRDGEYLMTAGDRGIVEVWRTFNLAPLYAFPACNAGIRSLALTHDQKYLLAGLSTGSIIVFHIDFNRWHHEYQQRY 3466          

HSP 2 Score: 469.544 bits (1207), Expect = 2.239e-131
Identity = 263/621 (42.35%), Postives = 397/621 (63.93%), Query Frame = 3
Query: 1470 FEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINT 3332
            ++G+L ++++F YNPVA D QLCL  +PK N   F H+ HALM  +V+ V+T SI+ TL+S+GG+++LFPLFSQLD ++    D   I  D  P + ++L+  + EL+  S  ++  ++Q++G L+IS+ + RS+    L  E+L S     L+L++  +  LS   N      QL   +                                          L   + D++L N A+WI+    VQ +L+ +LA +FLS+  +++  R ++ VLQ ++++KYYYW+VNPR +SGI+ K  +  P    + I  IR+ I  F+K+L++   NGV ++E+Q  LNYLT ++ED+N+  VL   ++LMSE PS+MVPAFD KHG++ IFKLLA+  + +R+ ALKLLGF+L RST+KRK D M PHNL+TL+ ERLLLY   L++  YN LYEIMTE ++ +I  T H  P+  + LENP +LKV+A LIRQSK T+ L+ V+K+FL D+  LCN+++ENRRTVLQMSVWQ+WL  +  + P++ +++++ D V +L R+LLHHA+K EYGGWRVW+DTLAI+HSKV+Y EF+    ++YE YE+  +D+ +   ++    I+T
Sbjct:  597 YDGKLSNAIVFMYNPVATDGQLCLQSSPKGNVSYFVHTPHALMLQDVKAVVTHSIHCTLNSIGGIQVLFPLFSQLDMAHEGLGD---IKRD--PTLCSKLLGFICELVETSQTVQQHMIQNRGFLVISFMLQRSSRE-HLTLEVLGSF----LNLTKYLVTCLSA--NSDLLLKQLFCFSF-----------------------------------------LTWQLLDHVLFNPALWIYTPANVQARLYSYLATEFLSDTQIYSNVRRVSTVLQTVHTLKYYYWVVNPRAKSGIIPKGLD-GPRPAQKDILAIRAYILLFLKQLIM-IGNGVKEDELQSILNYLTTMHEDENLHDVLQMLISLMSEHPSSMVPAFDVKHGVRSIFKLLAAESQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLYTLLAERLLLYEESLSLPTYNVLYEIMTEHISQQILYTRHPEPESHYRLENPMILKVVATLIRQSKQTESLIDVKKLFLQDMTLLCNSNRENRRTVLQMSVWQEWLIAMAYIHPKSSEEQKISDMVYSLFRMLLHHAIKHEYGGWRVWVDTLAIVHSKVSYEEFKLQFAQMYEHYERQRTDNITDPALRQARPIST 1162          

HSP 3 Score: 424.091 bits (1089), Expect = 1.595e-117
Identity = 195/370 (52.70%), Postives = 276/370 (74.59%), Query Frame = 3
Query:  354 IKSMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRK 1463
            I  M    ++K+ +LIGLI+V Q+  +E+V+ VL+LLV G FDME NF+I  +Q + HML+++      L+AE+ SVFI ++RKS  NL    +   IE  L  L+ ++ + ADLLIEMLG++AS+S++VKELK +F  +K +N  WP HS +LLNVL+QMP R+GPD FF+FPG  GSA+ +PP++KWPY+NG+TF  W  LDP ++VNI+R+KPYLYCF+T+KG+GY+ HFVG+ LV+T+MK+K KG QHCVKY  QPR+WYM+++VY+YNRWTKSEI+C ++G+L S  EM W ++TN+ FD+C+IGA+PE   E +  GQ+S IY F+E+L   QI A++ LGP YK  F+F+ EC  NL D+ ++
Sbjct:   18 IVRMTTADNLKFAVLIGLIEVGQVTNREVVNTVLHLLVGGEFDMELNFVIQDAQNIKHMLELLDHCPPNLQAEIWSVFIAILRKSVRNLQACTDVGLIEHVLVRLQRSETVVADLLIEMLGVLASYSITVKELKLLFGTMKATNGKWPRHSAKLLNVLRQMPHRNGPDVFFSFPGRKGSAMVLPPLAKWPYENGFTFTTWFRLDPINSVNIEREKPYLYCFKTSKGVGYTAHFVGNCLVLTSMKVKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCLVNGQLASSTEMAWFVSTNDPFDKCYIGATPELDEERVFCGQMSAIYLFSEALTTQQICAMHRLGPGYKSQFRFDNECYLNLPDNHKR 387          

HSP 4 Score: 286.189 bits (731), Expect = 1.696e-75
Identity = 155/289 (53.63%), Postives = 211/289 (73.01%), Query Frame = 3
Query: 3504 AQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            ++S +   +FSPGP   PFRIP F WS +HQRLL D+L S+E+D+Q+W+  + +++L+FVN++EN ++V+N VHL++ L+D+LI  CGGLLPLLA+ATSP+ ++D+LE   GM +  AV FL R++N+AD+++FA+SLNF ELE EK MS+GGILRQCLRLVCTCAVRNCLE +          E   Y   +   D     +L     Q L+RG +    ++ V  +  Q  P+ DPE LLQ+MD+NRLRAV+YRDVEE KQAQFL+L+IVYF+SVLMVS+YRD+LEP
Sbjct: 1831 SKSGSTRPMFSPGPTRPPFRIPEFKWSYIHQRLLSDVLFSLETDIQVWRSHSTKSVLDFVNSSENAIFVVNTVHLISQLADNLIIACGGLLPLLASATSPNSELDVLEPTQGMPLEVAVSFLQRLVNMADVLIFATSLNFGELEAEKNMSSGGILRQCLRLVCTCAVRNCLECK----------ERTRYNVGALARDVPGAAHL-----QALIRGAQASPKNI-VESITGQLSPVKDPEKLLQDMDVNRLRAVIYRDVEETKQAQFLSLAIVYFISVLMVSKYRDILEP 2103          

HSP 5 Score: 262.692 bits (670), Expect = 1.987e-68
Identity = 128/233 (54.94%), Postives = 168/233 (72.10%), Query Frame = 3
Query: 4953 TSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELV--SSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQN-----------EYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSG 5612
             SLT++LE ALG   PL+REI  DF+ +LS+TL+GSHGQEL+    GL T + S SVVE+VMLLCSQEWQNSLQKHAGLAFIEL+NEGRLL+HA  DH VRVANEA FIL+RMRA+DV KH++F   CA    ER+ EER+ +HLI +AR RD+ +A++L  +V +++ + HG W    +           + + +++LD WEDD+RRR+R V NP GS+HP+A L  A  +G
Sbjct: 2386 ASLTQKLEIALGPVCPLLREIMVDFAPFLSKTLVGSHGQELLMEGKGLTTFKNSHSVVELVMLLCSQEWQNSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFESQCAQTLLERREEERMCDHLITAARRRDNVIASRLLEKVRNIMCNRHGAWGDSSSTSSGGAIVGAVQKSPYWKLDAWEDDARRRKRMVQNPRGSSHPQATLKAALENG 2618          
BLAST of Neurobeachin vs. UniProt/SwissProt
Match: sp|Q9ESE1|LRBA_MOUSE (Lipopolysaccharide-responsive and beige-like anchor protein OS=Mus musculus OX=10090 GN=Lrba PE=1 SV=1)

HSP 1 Score: 931.013 bits (2405), Expect = 0.000e+0
Identity = 443/869 (50.98%), Postives = 593/869 (68.24%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            ++ GPV LSTPA L+AP V V G++S+T SELYFE+D  + N   +D K+L Y   LHGKW F+EIR+IFSR++L +N ALEIF+ANR+AVMF FPD  TV+KV+  LPRVG+G  + + Q R+ SLA+PRQ+FK SNMTQRWQ REISNF+YLM+LNTIAGR+YNDLNQYP+FPWV+ NYESE +DL+ PSN+RDLS PIGALNP R  FF  RF++W+DD    FHYGTHYSTA+FVL +L+R+EPFTT FLNLQ GKFDHADRTF SV++ W+N QRDTSD+KELIPEF+YLPEMF N N+Y  G  +DG +V DV LP WAKT E+FVRINR ALESE VSCQLH WIDLIFGYKQ+GPEA+R+ NVF YLTYEG+VN + I DP++R+A+E QIRSFGQTPSQL+ EPHPPR SA+  SPLMFT     D++M+LKF SNSP+  + AN  P   + AV+TV+AN ++ VNKW+++ A                                  G +Q           D P+            QLP+ +DPL++  T  ++R + +  D  ++ H+  F  T DNR I   GFWDKSFR++S +TG+L+QVV+GH+ VV C+ARSE     +CYI++GS D T++LW W N + + +GD    E+A PR  +TGH  EI C  +  ELG+++S S++  CLIH++ G+LLR+L   ++ + P  +  SREG+ ++  +      +++NGK             L+  +E D           I A+ L++DG Y+    ++G V +R+  +L+ + +YP CDA I ++A++ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct: 2066 NLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPKILAYTEGLHGKWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFGLPQTRRISLATPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPSNFRDLSKPIGALNPKRAAFFAERFESWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSVSRAWRNSQRDTSDIKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEPHPPRGSAMQASPLMFTDQAQQDVIMVLKFPSNSPVTHVAANTQPGLAMPAVITVTANRLFAVNKWHNLPA--------------------------------HQGAVQ-----------DQPY------------QLPVEIDPLIACGTGTHRRQVTDLLDQSIQVHSQCFVITSDNRYILVCGFWDKSFRVYSTDTGKLIQVVFGHWDVVTCLARSESYIGGNCYILSGSRDATLLLWYW-NGKSSGIGDNPGGETATPRAILTGHDYEITCAAVCAELGLVLSGSQEGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGCFCTFSVNGK-------------LQATVETD---------DHIRAIQLSRDGQYLLTGGDNGVVIVRQVSDLKQLFAYPGCDAGIRAMALSFDQRCIISGMASGSIVLFYNDFNRWHHEYQTRY 2856          

HSP 2 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 407/981 (41.49%), Postives = 635/981 (64.73%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVY--EQYEQDHSDHPSYSNI 3308
             I +K+ +L GL++V ++  ++IV+ V  LLV G FD+E NF+I   + ++ M+++++  D   +AE+ S+F  +++KS  NL +  E   +EK L  ++  D M ADLL++MLG++AS++++V+ELK  F  L+G    WP H+ +LL+VL+ MP + GPD FFNFPG   +AIA+PPI++WPYQNG+TF+ W+ +DP + +N+D+DKPYLYCFRT+KGLGYS HFVG  L+IT++K K KG QHCVK++ +P++WYMV++V++YNRW  SE+RCY++GEL S  E+ W +NT++ FD+CF+G+S       +  GQ++ +Y F+++LN  QI AIY LG  YKG FKF+AE    L++  +   ++G+L  ++ F YNP A D QLCL  +PK N  +F HS HALM  +V+ VLT SI S +HS+GGV++LFPLF+QLD+        Q +S++V   I   L+  + ELL  S A++ Q++  KG L+I Y + +S+      S +  ++++LCL+ S+    +LS  QN                                                    + L+K + D++L N A+WIH   +VQL L+ +L+ +F+    ++N  R +  VL  ++++KYYYW VNP+DRSGI  K  +  P  N ++I ++R+ +  FIK+L++K  +GV ++E+Q  LNYL  ++EDDN+  VL   V LM+E P++M+PAFD ++G++VI+KLLAS  E +R+ ALK LG++L+    KRK + M+ H LF+L+ ERL+L +  +TM MYN L+EI+ E++  ++    H  PD T  ++NP +LKVIA L+R S    E ++VR+ FL+D+  L NNS+ENRR++LQ SVWQ+W+  L   +P+  D++++ + V  + R+LL+HA+K E+GGWRVW+DTL+I HSKV +   + ++  ++  EQ + D    P  S++
Sbjct:   43 GIRMKFAVLTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESIMCMVELLEKCDVTCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDSMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGQWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIARWPYQNGFTFHTWLRMDPVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFDFKPQKWYMVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQMTAVYLFSDALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSAIAFMYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLFAQLDYK-------QYLSDEVDLTICTTLLAFIMELLKNSIAMQEQMLACKGFLVIGYSLEKSS-----KSHVSRAVLELCLAFSK----YLSNLQN---------------------------------------------------GMPLLKQLCDHILLNPAVWIHTPAKVQLMLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLD-GPRPNQKEILSLRAFLLMFIKQLVMK-DSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMAEHPNSMIPAFDQRNGLRVIYKLLASKSEGIRVQALKALGYFLKHLAPKRKAEVMLGHGLFSLLAERLMLQTNLITMTMYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPQILKVIATLLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREEQRKGDEETGPCSSSL 954          

HSP 3 Score: 259.996 bits (663), Expect = 1.107e-67
Identity = 135/228 (59.21%), Postives = 169/228 (74.12%), Query Frame = 3
Query: 4929 PKSNFPSS-TSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQ-NEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTA 5600
            P    P++  S+T+RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLLCSQEWQNS+QK+AGLAFIELVNEGRLL+    DH VRVANEA FILSR RAED+ +H+EF  LCA    +++ EE++ +HLI +A+ RD   A +L  ++ +L+   HG W S   +   EF+RLDYWEDD RRRRRFV NP GSTHPEA L TA
Sbjct: 1789 PSHKTPAAHMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREEEKMCDHLIRAAKYRDHVTATQLIQKIINLLTDKHGAWGSSAVSRPREFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTA 2016          

HSP 4 Score: 214.927 bits (546), Expect = 5.067e-54
Identity = 128/300 (42.67%), Postives = 191/300 (63.67%), Query Frame = 3
Query: 3546 RSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPP-------DPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETN 4424
            RS  FRIP F WSQ+HQRLL DLL SIE+D+Q+W+  + + +++FVN+++N ++V N +HL++ + D+++  CGG+LPLL+AATS + +++ +E   G+++  +V FL R++++ D+++FASSL F E+E EK MS+GGILRQCLRLVC  AVRNCLE +           S L     + + SK   +L P        P+  +  G+    D        L   P        +   +  LRAVV+RD+E++KQAQFLAL++VYF+SVLMVS+YRD+LEP     S SL+ + +   N
Sbjct: 1297 RSTMFRIPEFKWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKNMSSGGILRQCLRLVCAVAVRNCLECQ---------QHSQLKARGDTAKSSKTIHSLIPMGKSAAKSPVDIVTGGISSVRD--------LDRLPA-------RTWTLIGLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEPQDERHSQSLKETSSDNGN 1572          
BLAST of Neurobeachin vs. UniProt/SwissProt
Match: sp|Q8NFP9|NBEA_HUMAN (Neurobeachin OS=Homo sapiens OX=9606 GN=NBEA PE=1 SV=3)

HSP 1 Score: 905.205 bits (2338), Expect = 0.000e+0
Identity = 433/874 (49.54%), Postives = 581/874 (66.48%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHV-----SPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            ++ GPV LSTPA L+AP V   G++SIT +E+YFE+D ++     +D KVL Y   LHGKW FSEIRA+FSR++L +N ALE+F+ANR +VMF FPDQ TV+KV+Y LPRVG+G  Y + Q R+ SLA+PRQ++K SNMTQRWQ+REISNF+YLM+LNTIAGRTYNDLNQYP+FPWVL NYESE +DL+ P N+RDLS PIGALNP R  F+  R++ W+DD    +HY THYSTA   L++LVR+EPFTT FLN   GKFDH DRTF SVA++W+  QRDTSDVKELIPEF+YLPEMF NSN Y  G  ED  +V+DV LP WAK PEDFVRINR ALESE VSCQLH WIDLIFGYKQRGPEA+R+ NVF YLTYEGSVN D I DP++R+A+E QI++FGQTPSQL+ EPHPPR+SA+H+     SPLMF   +  D++M+LKF SNSP+  + AN  P   + AV+TV+ + ++ VN+W++                   L GA                           S+D  H             LP+ MDPL++  + +NKR + +  D  ++ +   F  T DNR I   GFWDKSFR++S ETG+L Q+V+GH+ VV C+ARSE     DCYIV+GS D T++LW W  R H +  + N  +   PR  +TGH  E+VCV +  ELG+++S +K+  CL+HTI G+LLR+L   ++ + P  + +S EG+ ++  +      ++INGK             L   ME++ S           A+ L+ DG  +    ++G V + +  + + ++ YP CDA I ++ ++ DQR ++ G+ +G+IV FN+DFN+WH+E+++RY
Sbjct: 2147 NLAGPVVLSTPAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQATVKKVVYSLPRVGVGTSYGLPQARRISLATPRQLYKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEELDLTLPGNFRDLSKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVG----------------LRGAPGY------------------------SLDQAH------------HLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSINGK-------------LLAQMEINDST---------RAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQNRY 2946          

HSP 2 Score: 819.691 bits (2116), Expect = 0.000e+0
Identity = 415/962 (43.14%), Postives = 638/962 (66.32%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKV 3257
            NI +K+ +LIGLI+V ++  ++IV+ VL LLV G FD+E NF+I  ++ +  M ++++  D   +AE+ S+F  ++RKS  NL  + E   IE+ L  +   D M ADLL++MLG++AS+S++VKELK +F +L+G +  WP H+V+LL+VL QMP R GPD FFNFPG   +AIA+PPI+KWPYQNG+T N W  +DP + +N+D+DKPYLYCFRT+KG+GYS HFVG+ L++T++K K KG QHCVKY+ QPR+WYM+S+V++YNRW  SEIRCY++G+L+S  +M W +NTN+ +D+CF+G+S       +  GQ+  +Y F+E+LNP QI AI+ LGP YK  FKF++E   +L++  ++  ++G+L  S+ F YN  A D QLCL  +PK N  +F HS HALM  +V+ ++T SI+S +HS+GG+++LFPLF+QLD   R  ND Q     V   + A L+  L ELL  S A++ Q++  KG L+I Y + +S                     S++HI          A  +Q +S             +  +  +++G+                    L+K + D++L N A+WIH   +VQL L+ +L+ +F+    ++   R +  VLQ ++++KYYYW++NP D SGI  K  +  P  + ++I ++R+ +  F+K+L+LK   GV ++E+Q  LNYL  ++ED+NI  VL   V LMSE P++M+PAFD ++GI+VI+KLLAS  E++ + ALK+LG++L+   +KRK + M  H+LFTL+GERL+L++  +T+  YNTLYEI+TE++  ++    H  PD T  ++NP +LKV+A L++ S  + EL++VR++FL+D+  L +NS+ENRR +LQ SVWQDW+F L  ++P+  +++++ + V N+ R+LL+HA+K E+GGWRVW+DTL+I HSKV Y   +  + K+
Sbjct:   69 NIRMKFAVLIGLIQVGEVSNRDIVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMIADLLVDMLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHVNTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAKATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLD--NRQLNDSQ-----VETTVCATLLAFLVELLKSSVAMQEQMLGGKGFLVIGYLLEKS---------------------SRVHITR--------AVLEQFLSF------------AKYLDGLSHGA-------------------PLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATIYTTIRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLD-GPRPSQKEIISLRAFMLLFLKQLILK-DRGVKEDELQSILNYLLTMHEDENIHDVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTYNTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLGYINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKM 961          

HSP 3 Score: 269.24 bits (687), Expect = 1.697e-70
Identity = 139/251 (55.38%), Postives = 185/251 (73.71%), Query Frame = 3
Query: 4956 SLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVW-ASDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNK----SKTEIFKNTLKELNLKSN 5693
            S+T +LE+AL   APL+REIF DF+ +LSRTL+GSHGQEL+  GLV ++ STSVVE+VMLLCSQEWQNS+QK+AGLAFIEL+NEGRLL HA  DH VRVANEA FIL+R RAEDV KH+EF   CA    +R+ EE++ +HLI++A+ RD   AN+LK ++ +++ + HG W A   ++ ++F+RLDYWEDD RRRRRFV N +GSTH EA+L  A   G    ++ +K    S+  + +N   EL L+ +
Sbjct: 1883 SITAKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEFESQCAQYAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFWRLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIEYGTEEDVVKSKKTFRSQAIVNQNAETELMLEGD 2133          

HSP 4 Score: 243.817 bits (621), Expect = 1.000e-62
Identity = 141/284 (49.65%), Postives = 197/284 (69.37%), Query Frame = 3
Query: 3531 FSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLEN---GNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNY-PISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            FSPGPR+  FRIP F WS +HQRLL DLL ++E+D+ +W+  + +++++FVN+ EN ++V N +HL++ + D++I  CGG+LPLL+AATSP+G    LEN     GM+   AV FL R+M + D++VFASSLNF E+E EK MS+GG++RQCLRLVC  AVRNCLE R R        +     +H S++             QE+ + +   +      E +  N  PI DP+ LLQ++DINRLRAVV+RDV+++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1320 FSPGPRTTMFRIPEFKWSPMHQRLLTDLLFALETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTGSKTELENIEVTQGMSAETAVTFLSRLMAMVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQ------RDRGNKSSHGSSKP------------QEVPQSVTATAASKTPLENVPGNLSPIKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEP 1585          
BLAST of Neurobeachin vs. TrEMBL
Match: A0A5E4M0E7 (Uncharacterized protein OS=Cinara cedri OX=506608 GN=CINCED_3A011444 PE=4 SV=1)

HSP 1 Score: 1432.54 bits (3707), Expect = 0.000e+0
Identity = 795/1766 (45.02%), Postives = 1079/1766 (61.10%), Query Frame = 3
Query: 3399 EERPSQSVDLAESV------------AKMIIDDIVGTACDLVTESAVAQSNTENQ-IFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLR--PRS-DDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETNDQDRDKFEKLNHEKADVCATVEEEDEEIHYSQTENKTDTLXXXXXXXXXXXXXXXXNQXXXXXXXXXXXIYAREISFESDGRKSRIXXXXXXXXXXXXXXXXXXAAILDENENENEKTPPISSIQIDNHADNSSGRFQQFTSTLPQFPEQRVT-DNRKHEIIDRDDEDYPKSNFPSST-------SLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELV--SSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQN----EYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEPRSNEDNXXXXXXXXXXXXXXXXYKIPDNKDSNQNKISDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQT----TLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            EE+ +  V+LA+ V            +K I+ + +    D+ TE     SN + + +F+PGP   PFRIP F WS +HQRLL D+L S+ES++Q+W+  + +++L+FVN  EN ++V+N VHL++ LSD+LI  CGGLLPLLA+ATSP+ ++D++E   GM +  A   L R++N+AD++VFASSLNF ELE EK MS+GGILRQCLRLVCT AVRNCLE + R     L ++ N               N     +Q L+R  +  P+S  D   N       PI DPE LLQEMDINRLRAV+YRDVEE KQAQFL+L+IVYF+SVLMVS+YRD+LEP PT    S++   N  TN          N++        +EED     +  EN   T                          C+  I + E++  S    S +  N ++  +    S +   A  D N NE+ ++      +I           +     +P    Q V   N  H +   +D      N P  T       SLT +LE ALG   PL+REI  DF+ +LS+TL+GSHGQEL+    GL T + S SVVE+VMLLCSQEWQNSLQKHAGLAFIEL+NEGRLL+HA  DH VRVANEA FIL+RMRA+DV KH++F   CA    ER+ EE++ +HLI +AR RD  +A+++  ++ +++ + HG W           ++F++LD WEDD+RRR+RFV NP G+THPEA L  A+L   +P     +++ E+F          + +VA        M+++SG G    +L D                                     +   ++DD +               +  L  P+N        +ST A L++ GV   G VSIT +ELYFE+D ++     LD +VL Y  HLHGKW+FSEIRAIFSR++L +NIA+EIF+A+R +VMF+FPDQ TV++VI  LPRVG+GIKY + Q R++S+ SPRQ+ + SNMTQ+WQ+REISNF+YLM+LNTIAGRTYNDLNQYP+FPWVL NYES  +DL  PSNYRDLS PIGALNPSRK +F+ R+ +W+++S   FHYGTHYSTAAFVLN+L+R+EPFTT+FL LQ GKFDH +R F S+A +WKNCQRDTSDVKELIPE F+LPEM +N N+Y+ G  EDG  V +V LP WA +PE+F+RINR ALESE VSCQLH WIDLIFGYKQRGPEAIR++NVF YLTYEGSV+ D I DP++R+A+E+QIR FGQTPSQL+ EPH PR+SA+H+SP+MFT +  D+ M +KF SNSPI  ++AN  PQ P+ AV+TV+ N  + +N+WN                             S TIQ+               S  +SP           NV LPL MD +L+Q+     +  +R LG+ F   ++     F  T D+R +   GFWD SFR+FS ET +++Q+V+GH+GVV C++RSEC    DCYI +GS+DCTI+LW W  R   ++G+    +   PR T+TGH+  +  V IS ELG++VSAS     L+HT  G+LLRSL   + F +P   V+SREG I++  +  ++  +TINGK + H  ++D                      +I  M L++DG+Y+    + G V + R  NL L++++P CD+++ SL +T DQ+F+L GL  G+IVIF++D+N+WHHE++ RY
Sbjct: 1534 EEKETIPVELADCVVEINTENKSLETSKQILMNGIEDKKDMKTEKKPIASNIDTRPMFNPGPSRPPFRIPEFKWSYIHQRLLSDVLYSLESNIQVWRGHSTKSVLDFVNGAENAIFVVNTVHLISQLSDNLIIACGGLLPLLASATSPNSELDIMEPTQGMTVEVAASLLQRLVNMADVLVFASSLNFSELETEKNMSSGGILRQCLRLVCTNAVRNCLECKERSRLLVLPSQPN---------------NPKQLHLQSLIRAGQSSPKSLIDGSTN-------PIRDPEKLLQEMDINRLRAVIYRDVEETKQAQFLSLAIVYFVSVLMVSKYRDILEP-PT---ASIQMHGNAPTN----------NNQTRSESPPTDEEDYNTMMTSMENLNHT-------------------SQVSSTPCNKSICSEELASTSSAACSDVESNDTDAKASTIASVHNEEAWTDVNLNEDSQSNNEEDGRIHRDIRGDKPLSEISVVNVPSSSTQSVNMQNPGHNV---EDFSLKNVNLPHQTHLPNREASLTHKLEAALGSVCPLLREIMVDFAPFLSKTLVGSHGQELLMEGKGLTTFKNSQSVVELVMLLCSQEWQNSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFEAQCAQTTLERREEEKMCDHLITAARRRDSVVASRILDKICNILSNKHGAWGYLHETIPIRMSQFWKLDVWEDDARRRKRFVPNPRGTTHPEATL-KAALEHGAPQDAILQAREEVF---------HAQLVA--------MSTQSGPGSQSSDLLD-------------------------------------DSELMTDDRE--------------LDADLVGPVN--------ISTRAALISAGVVAPGIVSITSAELYFEVDEDDPEFKKLDPEVLKYCDHLHGKWYFSEIRAIFSRRYLLQNIAIEIFMASRTSVMFSFPDQNTVKRVIKALPRVGVGIKYGLPQTRRASMMSPRQLMRNSNMTQKWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESTEMDLGLPSNYRDLSKPIGALNPSRKAYFEERYGSWENESIPPFHYGTHYSTAAFVLNWLIRIEPFTTMFLALQGGKFDHPNRLFSSIALSWKNCQRDTSDVKELIPELFFLPEMLSNDNEYKLGYQEDGTSVGNVELPPWATSPEEFIRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAIRASNVFYYLTYEGSVDMDTITDPIMREAIENQIRCFGQTPSQLLMEPHLPRSSAMHISPMMFTSIPDDVCMTMKFPSNSPICHISANTFPQLPMPAVVTVTTNMQFAINRWN--------------------------TNYSVTIQSP--------------SYAESPQ--------QPNVNLPLVMDQILTQSNSNVNVTLRRHLGDNFSQKLKIKWNCFVTTVDSRFLIVCGFWDNSFRVFSTETAKIVQIVFGHYGVVTCLSRSECNITSDCYIASGSSDCTILLWHWNARSQTIVGE---GDHPTPRATLTGHEQPVTSVAISAELGLVVSASSGGPVLVHTTFGDLLRSLDPPNGFENPECAVMSREGIIVVNYEHGSIAAFTINGKRLRHTTHND----------------------NIQCMLLSRDGEYLMTGGDKGIVEVWRTFNLSLLYAFPACDSSVRSLGLTHDQKFLLAGLSTGSIVIFHIDYNRWHHEFQQRY 3091          

HSP 2 Score: 489.574 bits (1259), Expect = 4.419e-135
Identity = 247/525 (47.05%), Postives = 353/525 (67.24%), Query Frame = 3
Query:  438 IVDAVLYL----LVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAEC----PQN---------LSDSQRKSA-------------FEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKL 1922
            I+  +++L    LV G FDME NF+I  +Q + HML+++      L+AE+ SVFI ++RKS  NL    +   IE  +  L  AD + ADLLI+MLG++ASFS++VKELK +   +K  N  WP HS +LLNVL+QMP R+GPD FF+FPG  GSAI +PP++KWPY+NG+TF  W  LDP ++VNI+R+KPYLYCF+T+KG+GY+ HFVG+ LV+T+MK+K KG QHCVKY  QPR+WYM+++VY+YNRWTKSEI+C ++G+L S  EM W ++ NE FD+C+IGA+PE   + +  GQ+S IY F+E+L  HQI AI+ LGP YK  F+F+ EC    P+N         LS +Q                 ++G+L ++++F YNPVA D QLCL   PK N   F H+ HALM  +V+ V+T SI+STL+S+GG+++LFPLF+QLD S   P D +  S      I  +L+  + +++  S  ++  ++Q++G L+ISY + RS+    L  E+L S ++L
Sbjct:   87 IIQCLVFLKAFSLVGGEFDMELNFIIQDAQNIRHMLELLDHCPPNLQAEIWSVFIAILRKSVRNLQACTDVGLIELVVNRLARADTVVADLLIDMLGVLASFSITVKELKLLLGSMKAINGKWPKHSTKLLNVLRQMPQRNGPDVFFSFPGKKGSAIVLPPLAKWPYENGFTFCTWFRLDPINSVNIEREKPYLYCFKTSKGVGYTAHFVGNCLVLTSMKIKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCVVNGQLASSTEMAWFVSANEPFDKCYIGATPELDEDRVFCGQMSAIYLFSEALTTHQICAIHRLGPGYKCQFRFDNECHLSLPENHKRVSEFKSLSQTQNTDISRMPQHAVDSSVLYDGKLSNAIVFMYNPVATDGQLCLQSTPKGNASYFVHTPHALMLQDVKAVITHSIHSTLNSVGGIQVLFPLFAQLDLSAE-PKDKKDAS------ICWKLLGFICDMVETSQTVQQHMIQNRGFLVISYMLQRSSRD-HLTLEVLGSFLRL 603          

HSP 3 Score: 380.948 bits (977), Expect = 5.927e-102
Identity = 191/399 (47.87%), Postives = 288/399 (72.18%), Query Frame = 3
Query: 2136 LVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINT 3332
            L+K + D++L N  +WI+    VQ +L+ +LA +FLS+  +++  R ++ VLQ ++++KYYYW+VNPR++SGI+ K  +  P    + I  IR  I  F+K+LM+    G+ ++E+Q  +NYLT V ED+N+  VL   ++LMSEQP++M+PAFD KHG++ +FKL+AS  + +R+ ALKLLGF+L RST+KRK D M P NL+TL+ ERL+L    +T+  YN LYEI+TE+++ +I  T H  PD    LENP +LKV+A LIRQ+K +++LL+V+K+FL+D+  LC+N++ENRRTVLQMSVWQ+WL  +  + P+T +++++ D V NL  +LLHHA+K EYGGWRVW+DTLAI+HSKV++ EF+     +YE YE+  SD+ +   ++ Q  I+T
Sbjct:  618 LLKQLLDHILFNPGLWIYTPTHVQTRLYTYLATEFLSDTQIYSNVRRVSTVLQTVHTLKYYYWVVNPRNKSGIIPKGLD-GPRPAQKDILIIRGYILLFLKQLMM-LGVGLKEDELQSIINYLTTVCEDENLHDVLQTLMSLMSEQPASMIPAFDVKHGVRCVFKLVASESQLIRLQALKLLGFFLSRSTHKRKYDVMSPFNLYTLLSERLMLNEETITLPTYNVLYEILTERISQQILYTRHPEPDSNCRLENPMILKVVATLIRQAKPSEQLLEVKKLFLSDMTILCSNNRENRRTVLQMSVWQEWLIAMAYIHPRTCEEQKVSDMVYNLFTMLLHHAIKHEYGGWRVWVDTLAIVHSKVSFEEFKLQFALMYEHYERQRSDNITDPRLRQQRPIST 1014          
BLAST of Neurobeachin vs. TrEMBL
Match: A0A182R220 (Uncharacterized protein OS=Anopheles funestus OX=62324 PE=4 SV=2)

HSP 1 Score: 1224.15 bits (3166), Expect = 0.000e+0
Identity = 599/1224 (48.94%), Postives = 809/1224 (66.09%), Query Frame = 3
Query: 4953 TSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELV--SSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNE--FYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEPRSNEDNXXXXXXXXXXXXXXXXYKIPDNKDSNQNKISDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQ------TTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
             SLT++LE ALG   PL+REI  DF+ +LS+TL+GSHGQEL+    GL T + S SVVE+VMLLCSQEWQNSLQKHAGLAFIEL+NEGRLL+HA  DH VRVANEA FIL+RMRA+DV KH++F   CA    ER+ EER+ +HLI +AR RD+ +A++L  +V +++ + HG W      Y +  F++LD WEDD+RRR+R V NP GS+HP+A L  +  +G +       +   +   T + +  ++    G              GV  EE++ ++ + PRS +                     PD  D ++  I D                       + +++D+TGPV +ST A L+APG+   G++SIT +E+YFE+D  N     +DQ+VL Y  HLHGKW+FSEIRAIFSR++L +N+ALEIF+A+R +++FAFPDQ TV+KVI  LPRVG+GIKY + Q R++S+ SPRQ+ + SNMTQ+WQ+REISNF+YLM+LNTIAGRTYNDLNQYP+FPWV+ NYES  +DLS PSNYRDLS PIGALNPSR+++F+ R++ WD      FHYGTHYSTAAFVLN+L+R+EPFTT+FL LQ GKFDH DR F SVA +WKNCQRDTSDVKELIPE+++LPEMF N++DYR G+ +DG+ V DV LP WAKTPE+FVRINR ALESE VSCQLH WIDLIFGYKQRGPEA+R+TNVF YLTYEGSV+ D I DP+ R A+E+QIR+FGQTPS L+ EPHPPR+SA+H+SP+MF  +  D+ M LKF  NSPI+ ++AN +PQ PL +V+TV+A + + VN+WN       + P  A+++                       NM                          N  LPL+MDPLLSQ      +   N+R LG+ F   ++  +  +  T D+R + A GFWD SFR+FS ET +++Q+++GHFGVV C++RSEC    DCYI +GS DCTI+LW W  R  +++G+    E   PR T+TGH+  +  V IS ELG++VS S +   L+HT  G+LLRSL     F+ P  + +SREG+I++     +V  YTINGK + +  ++D                      ++  M L++DG+Y+  + N G V + R  NL  ++++P C++ I SLA+T DQ+++L GL  G+I++F++DFN+WHHEY+ RY
Sbjct: 2210 ASLTQKLEIALGPVCPLLREIMVDFAPFLSKTLVGSHGQELLMEGKGLTTFKNSHSVVELVMLLCSQEWQNSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFESQCAQTLLERREEERMCDHLITAARRRDNVIASRLLEKVRNIMGNRHGAWGDMNANYQKQIFWKLDAWEDDARRRKRMVQNPRGSSHPQATLKASLENGTAVATGSTATSGTVSSGTDEAVGAETTAPGGAR----------PAGVAREEIY-SQIAVPRSQQ---------------------PDLLDDSELLIED-----------------------RELDLDLTGPVNISTKAKLIAPGLVAPGTMSITSTEMYFEVDEENGEFQQIDQEVLKYCDHLHGKWYFSEIRAIFSRRYLLQNVALEIFLASRTSILFAFPDQHTVKKVIKALPRVGVGIKYGIPQTRRASMMSPRQLMRNSNMTQKWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVITNYESRELDLSQPSNYRDLSKPIGALNPSRREYFEERYETWDTPGIPPFHYGTHYSTAAFVLNWLIRIEPFTTMFLALQGGKFDHPDRLFSSVALSWKNCQRDTSDVKELIPEWYFLPEMFYNASDYRLGQRDDGSTVGDVDLPPWAKTPEEFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAMRATNVFYYLTYEGSVDLDTIGDPVTRDAIENQIRNFGQTPSLLLMEPHPPRSSAMHLSPMMFNTMPDDVCMSLKFHLNSPIIHISANTYPQLPLPSVVTVTAGHQFAVNRWNCQYTASIQSPSYAESTQ----------------------NM--------------------------NANLPLTMDPLLSQINGHNSSNQQNRRHLGDNFSQKLQIKSNCYVTTVDSRFLIACGFWDNSFRVFSTETAKIVQIIFGHFGVVTCLSRSECNITSDCYIASGSADCTILLWHWNARTQSIVGE---GEIPTPRATLTGHETAVTSVVISAELGLVVSGSINGPVLVHTTFGDLLRSLEAPKDFISPENITLSREGFIVVNYDEGSVAAYTINGKLLRYESHND----------------------NLQCMLLSRDGEYLMTAGNKGIVEVWRTFNLAPLYAFPACNSGIRSLALTHDQKYLLAGLATGSIIVFHIDFNRWHHEYQQRY 3305          

HSP 2 Score: 481.871 bits (1239), Expect = 1.135e-132
Identity = 262/621 (42.19%), Postives = 399/621 (64.25%), Query Frame = 3
Query: 1470 FEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINT 3332
            ++G+L  +++F YNPVA D QLCL  APK N   F H+ H+LM  +V+ V+T SI+ TL+S+GG+++LFPLFSQLD    +P +G  +  D  P + A+L+  + EL+  S  ++  ++Q++G L+IS+ + RS+    L+ ++L S     LSL++  +  LS      A +D L+                                            +L+ HV    L N ++WI+    VQ +L+ +LA +FLS+  +++  R ++ VLQ ++++K+YYW+VNPR +SGI  K  +  P    + I  IR+ I  F+K+L++   NGV D+E+Q  LNYL  ++ED+N+  VL   ++LMSE PS+MVPAFD KHG++ IFKLLA+  + +R+ ALKLLGF+L RST+KRK D M PHNL+TL+ ERLLLY   +++  YN LYEIMTE ++ +I    H  P+  + LENP +LKV+A LIRQSK +++L++V+K+FL+D+  LCNN++ENRRTVLQMSVWQ+WL  +  + P+  +++++ D V +L R+LLHHA+K EYGGWRVW+DTLAI+HSKV+Y EF+    ++YE YE+  +D+ +   ++ Q  I+T
Sbjct:  476 YDGKLSSAIVFMYNPVATDGQLCLQSAPKGNLSYFVHTPHSLMLQDVKAVVTHSIHCTLNSIGGIQVLFPLFSQLD----MPYEGTDVRKD--PTLCAKLLGFICELVESSQTVQQHMIQNRGFLVISFMLQRSSRD-HLSLDVLGSF----LSLTKYLVTCLS------ANSDLLLK-------------------------------------------QLLDHV----LFNPSLWIYTPATVQARLYAYLATEFLSDTQIYSNVRRVSTVLQTVHTLKFYYWVVNPRAKSGITPKGLD-GPRPAQKDILAIRAYILLFLKQLIM-IGNGVKDDELQSILNYLMTMHEDENLHDVLQMLISLMSEHPSSMVPAFDVKHGVRTIFKLLAAESQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLYTLLAERLLLYEESVSLPTYNVLYEIMTEHISQQILYAKHPEPESHYRLENPMILKVVATLIRQSKQSEQLIEVKKLFLSDMTLLCNNNRENRRTVLQMSVWQEWLIAMAYIHPKNSEEQKLSDMVYSLFRMLLHHAIKYEYGGWRVWVDTLAIVHSKVSYEEFKLQFAQMYEHYEKHRTDNITDPALRQQRPIST 1030          

HSP 3 Score: 424.091 bits (1089), Expect = 4.725e-115
Identity = 198/379 (52.24%), Postives = 282/379 (74.41%), Query Frame = 3
Query:  360 SMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSL 1496
            SM +N+  K+ +LIGLI+V Q+  +E+V+ VL+LLV G FDME NF++  +Q V HML+++    + L+AE+ SVFI +++KS  NL    E   IE  L  L+ A+ + ADLLIEMLG++AS+S++VKELK +F  +K  N  WP HS +LLNVL+QMP R+GPD FF+FPG  GSAI +PP++KWPY+NG+TF+ W  LDP ++VNI+R+KPYLYCF+T+KG+GY+ HFVG+ LV+T+MK+K KG QHCVKY  QPR+WYM+++VY+YNRWTKSEI+C ++G+L S  EM W ++TN+ FD+C++GA+PE   E +  GQ++ IY F+E+L   QI A++ LGP YK  F+F+ EC  NL D+ ++ +    +  SL
Sbjct:   22 SMTDNL--KFAVLIGLIEVGQVSNREVVNTVLHLLVGGEFDMELNFVVQDAQNVKHMLELLDHCPANLQAEVWSVFIAILKKSVRNLQACTEIGLIEHVLARLQQAEPIVADLLIEMLGVLASYSITVKELKLLFGAMKAVNGKWPRHSAKLLNVLKQMPHRNGPDVFFSFPGRKGSAIVLPPLAKWPYENGFTFSTWFRLDPINSVNIEREKPYLYCFKTSKGVGYTAHFVGNCLVLTSMKVKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCLVNGQLASSTEMAWLVSTNDPFDKCYVGATPELDEERVFCGQMAAIYLFSEALTTQQICAMHRLGPGYKSQFRFDNECYLNLPDNHKRVSEAKAIISSL 398          

HSP 4 Score: 287.345 bits (734), Expect = 1.884e-73
Identity = 157/289 (54.33%), Postives = 211/289 (73.01%), Query Frame = 3
Query: 3504 AQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            ++S +   +FSPGP   PFRIP F WS +HQRLL D+L S+E+D+Q+W+  + +++L+FVN+ EN ++V+N VHL++ L+D+LI  CGGLLPLLA+ATSP+ ++D+LE   GM +  AV FL R++N+AD+++FASSLNF ELE EK MS+GGILRQCLRLVCTCAVRNCLE + R     L+N  +L +                  +Q L+RG +  S  + +  L     P+ DPE LLQ+MDINRLRAV+YRDVEE KQAQFL+L+IVYF+SVLMVS+YRD+LEP
Sbjct: 1630 SKSASTRPMFSPGPTRPPFRIPEFKWSYIHQRLLSDVLFSLETDIQVWRSHSTKSVLDFVNSAENAIFVVNTVHLISQLADNLIIACGGLLPLLASATSPNSELDVLEPTQGMPLDVAVSFLQRLVNMADVLIFASSLNFSELEAEKNMSSGGILRQCLRLVCTCAVRNCLECKERT--RGLYNGMSLKDIPGGVH------------LQALIRGAQSTSKTI-IESLSGPMSPVKDPEKLLQDMDINRLRAVIYRDVEETKQAQFLSLAIVYFISVLMVSKYRDILEP 1903          
BLAST of Neurobeachin vs. TrEMBL
Match: A0A182QU66 (Uncharacterized protein OS=Anopheles farauti OX=69004 PE=4 SV=1)

HSP 1 Score: 1223.76 bits (3165), Expect = 0.000e+0
Identity = 600/1226 (48.94%), Postives = 806/1226 (65.74%), Query Frame = 3
Query: 4953 TSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELV--SSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNE--FYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEPRSNEDNXXXXXXXXXXXXXXXXYKIPDNKDSNQNKISDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSP-HPDKLHNYVSSNVQLPLSMDPLLSQ-------TTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
             SLT++LE ALG   PL+REI  DF+ +LS+TL+GSHGQEL+    GL T + S SVVE+VMLLCSQEWQNSLQKHAGLAFIEL+NEGRLL+HA  DH VRVANEA FIL+RMRA+DV KH++F   CA    ER+ EER+ +HLI +AR RD+ +A++L  +V +++ + HG W      Y +  F++LD WEDD+RRR+R V NP GS+HP+A L  +  +G           T                     +  +T  S    GV  EE++ ++ + PRS +                     PD  D ++  I D                       + +++D+TGPV +ST A L+APG+   G++SIT +E+YFE+D  N     +DQ+VL Y  HLHGKW+FSEIRAIFSR++L +N+ALEIF+A+R +++FAFPDQ TV+KVI  LPRVG+GIKY + Q R++S+ SPRQ+ + SNMTQ+WQ+REISNF+YLM+LNTIAGRTYNDLNQYP+FPWV+ NYES  +DLS PSNYRDLS PIGALNPSR+++F+ R++ WD      FHYGTHYSTAAFVLN+L+R+EPFTT+FL LQ GKFDHADR F SV  +WKNCQRDTSDVKELIPE+++LPEMF N+++YRFG+ +DG+ V DV LP WAKTPE+FVRINR ALESE VSCQLH WIDLIFGYKQRGPEA+R+TNVF YLTYEGSV+ D I DP+ R A+E+QIR+FGQTPS L+ EPHPPR+SA+H+SP+MF  +  D+ M LKF  NSPI+ ++AN +PQ PL +V+TV+A + + VN+W                                              N    +S+ SP + +   N    N  LPL+MDPLLSQ       +   N+R LG+ F   ++  +  +  T D+R + A GFWD SFR+FS ET +++Q+++GHFGVV C++RSEC    DCYI +GS DCTI+LW W  R  +++G+    E   PR T+TGH+  +  V IS ELG++VS S +   L+HT  G+LLRSL     F+ P  + +SREG+I++     +V  YTINGK + +  ++D                      ++  M L++DG+Y+  + N G V + R  NL  ++++P C++ I SLA+T DQ+++L GL  G+I++F++DFN+WHHEY+ RY
Sbjct: 2191 ASLTQKLEIALGPVCPLLREIMVDFAPFLSKTLVGSHGQELLMEGKGLTTFKNSHSVVELVMLLCSQEWQNSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFESQCAQTLLERREEERMCDHLITAARRRDNVIASRLLEKVRNIMGNRHGAWGDMNANYQKQIFWKLDAWEDDARRRKRMVQNPRGSSHPQATLKASLENGGGVAASTATPATGAATTATGSSVATPGGTGDEPLEPDTTASRRASGVGREEIY-SQIAVPRSQQ---------------------PDLLDDSELLIED-----------------------RELDLDLTGPVNISTKAKLIAPGLVAPGTMSITSTEMYFEVDEENGEFQTIDQEVLKYCDHLHGKWYFSEIRAIFSRRYLLQNVALEIFLASRTSILFAFPDQHTVKKVIKALPRVGVGIKYGIPQTRRASMMSPRQLMRNSNMTQKWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVITNYESRELDLSQPSNYRDLSKPIGALNPSRREYFEERYETWDTPGIPPFHYGTHYSTAAFVLNWLIRIEPFTTMFLALQGGKFDHADRLFSSVGLSWKNCQRDTSDVKELIPEWYFLPEMFYNASEYRFGQRDDGSTVGDVELPPWAKTPEEFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAMRATNVFYYLTYEGSVDLDTIGDPVTRDAIENQIRNFGQTPSLLLMEPHPPRSSAMHLSPMMFNTMPDDVCMSLKFHLNSPIIHISANTYPQLPLPSVVTVTAGHQFAVNRW----------------------------------------------NCQYTASIQSPSYAESTQNL---NANLPLTMDPLLSQINGHSSSSNQQNRRHLGDNFSQKLQIKSNCYVTTVDSRFLIACGFWDNSFRVFSTETAKIVQIIFGHFGVVTCLSRSECNITSDCYIASGSADCTILLWHWNARTQSIVGE---GEIPTPRATLTGHETAVTSVVISAELGLVVSGSINGPVLVHTTFGDLLRSLEAPKDFISPENITLSREGFIVVNYDEGSVAAYTINGKLLRYETHND----------------------NLQCMLLSRDGEYLMTAGNKGIVEVWRTFNLAPLYAFPACNSGIRSLALTHDQKYLLAGLATGSIIVFHIDFNRWHHEYQQRY 3297          

HSP 2 Score: 480.33 bits (1235), Expect = 3.405e-132
Identity = 262/621 (42.19%), Postives = 397/621 (63.93%), Query Frame = 3
Query: 1470 FEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINT 3332
            ++G+L   ++F YNPVA D QLCL  APK N   F H+ H+LM  +V+ V+T SI+ TL+S+GG+++LFPLFSQLD    +P +G  +  D  P + A+L+  + EL+  S  ++  ++Q++G L+IS+ + RS+    L+ ++L S     LSL++  +  LS      A +D L+                                            +L+ HV    L N ++WI+    VQ +L+ +LA +FLS+  +++  R ++ VLQ ++++K+YYW+VNPR +SGI  K  +  P    + I  IR+ I  F+K+L++   NGV D+E+Q  LNYL  ++ED+N+  VL   ++LMSE PS+MVPAFD KHG++ IFKLLA+  + +R+ ALKLLGF+L RST+KRK D M PHNL+TL+ ERLLLY   +++  YN LYEIMTE ++ +I    H  P+  + LENP +LKV+A LIRQSK + +L++V+K+FL+D+  LCNN++ENRRTVLQMSVWQ+WL  +  + P+  +++++ D V +L R+LLHHA+K EYGGWRVW+DTLAI+HSKV+Y EF+    ++YE YE+  +D+ +   ++ Q  I+T
Sbjct:  482 YDGKLSSGIVFMYNPVATDGQLCLQSAPKGNLSYFVHTPHSLMLQDVKAVVTHSIHCTLNSIGGIQVLFPLFSQLD----MPYEGTDVRKD--PTLCAKLLGFICELVESSQTVQQHMIQNRGFLVISFMLQRSSRD-HLSLDVLGSF----LSLTKYLVTCLS------ANSDLLLK-------------------------------------------QLLDHV----LFNPSLWIYTPATVQARLYAYLATEFLSDTQIYSNVRRVSTVLQTVHTLKFYYWVVNPRAKSGITPKGLD-GPRPAQKDILAIRAYILLFLKQLIM-IGNGVKDDELQSILNYLMTMHEDENLHDVLQMLISLMSEHPSSMVPAFDVKHGVRTIFKLLAAESQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLYTLLAERLLLYEESVSLPTYNVLYEIMTEHISQQILYAKHPEPESHYRLENPMILKVVATLIRQSKQSDQLIEVKKLFLSDMTLLCNNNRENRRTVLQMSVWQEWLIAMAYIHPKNTEEQKLSDMVYSLFRMLLHHAIKYEYGGWRVWVDTLAIVHSKVSYEEFKLQFAQMYEHYEKHRTDNITDPALRQQRPIST 1036          

HSP 3 Score: 423.705 bits (1088), Expect = 6.066e-115
Identity = 196/368 (53.26%), Postives = 278/368 (75.54%), Query Frame = 3
Query:  360 SMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRK 1463
            SM +N+  K+ +LIGLI+V Q+  +E+V+ VL+LLV G FDME NF++  +Q V HML+++    + L+AE+ SVFI +++KS  NL    E   IE  L  L+ A+ + ADLLIEMLG++AS+S++VKELK +F  +K  N  WP HS +LLNVL+QMP R+GPD FF+FPG  GSAI +PP++KWPY+NG+TF+ W  LDP ++VNI+R+KPYLYCF+T+KG+GY+ HFVG+ LV+T+MK+K KG QHCVKY  QPR+WYM+++VY+YNRWTKSEI+C ++G+L S  EM W ++TN+ FD+C++GA+PE   E +  GQ++ IY F+E+L   QI A++ LGP YK  F+F+ EC  NL D+ ++
Sbjct:   22 SMTDNL--KFAVLIGLIEVGQVSNREVVNTVLHLLVGGEFDMELNFVVQDAQNVKHMLELLDHCPANLQAEVWSVFIAILKKSVRNLQACTEIGLIEHVLARLQQAEPIVADLLIEMLGVLASYSITVKELKLLFGAMKAVNGKWPRHSAKLLNVLKQMPHRNGPDVFFSFPGRKGSAIVLPPLAKWPYENGFTFSTWFRLDPINSVNIEREKPYLYCFKTSKGVGYTAHFVGNCLVLTSMKVKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCLVNGQLASSTEMAWLVSTNDPFDKCYVGATPELDEERVFCGQMAAIYLFSEALTTQQICAMHRLGPGYKSQFRFDNECYLNLPDNHKR 387          

HSP 4 Score: 282.337 bits (721), Expect = 6.435e-72
Identity = 158/299 (52.84%), Postives = 212/299 (70.90%), Query Frame = 3
Query: 3495 SAVAQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDV-------EEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            +A  +S +   +FSPGP   PFRIP F WS +HQRLL D+L S+E+D+Q+W+  + +++L+FVN+ EN ++V+N VHL++ L+D+LI  CGGLLPLLA+ATSP+ ++D+LE   GM +  AV FL R++N+AD+++FASSLNF ELE EK MS+GGILRQCLRLVCTCAVRNCLE + R     L+N  +L +                  +Q L+RG +  S  + +  L     P+ DPE LLQ+MDINRLRAV+YRDV       EE KQAQFL+L+IVYF+SVLMVS+YRD+LEP
Sbjct: 1548 AASGKSASTRPMFSPGPTRPPFRIPEFKWSYIHQRLLSDVLFSLETDIQVWRSHSTKSVLDFVNSAENAIFVVNTVHLISQLADNLIIACGGLLPLLASATSPNSELDVLEPTQGMPLDVAVSFLQRLVNMADVLIFASSLNFSELEAEKNMSSGGILRQCLRLVCTCAVRNCLECKERT--RGLYNGMSLKDIPGGVH------------LQALIRGAQSTSKTI-IESLAGPMSPVKDPEKLLQDMDINRLRAVIYRDVLKKRLFQEETKQAQFLSLAIVYFISVLMVSKYRDILEP 1831          
BLAST of Neurobeachin vs. TrEMBL
Match: A0A453YNR8 (Uncharacterized protein OS=Anopheles gambiae OX=7165 PE=4 SV=1)

HSP 1 Score: 1221.07 bits (3158), Expect = 0.000e+0
Identity = 602/1230 (48.94%), Postives = 811/1230 (65.93%), Query Frame = 3
Query: 4953 TSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELV--SSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNE--FYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSES-----GYGVTDEELFDAEKSEPRSNEDNXXXXXXXXXXXXXXXXYKIPDNKDSNQNKISDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSP-HPDKLHNYVSSNVQLPLSMDPLLSQ------TTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
             SLT++LE ALG   PL+REI  DF+ +LS+TL+GSHGQEL+    GL T + S SVVE+VMLLCSQEWQNSLQKHAGLAFIEL+NEGRLL+HA  DH VRVANEA FIL+RMRA+DV KH++F   CA    ER+ EER+ +HLI +AR RD+ +A++L  +V +++ + HG W      Y +  F++LD WEDD+RRR+R V NP GS+HP+A L  +  +G +         T     +       ++    V   D T  + +     G GV  EE++ ++ + PRS +                     PD  D ++  I D                       + +++D+TGPV +ST A L+APG+   G++SIT +E+YFE+D  N     +DQ+VL Y  HLHGKW+FSEIRAIFSR++L +N+ALEIF+A+R +++FAFPDQ TV+KVI  LPRVG+GIKY + Q R++S+ SPRQ+ + SNMTQ+WQ+REISNF+YLM+LNTIAGRTYNDLNQYP+FPWV+ NYES  +DLS PSNYRDLS PIGALNPSR+++F+ R++ WD      FHYGTHYSTAAFVLN+L+R+EPFTT+FL LQ GKFDH DR F SVA +WKNCQRDTSDVKELIPE+++LPEMF N++DYR G+ +DG+ V DV LP WAKTPE+FVRINR ALESE VSCQLH WIDLIFGYKQRGPEA+R+TNVF YLTYEGSV+ D I DP+ R A+E+QIR+FGQTPS L+ EPHPPR+SA+H+SP+MF  +  D+ M LKF  NSPI+ ++AN +PQ PL +V+TV+A + + VN+W                                              N    +S+ SP + +   N    N  LPL+MDPLLSQ      +   N+R LG+ F   ++  +  +  T D+R + A GFWD SFR+FS ET +++Q+++GHFGVV C++RSEC    DCYI +GS DCTI+LW W  R  +++G+    E   PR T+TGH+  +  V IS ELG++VS S +   L+HT  G+LLRSL     F+ P  + +SREG+I++     +V  YTINGK + +  ++D                      ++  M L++DG+Y+  + N G V + R  NL  ++++P C++ I SLA+T DQ+++L GL  G+I++F++DFN+WHHEY+ RY
Sbjct: 2097 ASLTQKLEIALGPVCPLLREIMVDFAPFLSKTLVGSHGQELLMEGKGLTTFKNSHSVVELVMLLCSQEWQNSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFESQCAQTLLERREEERMCDHLITAARRRDNVIASRLLEKVRNIMGNRHGAWGDMNANYQKQIFWKLDAWEDDARRRKRMVQNPRGSSHPQATLKASLENGTT-------GGTVAAATSSTASTAATSADEAVGSGDTTTPTSARLAGGGGGVAREEIY-SQIAVPRSQQ---------------------PDLLDDSELLIED-----------------------RELDLDLTGPVNISTKAKLIAPGLVAPGTMSITSTEMYFEVDEENGEFQQIDQEVLKYCDHLHGKWYFSEIRAIFSRRYLLQNVALEIFLASRTSILFAFPDQHTVKKVIKALPRVGVGIKYGIPQTRRASMMSPRQLMRNSNMTQKWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVITNYESRELDLSQPSNYRDLSKPIGALNPSRREYFEERYETWDTPGIPPFHYGTHYSTAAFVLNWLIRIEPFTTMFLALQGGKFDHPDRLFSSVALSWKNCQRDTSDVKELIPEWYFLPEMFYNASDYRLGQRDDGSTVGDVELPPWAKTPEEFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAMRATNVFYYLTYEGSVDLDTIGDPVTRDAIENQIRNFGQTPSLLLMEPHPPRSSAMHLSPMMFNTMPDDVCMSLKFHLNSPIIHISANTYPQLPLPSVVTVTAGHQFAVNRW----------------------------------------------NCQYTASIQSPSYAESTQNL---NANLPLTMDPLLSQINGHNNSNQQNRRHLGDNFSQKLQIKSNCYVTTVDSRFLIACGFWDNSFRVFSTETAKIVQIIFGHFGVVTCLSRSECNITSDCYIASGSADCTILLWHWNARTQSIVGE---GEIPTPRATLTGHETAVTSVVISAELGLVVSGSINGPVLVHTTFGDLLRSLEAPKDFISPENITLSREGFIVVNYDEGSVAAYTINGKLLRYESHND----------------------NLQCMLLSRDGEYLMTAGNKGIVEVWRTFNLAPLYAFPACNSGIRSLALTHDQKYLLAGLATGSIIVFHIDFNRWHHEYQQRY 3200          

HSP 2 Score: 463.381 bits (1191), Expect = 5.235e-127
Identity = 257/621 (41.38%), Postives = 392/621 (63.12%), Query Frame = 3
Query: 1470 FEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINT 3332
            ++G+L  +++F YNPVA D QLCL  APK N   F H+ H+LM  +V+ V+T SI+ TL+S+GG+++LFPLFSQLD    +P +G  +  D  P +    ++     +  S   +  ++Q++G L+IS+ + RS+    L+ ++L S     LSL++  +  LS      A +D L+                                            +L+ HV    L N ++WI+    VQ +L+ +LA +FLS+  +++  R ++ VLQ ++++K+YYW+VNPR +SGI  K  +  P    + I  IR+ I  F+K+L++   NG  D+E+Q  LNYL  ++ED+N+  VL   ++LMSE PS+MVPAFD KHG++ IFKLLA+  + +R+ ALKLLGF+L RST+KRK D M PHNL+TL+ ERLLLY   +++  YN LYEIMTE ++ +I    H  P+  + LENP +LKV+A LIRQSK +++L++V+K+FL+D+  LCNN++ENRRTVLQMSVWQ+WL  +  + P+  +++++ D V +L R+LLHHA+K EYGGWRVW+DTLAI+HSKV+Y EF+    ++YE YE+  +D+ +   ++ Q  I+T
Sbjct:  473 YDGKLSSAIVFMYNPVATDGQLCLQSAPKGNLSYFVHTPHSLMLQDVKAVVTHSIHCTLNSIGGIQVLFPLFSQLD----MPYEGTDVRKD--PTL---CLDSFANWVESSQTGQQHMIQNRGFLVISFMLQRSSRD-HLSLDVLGSF----LSLTKYLVTCLS------ANSDLLLK-------------------------------------------QLLDHV----LFNPSLWIYTPATVQARLYAYLATEFLSDTQIYSNVRRVSTVLQTVHTLKFYYWVVNPRAKSGITPKGLD-GPRPAQKDILAIRAYILLFLKQLIM-IGNGAKDDELQSILNYLMTMHEDENLHDVLQMLISLMSEHPSSMVPAFDVKHGVRTIFKLLAAESQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLYTLLAERLLLYEESVSLPTYNVLYEIMTEHISQQILYAKHPEPESHYRLENPMILKVVATLIRQSKQSEQLIEVKKLFLSDMTLLCNNNRENRRTVLQMSVWQEWLIAMAYIHPKNSEEQKLSDMVYSLFRMLLHHAIKYEYGGWRVWVDTLAIVHSKVSYEEFKLQFAQMYEHYEKHRTDNITDPALRQQRPIST 1024          

HSP 3 Score: 424.091 bits (1089), Expect = 5.229e-115
Identity = 196/368 (53.26%), Postives = 278/368 (75.54%), Query Frame = 3
Query:  360 SMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRK 1463
            SM +N+  K+ +LIGLI+V Q+  +E+V+ VL+LLV G FDME NF++  +Q V HML+++    + L+AE+ SVFI +++KS  NL    E   IE  L  L+ A+ + ADLLIEMLG++AS+S++VKELK +F  +K  N  WP HS +LLNVL+QMP R+GPD FF+FPG  GSAI +PP++KWPY+NG+TF+ W  LDP ++VNI+R+KPYLYCF+T+KG+GY+ HFVG+ LV+T+MK+K KG QHCVKY  QPR+WYM+++VY+YNRWTKSEI+C ++G+L S  EM W ++TN+ FD+C++GA+PE   E +  GQ++ IY F+E+L   QI A++ LGP YK  F+F+ EC  NL D+ ++
Sbjct:   22 SMTDNL--KFAVLIGLIEVGQVSNREVVNTVLHLLVGGEFDMELNFVVQDAQNVKHMLELLDHCPANLQAEVWSVFIAILKKSVRNLQACTEIGLIEHVLARLQQAEPIVADLLIEMLGVLASYSITVKELKLLFGAMKAVNGKWPRHSAKLLNVLKQMPHRNGPDVFFSFPGRKGSAIVLPPLAKWPYENGFTFSTWFRLDPINSVNIEREKPYLYCFKTSKGVGYTAHFVGNCLVLTSMKVKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCLVNGQLASSTEMAWLVSTNDPFDKCYVGATPELDEERVFCGQMAAIYLFSEALTTQQICAMHRLGPGYKSQFRFDNECYLNLPDNHKR 387          

HSP 4 Score: 288.115 bits (736), Expect = 1.102e-73
Identity = 163/321 (50.78%), Postives = 224/321 (69.78%), Query Frame = 3
Query: 3504 AQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSV-NRETNDQDRDKFEKLNHE 4463
            ++S++   +FSPGP   PFRIP F WS +HQRLL D+L S+E+D+Q+W+  + +++L+FVN+ EN ++V+N VHL++ L+D+LI  CGGLLPLLA+ATSP+ ++D+LE   GM +  AV FL R++N+AD+++FASSLNF ELE EK MS+GGILRQCLRLVCTCAVRNCLE + R     L+N  +L +                  +Q L+RG +  S  + +  L     P+ DPE LLQ+MDINRLRAV+YRDVEE KQAQFL+L+IVYF+SVLMVS+YRD+LEP      +   S V +R T  Q     ++ ++E
Sbjct: 1597 SKSSSTRPMFSPGPTRPPFRIPEFKWSYIHQRLLSDVLFSLETDIQVWRSHSTKSVLDFVNSAENAIFVVNTVHLISQLADNLIIACGGLLPLLASATSPNSELDVLEPTQGMPLDVAVSFLQRLVNMADVLIFASSLNFSELEAEKNMSSGGILRQCLRLVCTCAVRNCLECKERT--RGLYNGMSLKDIPGGVH------------LQALIRGAQSTSKTI-IESLSGPMSPVKDPEKLLQDMDINRLRAVIYRDVEETKQAQFLSLAIVYFISVLMVSKYRDILEPPVELQIHRNSSPVIHRSTPTQGTQSMQEGDYE 1902          
BLAST of Neurobeachin vs. TrEMBL
Match: A0A453YNQ3 (Uncharacterized protein OS=Anopheles gambiae OX=7165 PE=4 SV=1)

HSP 1 Score: 1220.3 bits (3156), Expect = 0.000e+0
Identity = 602/1230 (48.94%), Postives = 811/1230 (65.93%), Query Frame = 3
Query: 4953 TSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELV--SSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNE--FYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSES-----GYGVTDEELFDAEKSEPRSNEDNXXXXXXXXXXXXXXXXYKIPDNKDSNQNKISDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSP-HPDKLHNYVSSNVQLPLSMDPLLSQ------TTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
             SLT++LE ALG   PL+REI  DF+ +LS+TL+GSHGQEL+    GL T + S SVVE+VMLLCSQEWQNSLQKHAGLAFIEL+NEGRLL+HA  DH VRVANEA FIL+RMRA+DV KH++F   CA    ER+ EER+ +HLI +AR RD+ +A++L  +V +++ + HG W      Y +  F++LD WEDD+RRR+R V NP GS+HP+A L  +  +G +         T     +       ++    V   D T  + +     G GV  EE++ ++ + PRS +                     PD  D ++  I D                       + +++D+TGPV +ST A L+APG+   G++SIT +E+YFE+D  N     +DQ+VL Y  HLHGKW+FSEIRAIFSR++L +N+ALEIF+A+R +++FAFPDQ TV+KVI  LPRVG+GIKY + Q R++S+ SPRQ+ + SNMTQ+WQ+REISNF+YLM+LNTIAGRTYNDLNQYP+FPWV+ NYES  +DLS PSNYRDLS PIGALNPSR+++F+ R++ WD      FHYGTHYSTAAFVLN+L+R+EPFTT+FL LQ GKFDH DR F SVA +WKNCQRDTSDVKELIPE+++LPEMF N++DYR G+ +DG+ V DV LP WAKTPE+FVRINR ALESE VSCQLH WIDLIFGYKQRGPEA+R+TNVF YLTYEGSV+ D I DP+ R A+E+QIR+FGQTPS L+ EPHPPR+SA+H+SP+MF  +  D+ M LKF  NSPI+ ++AN +PQ PL +V+TV+A + + VN+W                                              N    +S+ SP + +   N    N  LPL+MDPLLSQ      +   N+R LG+ F   ++  +  +  T D+R + A GFWD SFR+FS ET +++Q+++GHFGVV C++RSEC    DCYI +GS DCTI+LW W  R  +++G+    E   PR T+TGH+  +  V IS ELG++VS S +   L+HT  G+LLRSL     F+ P  + +SREG+I++     +V  YTINGK + +  ++D                      ++  M L++DG+Y+  + N G V + R  NL  ++++P C++ I SLA+T DQ+++L GL  G+I++F++DFN+WHHEY+ RY
Sbjct: 2183 ASLTQKLEIALGPVCPLLREIMVDFAPFLSKTLVGSHGQELLMEGKGLTTFKNSHSVVELVMLLCSQEWQNSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFESQCAQTLLERREEERMCDHLITAARRRDNVIASRLLEKVRNIMGNRHGAWGDMNANYQKQIFWKLDAWEDDARRRKRMVQNPRGSSHPQATLKASLENGTT-------GGTVAAATSSTASTAATSADEAVGSGDTTTPTSARLAGGGGGVAREEIY-SQIAVPRSQQ---------------------PDLLDDSELLIED-----------------------RELDLDLTGPVNISTKAKLIAPGLVAPGTMSITSTEMYFEVDEENGEFQQIDQEVLKYCDHLHGKWYFSEIRAIFSRRYLLQNVALEIFLASRTSILFAFPDQHTVKKVIKALPRVGVGIKYGIPQTRRASMMSPRQLMRNSNMTQKWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVITNYESRELDLSQPSNYRDLSKPIGALNPSRREYFEERYETWDTPGIPPFHYGTHYSTAAFVLNWLIRIEPFTTMFLALQGGKFDHPDRLFSSVALSWKNCQRDTSDVKELIPEWYFLPEMFYNASDYRLGQRDDGSTVGDVELPPWAKTPEEFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAMRATNVFYYLTYEGSVDLDTIGDPVTRDAIENQIRNFGQTPSLLLMEPHPPRSSAMHLSPMMFNTMPDDVCMSLKFHLNSPIIHISANTYPQLPLPSVVTVTAGHQFAVNRW----------------------------------------------NCQYTASIQSPSYAESTQNL---NANLPLTMDPLLSQINGHNNSNQQNRRHLGDNFSQKLQIKSNCYVTTVDSRFLIACGFWDNSFRVFSTETAKIVQIIFGHFGVVTCLSRSECNITSDCYIASGSADCTILLWHWNARTQSIVGE---GEIPTPRATLTGHETAVTSVVISAELGLVVSGSINGPVLVHTTFGDLLRSLEAPKDFISPENITLSREGFIVVNYDEGSVAAYTINGKLLRYESHND----------------------NLQCMLLSRDGEYLMTAGNKGIVEVWRTFNLAPLYAFPACNSGIRSLALTHDQKYLLAGLATGSIIVFHIDFNRWHHEYQQRY 3286          

HSP 2 Score: 462.996 bits (1190), Expect = 6.595e-127
Identity = 257/621 (41.38%), Postives = 392/621 (63.12%), Query Frame = 3
Query: 1470 FEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINT 3332
            ++G+L  +++F YNPVA D QLCL  APK N   F H+ H+LM  +V+ V+T SI+ TL+S+GG+++LFPLFSQLD    +P +G  +  D  P +    ++     +  S   +  ++Q++G L+IS+ + RS+    L+ ++L S     LSL++  +  LS      A +D L+                                            +L+ HV    L N ++WI+    VQ +L+ +LA +FLS+  +++  R ++ VLQ ++++K+YYW+VNPR +SGI  K  +  P    + I  IR+ I  F+K+L++   NG  D+E+Q  LNYL  ++ED+N+  VL   ++LMSE PS+MVPAFD KHG++ IFKLLA+  + +R+ ALKLLGF+L RST+KRK D M PHNL+TL+ ERLLLY   +++  YN LYEIMTE ++ +I    H  P+  + LENP +LKV+A LIRQSK +++L++V+K+FL+D+  LCNN++ENRRTVLQMSVWQ+WL  +  + P+  +++++ D V +L R+LLHHA+K EYGGWRVW+DTLAI+HSKV+Y EF+    ++YE YE+  +D+ +   ++ Q  I+T
Sbjct:  473 YDGKLSSAIVFMYNPVATDGQLCLQSAPKGNLSYFVHTPHSLMLQDVKAVVTHSIHCTLNSIGGIQVLFPLFSQLD----MPYEGTDVRKD--PTL---CLDSFANWVESSQTGQQHMIQNRGFLVISFMLQRSSRD-HLSLDVLGSF----LSLTKYLVTCLS------ANSDLLLK-------------------------------------------QLLDHV----LFNPSLWIYTPATVQARLYAYLATEFLSDTQIYSNVRRVSTVLQTVHTLKFYYWVVNPRAKSGITPKGLD-GPRPAQKDILAIRAYILLFLKQLIM-IGNGAKDDELQSILNYLMTMHEDENLHDVLQMLISLMSEHPSSMVPAFDVKHGVRTIFKLLAAESQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLYTLLAERLLLYEESVSLPTYNVLYEIMTEHISQQILYAKHPEPESHYRLENPMILKVVATLIRQSKQSEQLIEVKKLFLSDMTLLCNNNRENRRTVLQMSVWQEWLIAMAYIHPKNSEEQKLSDMVYSLFRMLLHHAIKYEYGGWRVWVDTLAIVHSKVSYEEFKLQFAQMYEHYEKHRTDNITDPALRQQRPIST 1024          

HSP 3 Score: 424.091 bits (1089), Expect = 4.845e-115
Identity = 196/368 (53.26%), Postives = 278/368 (75.54%), Query Frame = 3
Query:  360 SMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRK 1463
            SM +N+  K+ +LIGLI+V Q+  +E+V+ VL+LLV G FDME NF++  +Q V HML+++    + L+AE+ SVFI +++KS  NL    E   IE  L  L+ A+ + ADLLIEMLG++AS+S++VKELK +F  +K  N  WP HS +LLNVL+QMP R+GPD FF+FPG  GSAI +PP++KWPY+NG+TF+ W  LDP ++VNI+R+KPYLYCF+T+KG+GY+ HFVG+ LV+T+MK+K KG QHCVKY  QPR+WYM+++VY+YNRWTKSEI+C ++G+L S  EM W ++TN+ FD+C++GA+PE   E +  GQ++ IY F+E+L   QI A++ LGP YK  F+F+ EC  NL D+ ++
Sbjct:   22 SMTDNL--KFAVLIGLIEVGQVSNREVVNTVLHLLVGGEFDMELNFVVQDAQNVKHMLELLDHCPANLQAEVWSVFIAILKKSVRNLQACTEIGLIEHVLARLQQAEPIVADLLIEMLGVLASYSITVKELKLLFGAMKAVNGKWPRHSAKLLNVLKQMPHRNGPDVFFSFPGRKGSAIVLPPLAKWPYENGFTFSTWFRLDPINSVNIEREKPYLYCFKTSKGVGYTAHFVGNCLVLTSMKVKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCLVNGQLASSTEMAWLVSTNDPFDKCYVGATPELDEERVFCGQMAAIYLFSEALTTQQICAMHRLGPGYKSQFRFDNECYLNLPDNHKR 387          

HSP 4 Score: 288.115 bits (736), Expect = 1.033e-73
Identity = 157/289 (54.33%), Postives = 212/289 (73.36%), Query Frame = 3
Query: 3504 AQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            ++S++   +FSPGP   PFRIP F WS +HQRLL D+L S+E+D+Q+W+  + +++L+FVN+ EN ++V+N VHL++ L+D+LI  CGGLLPLLA+ATSP+ ++D+LE   GM +  AV FL R++N+AD+++FASSLNF ELE EK MS+GGILRQCLRLVCTCAVRNCLE + R     L+N  +L +                  +Q L+RG +  S  + +  L     P+ DPE LLQ+MDINRLRAV+YRDVEE KQAQFL+L+IVYF+SVLMVS+YRD+LEP
Sbjct: 1597 SKSSSTRPMFSPGPTRPPFRIPEFKWSYIHQRLLSDVLFSLETDIQVWRSHSTKSVLDFVNSAENAIFVVNTVHLISQLADNLIIACGGLLPLLASATSPNSELDVLEPTQGMPLDVAVSFLQRLVNMADVLIFASSLNFSELEAEKNMSSGGILRQCLRLVCTCAVRNCLECKERT--RGLYNGMSLKDIPGGVH------------LQALIRGAQSTSKTI-IESLSGPMSPVKDPEKLLQDMDINRLRAVIYRDVEETKQAQFLSLAIVYFISVLMVSKYRDILEP 1870          
BLAST of Neurobeachin vs. Ensembl Cavefish
Match: nbeab (neurobeachin b [Source:ZFIN;Acc:ZDB-GENE-120329-2])

HSP 1 Score: 874.389 bits (2258), Expect = 0.000e+0
Identity = 427/893 (47.82%), Postives = 585/893 (65.51%), Query Frame = 3
Query: 5940 SESETVTNNSLAKPINMD-ITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEI-KDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHV-----SPLMFTP-VHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
             E +TV   SL +  +MD + GPV LSTPA L+AP ++  G++SIT +E+YFE+D ++     LD ++L Y   LHGKW FSEIRA+F+R++L +N ALE+F+ANR +VMF FPDQ TV++V+Y LPRVG+G  Y + Q R+ SLASPRQ+FK SNMTQRWQ+REISNF+YLM+LNTIAGRTYNDLNQYP+FPWVL NYESE +DL+ P N+RDLS PIG+LNP R  F+   +++WD+++    HY THYSTA   L++LVR+EPFTT FLN    KFDHA+RTF  + ++W++CQRDTSDVKELIPEF+YLPEMF NSN Y  G  +DG  V DV LP WAKTPEDFVRINR ALESE VSCQLH WIDLIFGYKQRGPEA+R+ NVF +LTYEGSVN D +  DP +R+A+E QI++ GQTPSQL+ EPHPPR+SA+H+     SPLMF   +  D++M+LKF SNSP+  + AN  P   + A +TV+ + ++ VN+W++                       + L  +P     QS +                              LP+ MD L++     NKR + +  D  ++ ++  F  T DNR I   GFWDKSFR++S ETG+L Q+V+GH+ VV C+ARSE     DCYIV+GS D T++LW W  R H +  + N  +   PR  +TGH  E+VCV +  ELG+++S +K+  CL+HTI G+LLR+L   D+   P  + +S EG+ ++  +      ++INGK             L   ME++ S           A+ L+ DG  +    ++G V + +  + + ++ YP CDA I ++ ++ DQR ++ G+ +G+IV FN+DFN+WH+E+++RY
Sbjct: 2058 GEDDTV---SLLQDKDMDNLAGPVVLSTPAQLVAPVLAARGTLSITTTEIYFEVDEDDPAFKRLDPRILAYSEGLHGKWMFSEIRAVFARRYLLQNTALEVFMANRTSVMFNFPDQPTVKRVVYSLPRVGVGTSYGLPQARRISLASPRQLFKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEELDLTVPGNFRDLSKPIGSLNPKRAVFYAESYESWDEETPPC-HYTTHYSTADSTLHWLVRIEPFTTFFLNTNGNKFDHANRTFSGIMRSWRHCQRDTSDVKELIPEFYYLPEMFVNSNGYCLGDRDDGTPVCDVELPAWAKTPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFHHLTYEGSVNLDGLAADPQLREAMEAQIQTVGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKEQMQQDVIMVLKFPSNSPVTHVAANTLPHLAMPAAVTVTCSRLFAVNRWHNT----------------------VGLRGAPGYSLEQSHH------------------------------LPIEMDSLIANNAGTNKRQITDLVDQSIQINSQCFVVTADNRYILVCGFWDKSFRVYSSETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNNSDYPAPRAVLTGHDYEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPDNCCLPRLISVSSEGHCIICYERGQFCNFSINGK-------------LLAQMEINDST---------RALLLSSDGQTLVTGGDNGVVEVWQACDFKQLYVYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQNRY 2872          

HSP 2 Score: 798.89 bits (2062), Expect = 0.000e+0
Identity = 401/962 (41.68%), Postives = 625/962 (64.97%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKV 3257
            +I  K+ +L+GLI+  ++  ++I + VL LLV G FD+E NF+I  ++ ++ M+++++      +AE+ S+F  ++RKS  NL    E   I+  L  + + D M ADLL++MLG++AS+S++VKELK +F +L+G    WP H+V+LL VL QMP R GPD FFNFPG   +AIA+PPI+KWPYQ+G++ N W  +DP + +N+D+DKPYLYCFRT+KG+GYS HFVG+ L++T++K K KG QHCVKY+ QPR+WYM+S+V++YNRW  SEIRCY++G+L+S  +M W +NTN+ +D+CF+G+S       +  GQ+  IY F+E+LNP QI AI+ LG SYK  FKF++E   +L++  ++  ++G+L +S+ F YN  A D QLCL  +P+ N  +F HS HALM  +V+  +T SI+S +HS+GG+++LFPLF+QLDF        Q   + V   + A L+  L ELL  S A++ Q++  KG L+I Y + +S                     S++HI          A  +Q +S                              Y  A+  G+     L+K + D++L N A+WIH   +VQL L+ +L+ +F+    ++N  R +  VLQ ++++KYYYW VNP          P + P  + ++I ++R+ +  F+K+L+LK   GV ++E+Q   NYL  ++ED+N+  VL   V LMSE P++M+PAFD ++GI+V++KLLAS  E++R+ ALK+LG++L+   +KRK + M  H+LFTL+ ERL+L++  +++  YNTLYEI+TE++  ++    H  PD T  ++NP +LKV+A L++ S  + EL++VR++FL+D+  L +NS+ENRR +LQ SVWQDW+F L  ++P+  +++++ + V N+ R+LL+HA+K E+GGWRVW+DTL+I HSKV Y   +  + K+
Sbjct:   19 SIRTKFAVLVGLIQAGEVTDRDIAETVLNLLVGGEFDLETNFIIQDAESMVCMVELLEHCRVTCQAEIWSMFTAILRKSVRNLQTCTEVGLIQLVLIRMSSVDDMIADLLVDMLGVLASYSITVKELKLLFSMLRGEGGLWPRHAVKLLAVLNQMPQRHGPDAFFNFPGRSAAAIALPPIAKWPYQSGFSLNTWFRMDPLNNINMDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHVNTNDSYDKCFLGSSETADANRVFCGQLGAIYVFSEALNPAQIFAIHQLGSSYKSTFKFKSESDIHLAEHHKQVLYDGKLANSICFTYNAKATDAQLCLESSPRDNPSIFVHSPHALMLQDVKATVTHSIHSAIHSIGGIQVLFPLFAQLDFH-------QHSESQVETTVCATLLAFLVELLKSSVAMQEQMLGGKGFLVIGYLLEKS---------------------SRVHITR--------AVLEQFLSF---------------------------AKYLDALSHGAP----LLKQLCDHILFNAAIWIHTPAKVQLSLYTYLSAEFIGTATIYNTIRRVGTVLQLMHTLKYYYWAVNP---------APCNGPRPSQKEIISLRAFMLLFLKQLILK-DRGVKEDELQSIQNYLLTMHEDENLHDVLQLLVALMSEHPASMIPAFDQRNGIRVVYKLLASKSESIRVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLCERLMLHTSTVSVTTYNTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLGYINPKNSEEQKITEMVYNIFRILLYHAIKHEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKM 903          

HSP 3 Score: 261.151 bits (666), Expect = 6.698e-69
Identity = 128/208 (61.54%), Postives = 165/208 (79.33%), Query Frame = 3
Query: 4956 SLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWAS-DQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTH 5576
            S+T +LE+AL   APL+REIF DF+ +LSRTL+GSHGQEL+  GLV ++ STSVVE+VMLLCSQEWQNS+QK+AGLAFIEL+NEGRLL HA  DH VRVANEA FIL+R RAEDV KH+EF   CA    +R+ EE++ +HLI++A+ RD   AN+LK ++ +++ + HG W +   +  ++F+RLDYWEDD RRRRRFV NP+GSTH
Sbjct: 1809 SITTKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEFESNCAQYAADRREEEKMCDHLISAAKHRDHVTANQLKQKIVNILTNKHGAWGALAHSHLHDFWRLDYWEDDLRRRRRFVRNPFGSTH 2016          

HSP 4 Score: 249.21 bits (635), Expect = 2.551e-65
Identity = 140/295 (47.46%), Postives = 200/295 (67.80%), Query Frame = 3
Query: 3498 AVAQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNL----PPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            A+  +  + + FSPGPR+  FRIP F WS +HQRLL DLL ++E+D+ +W+  + +++++FVN+ EN ++V N +HL++ + D++I  CGG+LPLL+AATSPS +++ +E   GM+   AV FL R+M++ D++VFASSLNF E+E EK MS+GG++RQCLRLVC  AVR+CLE R R                    D  F  ++    P D +Q      +   D+   N       PI DP+ LLQ++DINRLRAVV+RDV++ KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1249 AMLMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFALEADVHVWRSHSMKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPSSELEGVEVTQGMSSETAVAFLTRLMSMVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRSCLECRQR------------------QRDRGFKSSMSSLKPQDSLQNTAASSKSAMDNFPGNL-----SPIMDPDRLLQDVDINRLRAVVFRDVDDGKQAQFLALAVVYFISVLMVSKYRDILEP 1520          
BLAST of Neurobeachin vs. Ensembl Cavefish
Match: nbeaa (neurobeachin a [Source:ZFIN;Acc:ZDB-GENE-050320-68])

HSP 1 Score: 870.537 bits (2248), Expect = 0.000e+0
Identity = 430/920 (46.74%), Postives = 589/920 (64.02%), Query Frame = 3
Query: 5877 KDSNQNKISDDTKSAQGI-KKVSESETVTNN-----SLAKPINMD-ITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHV-----SPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMEL-DSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            +D  +NK S  T  +Q +  +  E+E +        SL +   +D + GPV LSTPA L+AP +   G++SIT +E+YFE+D  +     +D KVL Y   LHGKW FSEIRA+F+R++L +N  LE+F+ANR +VMF FPDQ TV+KV+Y LPRVG+G  Y + Q R+ SLA+PRQ+FK SNMTQRWQ+REISNF+YLM+LNTIAGRTYNDLNQYP+FPWVL NYESE +DL+ P N+RDLS PIGALNP R  F+   ++ W++D     HY   YSTAA  L +L R+EPFTT +LN    KFDH DRTF  + ++W++CQRDTSDVKELIPEF+YLPEMF NSN Y  G  ED + V DV LP WAK PEDFVRINR ALESE VSCQLH WIDLIFGYKQRGPEA+R+ NVF Y++YEGSVN D I D  +R+++E QI++FGQ PSQL+ EPHPPR+SA+H+     SPLMF   +  D++M+LKF SNSP+  + AN  P   + A +TV+ + ++ VN+W++                   L GA                           S++  H             LP+ MDPL++  + +NKR + +  D  ++ +   F  T DNR I   GFWDKSFR++S ETG+L Q+V+GH+ VV C+ARSE     DCYIV+GS D T++LW W  R H +  + N  +   PR  +TGH  E+VCV +  ELG+++S +K+  CL+HTI G+LLR+L   ++ V P  + +S EG+ ++  +      ++INGK             L   ME+ DSS+          A+ L+ DG  +    ++G V + +  + + ++ YP CDA I ++ ++ DQR ++ G+ +G+IV FN+DFN+WH+E+++RY
Sbjct: 1593 EDYEENKKSKKTFRSQSVVSQNPETELMLEGDDDAVSLLQEKELDNLAGPVVLSTPAQLVAPVIVARGTLSITTTEIYFEVDEEDPAFKKIDAKVLAYSEGLHGKWMFSEIRAVFARRYLLQNTGLEVFMANRTSVMFNFPDQATVKKVVYSLPRVGVGTSYGLPQARRISLATPRQLFKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEELDLTLPGNFRDLSKPIGALNPKRAAFYAEHYETWEEDGTPPHHYTALYSTAASTLLWLHRIEPFTTFYLNGNEKKFDHPDRTFSGIMRSWRSCQRDTSDVKELIPEFYYLPEMFVNSNGYDLGLREDRSAVSDVELPVWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFHYMSYEGSVNLDTITDLQLRESMEAQIQTFGQVPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLSVPAAVTVTCSRLFAVNRWHNTVG----------------LRGAPGY------------------------SLEQAH------------HLPIEMDPLIANNSGVNKRQITDLVDQSIQINTHCFVVTADNRYILVCGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNNSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCVRPRLISVSSEGHCIIYYERGRFCNFSINGK-------------LLAQMEVNDSSR----------AILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQNRY 2437          

HSP 2 Score: 332.413 bits (851), Expect = 9.695e-91
Identity = 168/381 (44.09%), Postives = 269/381 (70.60%), Query Frame = 3
Query: 2115 GSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKV 3257
            G +H   L+K + D++L N A+WIH   +VQL L+ +L+ +F+    ++   R +  VLQ ++++KYYYW  NP + SGI  K  +  P    ++I ++R+ +  F+K+L+LK   GV ++E+Q  LNYL  ++ED+NI  VL   V LMSE P++M+PAFD ++GI+VI+KLLAS  E++R+ ALK+LG++L+   +KRK + M  H+LFTL+GERL++++  +T+  YNTLYEI+TE++  ++    H  PD T  ++NP +LKV+A L++ S  + EL++VR++FL+D+  L +NS+ENRR +LQ SVWQDW+F L  ++P+ P+++++ + V N+ R+LL+HA+K E+GGWRVW+DTL+I HSKV Y   +  + K+
Sbjct:   84 GLTHGAPLLKQLCDHVLFNAAIWIHTPAKVQLSLYTYLSAEFIGTATIYTTIRRVGTVLQLMHTLKYYYWASNPLESSGITPKGLD-GPRPTQKEIISLRAFMLLFLKQLILK-DRGVKEDELQSILNYLLTMHEDENIHDVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIRVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMMHTNTVTVTTYNTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSSPSTELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLGYINPKNPEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKM 462          

HSP 3 Score: 260.766 bits (665), Expect = 6.653e-69
Identity = 129/212 (60.85%), Postives = 168/212 (79.25%), Query Frame = 3
Query: 4956 SLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAIL 5591
            S+T +LE+AL   APL+REIF DF+ +LSRTL+GSHGQEL+  GLV ++ STSVVE+VMLLCSQEWQNS+QK+AGLAFIEL+NEGRLL HA  DH VRVANEA FIL+R RAEDV KH+EF   CA    +R+ EE++ +HLI++A+ RD   AN+LK ++ +++ + HG W +  ++ ++F+RLDYWEDD RRRRRFV N +GSTH +A L
Sbjct: 1379 SITTKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEFESNCAQYAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGT-MSQLHDFWRLDYWEDDLRRRRRFVRNAFGSTHSDASL 1589          

HSP 4 Score: 249.595 bits (636), Expect = 1.725e-65
Identity = 141/281 (50.18%), Postives = 196/281 (69.75%), Query Frame = 3
Query: 3531 FSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNY-PISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            FSPGPR+  FRIP F WS +HQRLL DLL ++E+D+ +W+  + +++++FVN+ EN ++V N +HL++ + D++I  CGG+LPLL+AATSPS +++ +E   GM+   AV FL R+M + D++VFASSLNF E+E EK MS+GG++RQCLRLVC  AVRNCLE R R                    D     +LP    QE ++     S     N  + +N  PI DP+ LLQ++DINRLRAVV+RDV+++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct:  822 FSPGPRTTMFRIPEFKWSPMHQRLLTDLLFALETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPSTELENVEATQGMSSETAVTFLSRLMAMVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQR------------------QRDRGSKSSLPISKTQENLQSAASASKSAIAN--VPRNLSPIKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEP 1082          
BLAST of Neurobeachin vs. Ensembl Cavefish
Match: lrba (LPS-responsive vesicle trafficking, beach and anchor containing [Source:ZFIN;Acc:ZDB-GENE-090311-19])

HSP 1 Score: 839.336 bits (2167), Expect = 0.000e+0
Identity = 420/868 (48.39%), Postives = 551/868 (63.48%), Query Frame = 3
Query: 5994 ITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            +TGPV LST A LLAPGV V GS+SIT +ELYFE+D  + +    D K+L Y   LHGKW F+EIRA+FSR++L +N ALEIF+ANR AVMF F D  TV+KV++ LPRVG+G  Y + Q R+ SLA+P+Q+FK S+MTQRWQ+REISNF+YL++LNTI+GRT+NDLNQYP+FPWV+ NY++E +DL+ PSNYRDLS PIGALNP R  FF +RF++W+D+    FHYGTHYSTA+F + +L+R+EPFTT FLN Q GKFDHADRTF S+++ W+NCQRDTSDVKELIPEFFYLPEMF NSN+Y  G  +DG +V DV LP WAK+PE+FVRINR ALESE VSCQLH WIDLIFGYKQ+GPEA+RS NVF YLTYEG+VN   I DPM+R+A+E QIRSFGQTP QL+ EPH PR+SA+ V+PLMFT  +  D++M+LKF SNSP+      VH          V+AN   G+N                                SP I          ++ + R+ +V+     K H   +SNV                ++R + +  D  ++  +  F  T DNR +   GFWDKSFR++S +TG+L+Q+V+GH  VV C+ARSE     DCY+++GS D T++LW W  + H  +GD    +   PR  +TGH  E+ C  +            D   L   ++G              P  L  S EG+ ++         Y+INGK + H    D+                      I AM L+KDG Y+    + G + + + H+L+ + SYP CDAAI S+AI+ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct: 1922 VTGPVNLSTSAQLLAPGVCVRGSLSITSTELYFEVDEEHPSFTQSDPKILAYTEGLHGKWLFTEIRAVFSRRYLLQNTALEIFLANRTAVMFNFADAATVKKVVHCLPRVGVGTNYGLPQTRRISLATPKQLFKASSMTQRWQRREISNFEYLIFLNTISGRTFNDLNQYPVFPWVITNYDTEDLDLTLPSNYRDLSKPIGALNPKRAAFFSDRFESWEDEQVPKFHYGTHYSTASFTMMWLLRIEPFTTFFLNFQGGKFDHADRTFSSISRAWRNCQRDTSDVKELIPEFFYLPEMFVNSNNYNLGVMDDGTVVSDVELPPWAKSPEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRSLNVFYYLTYEGAVNLSTITDPMLREAVESQIRSFGQTPCQLLIEPHSPRSSAMQVTPLMFTDQMQQDVIMVLKFPSNSPV------VH----------VAANTQPGLN--------------------------------SPAI---------ITVTANRLFAVN-----KWHGLTASNVG--------------SHRRQITDLLDQSIQVSSQCFIITSDNRFLLLAGFWDKSFRVYSTDTGKLVQIVFGHRDVVTCLARSESYIGGDCYVLSGSRDATLLLWYWSGK-HCSIGD---SKFVTPRAILTGHDCEVTCASVCA----------DCCGLWRVLRG-----------VCGPRLLQASTEGHCVIYYDQGHFCTYSINGKLLQHKELEDK----------------------IRAMLLSKDGQYLLCGGDGGILSVWQVHDLKQLFSYPGCDAAIRSMAISNDQRCIITGMASGSIVLFYNDFNRWHHEYQTRY 2666          

HSP 2 Score: 786.178 bits (2029), Expect = 0.000e+0
Identity = 392/957 (40.96%), Postives = 611/957 (63.85%), Query Frame = 3
Query:  372 NIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYK----GNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYH 3230
             I +K+ +L GL++  ++  ++IV+ V  LLV G FD+E NF+I  ++ +  M++++   +   +AE+ S+F  +++KS  NL    +   I+  L+ + + D M ADLL++MLG +AS+S++VKELK  F  L+G    WP H+V+LL+VL+ M  R+GPD FF FPG   +    P   KWPYQ+G+TF+ W+ +DP + +N+D+DKPYLYCFRT+KGLGYS HFVG  L++T++K K KG QHCVKY+ +P++WYMV++V++YNRW  SEI CY++GEL S  E+ W +NT++ FD+CF+G+S       +  GQ+  +Y F+E+L+  QI AIY LGP YK    G FK++AE     ++  +   ++G+L  S+ F YNP A D QLCL  +PK N  +F HS HALM  +V+ V+T S+ S +HS+GGV++LFPLF+QLDF+       Q  S ++  ++   L++ + ELL  S A++ Q++  KG L+I Y + +S                     S++H+                    T P  +     +  + N+ NG                   + L+K + D++L N A+WIHA  +VQL L+ +LA +F+S   ++N  R +  VLQ ++++KYYYW+VNP+DRSG+  K  +  P  N ++I ++R+ +  F+K+L++K + GV ++E+Q  LNYL  ++EDDN+  VL   V LMSE PS+MV AFD ++GI+VI+KLL S  E +R+ ALK++G++L+    KRK D M+ H LF+L+ ERL L+S   +M  YN L+EI+TE++  ++    H  PD T  ++NP +LKVIA L++ +    E ++VR++FL+D+  L NNS+ENRR++LQ SVWQ+W+  L  ++P+  +++++ + V  + R+LL+HA+K E+GGWRVW+DTL+I HSKV+ H
Sbjct:   19 GIRMKFAVLQGLVQAGEVSSRDIVETVFNLLVGGQFDLEMNFIIQETESIECMVELLDKCEVTCQAEVWSIFTAVLKKSVRNLQACTDVGLIQLVLQRIDSTDSMIADLLVDMLGGLASYSITVKELKLFFSKLQGEKGKWPPHAVKLLSVLKSMANRTGPDSFFTFPGKSAAIALPPIA-KWPYQSGFTFHTWLRMDPINNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIVTSLKSKGKGFQHCVKYDFKPQKWYMVTIVHIYNRWKNSEISCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQMGAVYLFSEALSAAQILAIYQLGPGYKLELTGTFKYKAESDLLFAEHHKTLLYDGKLSGSIAFTYNPRATDAQLCLESSPKDNASIFVHSPHALMLQDVKAVVTHSVQSAIHSIGGVQVLFPLFTQLDFT-------QHSSEELDTSVCCTLLSFMMELLKNSVAMQEQVLACKGFLVIGYSLEKS---------------------SKVHV--------------------TRPVMEIFLAFARYLSNLPNG-------------------VLLLKQLCDHILFNPAIWIHAPAKVQLTLYTYLATEFISTVTIYNAVRRVGTVLQVMHTLKYYYWVVNPQDRSGVTPKGLD-GPRPNQKEIHSLRAFLLLFVKQLIMKDY-GVKEDELQSILNYLLTMHEDDNLMDVLQLLVALMSEHPSSMVQAFDQRNGIRVIYKLLGSKSEGIRVQALKVMGYFLRHLQPKRKSDVMLSHGLFSLLTERLALHSSQFSMTTYNVLFEILTEQICTQVIHKQHPDPDSTVKIQNPQILKVIAALLKNAPAGPETMEVRRVFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCFINPKNSEEQKITEMVYAVFRILLYHAIKYEWGGWRVWVDTLSITHSKVSAH 905          

HSP 3 Score: 251.521 bits (641), Expect = 4.965e-66
Identity = 144/302 (47.68%), Postives = 196/302 (64.90%), Query Frame = 3
Query: 4947 SSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPI-IHNKSKTEIFKNTLKEL------------NLKSN---VVAGVSINDN-TMTSESGYGVTDEELFDAEKSEPR 5795
            ++ S  +RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLLCSQEWQNS+QK+AGLAFIELVNEGRLL+H   DH VRVANEA FILSR RAED+ KH+EF    A    +++ EE++ +HLI +A+ RD   A +L  ++ +++   HG W S       F+RLDYWEDD RRRRRF+ N +GS+H EA L  A+ +G+S  +   + S  E+  +TL  L            NL ++   +  GV +  + ++TS   Y   DEE     +S+P+
Sbjct: 1668 TAESAAERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSHTMKDHLVRVANEAEFILSRQRAEDIHKHAEFESQSAQYSADKRDEEKMCDHLIRAAKYRDHVTATQLIQKIVNILTDKHGAWGSSSYRPQSFWRLDYWEDDLRRRRRFIRNQFGSSHSEATLKAAAENGESRALRADSASPQELDDDTLSALEDKEPEPVTGPVNLSTSAQLLAPGVCVRGSLSITSTELYFEVDEEHPSFTQSDPK 1969          

HSP 4 Score: 246.899 bits (629), Expect = 1.247e-64
Identity = 135/271 (49.82%), Postives = 193/271 (71.22%), Query Frame = 3
Query: 3558 FRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            FRIP F WS +HQRLL DLL SIE+D+Q+W+  + + +++FVN++EN V+V N VHL++ + D+LI  CGG+LPLL+AATS + +++ +E   G+A+  ++ FL R++++ D+++FASSL+F E+E EK MS+GG+LRQCLRLVC  AVRNCLE + +  H ++  ES+     S    SKF     P P+  +  G+ P                I D + LLQ+MDINRLRAVV+RD+E++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1264 FRIPEFKWSHMHQRLLTDLLFSIETDVQMWRSHSTKTVMDFVNSSENVVFVHNTVHLISQVVDNLIMACGGILPLLSAATSSTHELESIEPSQGLAVESSLAFLQRLISLVDVLIFASSLSFTEIEAEKNMSSGGVLRQCLRLVCAMAVRNCLECQQQHSHCKVGGESSQKLEQSIVGPSKF----MPSPVDMVTGGVSP----------------IRDVDRLLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEP 1514          
BLAST of Neurobeachin vs. Ensembl Cavefish
Match: nbeal1 (neurobeachin-like 1 [Source:ZFIN;Acc:ZDB-GENE-130530-544])

HSP 1 Score: 382.874 bits (982), Expect = 5.842e-106
Identity = 195/400 (48.75%), Postives = 260/400 (65.00%), Query Frame = 3
Query: 6057 GSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSA--FHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSE-DGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNS 7247
            G + IT   +YF  D++ +   G+ Q           KW  S+IR I  R++  +  ALEIF+ ++      F  ++ VR  +Y   R+ +     +   R     SP+++ K S +TQ+W  REISNFDYLM LNTIAGRTYN+L QYP+FPW+LA+Y SE +DLS P  +RDLS P+  LN    K    ++++++D + +   FHYGTHYS AA V++YL+RVEPFT+L + LQSG+FD ADR FHS+  TW+    + +DVKELIPEFFY PE   N N +  G+ +     V+DV+LPKWAK+PEDF+  +R+ALESE VS  LH WIDLIFGYKQRGP A+ + NVF Y TYEG+V+ D I D   R+ALE  I +FGQTP QL+ EPHP R S
Sbjct: 1950 GRLDITTHHIYF-YDSSTEKEEGVGQDF---------KWPLSQIREIHLRRYNLRRSALEIFLIDQTNYFLNF--KKEVRNKVY--SRMLLLCSLPLHGTR-----SPQELLKASGLTQKWVNREISNFDYLMQLNTIAGRTYNNLAQYPVFPWILADYTSEELDLSDPCVFRDLSKPVAVLNEKNAKAVREKYESFEDPTGTIDRFHYGTHYSNAAGVMHYLIRVEPFTSLHIQLQSGRFDCADRQFHSIPATWQTLIDNPNDVKELIPEFFYFPEFLENQNGFDLGRLQISKERVNDVVLPKWAKSPEDFIYKHRKALESEYVSAHLHEWIDLIFGYKQRGPAAVEALNVFYYCTYEGAVDLDAITDEKERKALEGMISNFGQTPCQLLKEPHPVRLS 2330          

HSP 2 Score: 111.309 bits (277), Expect = 1.392e-23
Identity = 77/277 (27.80%), Postives = 133/277 (48.01%), Query Frame = 3
Query: 7737 FACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTI-QGELLRSLLLSDSFVDPY---RLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNV 8555
            F  + D +++F+GG WD S R+ S+  G+ +     H  ++ C+A   CG     ++++GS D T M+W    +  A +G      S +P   + GH  E+V V IS EL + VS ++D   +IH++ +G+ +RSL        P     L +S EG++++    C     T+  K+  HL + +          L S  +K           L   G+Y+ + S  GF+ IR  ++L L  S       I  +++T +Q  +LVGL +G +++  V
Sbjct: 2448 FVVSHDGKLLFSGGHWDNSLRVTSLLKGKTVGQYIRHMDIITCLATDYCGI----HLISGSRDTTCMVWQVQQQGGAPVG-----LSPKPLQVLYGHTDEVVSVCISTELDMAVSGARDGTVIIHSVRRGQYMRSLRPPCESTLPVSIPHLAVSWEGHVVVHT--CVEGKATLKDKNALHLYSVN-------GKHLSSEPLKE------QVTDLCVSGEYIVMGSEQGFLSIRDLYSLALCASPMAMRVPIRCVSVTKEQSHMLVGLEDGKLILVGV 2700          

HSP 3 Score: 60.077 bits (144), Expect = 4.793e-8
Identity = 77/337 (22.85%), Postives = 126/337 (37.39%), Query Frame = 3
Query:  915 KWPYQNGWTFNCWIHLD-----PASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSN--LVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNR--WTKSEIRCYIDGELISQVEMPWQINT-NEGFDRC-------------------------------------------FIGASPEQKTE--------------TLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKF-EAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPND 1721
            +WP  + ++F  W+ LD     P S       +  LY F T  G G+   F+ S   LV+     K+        Y      W+ + VV+V  +  + +S +  Y+DG+   ++  P +  T  E F  C                                            +G  PE  T+              T L GQ+  +  F E+L  +Q+ A+++ GP+    FK  EAE               G L   L+  Y+P AC   +CL+ +P +         H  +TGN   V+   +   ++ +GG+ +LFP+  QL      P+D
Sbjct:  628 RWP-GSAFSFLAWLSLDQDQLGPPSK---GEKRKQLYSFFTPGGTGFEA-FISSAGALVVAVCSKKEYVTVMLPDYCFCDSLWHFIGVVHVPGKRPFGQSLVYIYVDGQ--QKLSAPLKYPTMTEPFTSCCIGSAGHRTTTPPPSQIPDPPLSGAPSGRSSLGGILSPQTWGGLLGGKPESLTKLISAGTQDSEWGSPTSLQGQLGSVMVFHEALQINQLKALFTAGPNCISPFKSQEAEL--------------GDLSSKLLLHYSPKACRNPICLDLSPNL--------LHGRLTGN--KVVNWDVKDMINCVGGLPVLFPVLEQLTLLTPDPSD 933          
BLAST of Neurobeachin vs. Ensembl Cavefish
Match: nbeal2 (neurobeachin-like 2 [Source:NCBI gene;Acc:100330830])

HSP 1 Score: 368.622 bits (945), Expect = 1.024e-101
Identity = 193/413 (46.73%), Postives = 263/413 (63.68%), Query Frame = 3
Query: 6051 VHGSVSITKSELYFEMDANNKN----NIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIY--VLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSA--FHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSE-DGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVS 7262
            V G + +T   +YF   ++ K      IG D            K   S++R +  R++  +  ALE+F  ++      F  ++ VR  +Y  +L      + Y  S+       SP+++ K SN+TQ+W  REISNF+YLM LNTIAGRTYNDL+QYP+FPWVL +Y S  +DL  P+ +RDLS PIG +NP   +    ++++++D + +   FHYGTHYS AA V++Y++R+EPFTTL + LQSGKFD ADR FHSVA  W+      +DVKELIPEFFY PE   N N +  G  + +   V++V+LP+WA + EDF+R +R+ALESE VS  LH WIDLIFGYKQRGPEA+ + NVF Y TYEG+V+ D I +   R+ALE  I +FGQTP QL+ E HPPR SA + S
Sbjct: 2004 VSGRLEVTTHHIYFYDGSSEKEETEEGIGFD-----------FKRPLSQLREVHLRRYNLRRSALELFFIDQAHYFINF--RKKVRNKVYSRILGLRPPNLFYFGSR-------SPQELLKASNLTQKWVCREISNFEYLMQLNTIAGRTYNDLSQYPVFPWVLCDYTSSVLDLEDPAVFRDLSKPIGVVNPRHAQNVREKYESFEDPTGTVDKFHYGTHYSNAAGVMHYMIRMEPFTTLHIQLQSGKFDCADRQFHSVAAAWQARMESPADVKELIPEFFYFPEFLDNMNGFNLGCLQVNQEQVNNVVLPRWASSREDFIRKHRKALESEHVSAHLHEWIDLIFGYKQRGPEAVEALNVFYYCTYEGAVDLDAIANETERKALEGIISNFGQTPCQLLKEAHPPRMSAENAS 2396          

HSP 2 Score: 57.7658 bits (138), Expect = 2.307e-7
Identity = 33/118 (27.97%), Postives = 55/118 (46.61%), Query Frame = 3
Query: 7590 PHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLW 7943
            P+   + NY +       S DP +S      +R L   F   +         + D R++F+GG WD S R+  +  G+++  +  H  VV C++   CG     Y+++GS D T M+W
Sbjct: 2459 PYDKNIANYFT------FSKDPTMSNPK--TQRFLSGPFSPGVEIGAQVLVVSSDGRLLFSGGHWDCSLRVTMLGKGKMVGRICRHIDVVTCLSLDLCGI----YLISGSRDTTCMVW 2564          
BLAST of Neurobeachin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007035.1 (pep scaffold:Pmarinus_7.0:GL477366:176480:246408:1 gene:ENSPMAG00000006333.1 transcript:ENSPMAT00000007035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 766.533 bits (1978), Expect = 0.000e+0
Identity = 387/815 (47.48%), Postives = 519/815 (63.68%), Query Frame = 3
Query: 6135 KVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIA-----GRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQ-PRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDF 8561
            KVL Y   LHGKW FSE+ AIFSR++L +N ALEIF+++R ++MF  PD   V+ V+++LPRVGIG  Y + Q R+ SLASPRQ+FK SNMTQRWQQR++SNF+YLM+LNTIA     GRTYNDLNQYP+FPWV+ANY+SE +DL+ PSN+RDLS P+GALNP R   F  R+ +WDD    AFHYGTHYSTAAFVL +L+RVEPFT  FL+LQ GKFDHADRTF SVA+ W+N QRDTSDVKELIPEFFYLPEMFTNSNDY  G ++ G  V DV+LP WAKT E+FVRINR ALESE+VSCQLH W+DLIFGYKQRGPEAIR+ NV+ YLTYEG+VN   I+D + R+A+E QIRSFGQTP+QL+ EPH PR+SA+H               M+ F S +P+++   +   Q  +  VL   +N     +   HVAA+          + P     A+   T   +      N     +S  M  +               ++LP+ +DPLL     +++R + +  D  +      F  T DNR +  GGFWDKSFR++S +TGRL Q ++GH+ VV C+ARSE G   DCY+ +GS D T++LW W  R+ A LGD     + + PR  +TGH  E+  V +S ELG+ +S S  S CL+HT+ GELLR+L  + +   P  L IS++          T+L +++NG+        D                      +  AM L+ DG YV    + G V + R ++L  +++YP CD+++ +L ++ DQR ++ G+  G+IV+F++++
Sbjct:   11 KVLAYTESLHGKWLFSEVEAIFSRRYLLQNTALEIFLSSRTSIMFNLPDATIVKSVVHLLPRVGIGTLYGLPQARRYSLASPRQLFKASNMTQRWQQRDVSNFEYLMFLNTIAACTDPGRTYNDLNQYPVFPWVIANYDSEELDLTLPSNFRDLSKPVGALNPQRAAVFAERYASWDDADIPAFHYGTHYSTAAFVLMWLLRVEPFTNYFLSLQGGKFDHADRTFSSVARAWRNSQRDTSDVKELIPEFFYLPEMFTNSNDYNLGVTDAGVAVGDVVLPPWAKTGEEFVRINRAALESEIVSCQLHQWVDLIFGYKQRGPEAIRAMNVYYYLTYEGAVNMASIRDRVTREAVEAQIRSFGQTPAQLMVEPHAPRSSAMH---------------MVWFPSQTPMMFSNKS---QQEVIMVLKFPSN-----SPVTHVAAN----------TGPMQSPPAILTITCSRLFAINKWNGLCERSSASMEDI---------------MRLPVEIDPLLVANMGLHRRQIMDPVDHSVPTCVNTFTVTADNRFVMLGGFWDKSFRVYSTDTGRLKQAMFGHWDVVTCLARSEVGVGGDCYVASGSRDATVLLWRWSGRELA-LGDRTMHGNMRSPRAILTGHDTEVTSVAVSTELGLAISGSIGSPCLMHTLAGELLRALEGAGATATPLLLAISQDALCFGYYDDGTLLSFSVNGRLSARTPTGD----------------------TTRAMVLSADGQYVLTGGDKGVVEVWRAYDLAKLYTYPMCDSSVRALGLSYDQRVVIAGMAPGSIVLFHINY 754          
BLAST of Neurobeachin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006328.1 (pep scaffold:Pmarinus_7.0:GL479339:689:33391:1 gene:ENSPMAG00000005716.1 transcript:ENSPMAT00000006328.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 414.461 bits (1064), Expect = 1.018e-129
Identity = 184/285 (64.56%), Postives = 230/285 (80.70%), Query Frame = 3
Query: 5994 ITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVK 6848
            +TGPV +STPA L+APG+   G++SIT +E++FE+D  +     L+ KVL Y   LHGKW FSEIRA+FSR+ L +N ALEIF+ANR +VMF FPD  TV+KV+Y LPRVG+G  Y + Q R+ SLASPRQ+FK SNMTQRWQ+REISNF+YL++LNTIAGRTYNDLNQYP+FPWV+ NYESE +DL+ PSN+RDLS P+GALNP R  FF  R+++WDD+    FHYG+HYSTA F L +L+R+EPFTT FLN+Q GKFDH+DRTF S+ + W+NCQRDTSDVK
Sbjct:  150 MTGPVVISTPAQLVAPGLVAKGTLSITATEMFFEVDEEDPAFKKLNPKVLAYTEGLHGKWMFSEIRAVFSRRCLLQNSALEIFMANRTSVMFNFPDHATVKKVVYSLPRVGVGTSYGLPQARRISLASPRQLFKSSNMTQRWQRREISNFEYLIFLNTIAGRTYNDLNQYPVFPWVITNYESEELDLTLPSNFRDLSKPVGALNPKRAAFFVERYESWDDEQVPPFHYGSHYSTAGFTLTWLLRIEPFTTFFLNMQGGKFDHSDRTFSSIIRAWQNCQRDTSDVK 434          

HSP 2 Score: 88.1965 bits (217), Expect = 5.869e-18
Identity = 48/109 (44.04%), Postives = 67/109 (61.47%), Query Frame = 3
Query: 5325 LCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWA-SDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKT 5648
            LCA    ER+ EE++ +HLI +A+ RD   AN+LK ++ +++ + HG W  +  +   EF+RLDYWEDD RRRRRFV NP+GS H +A L  A   G    +I    K 
Sbjct:    7 LCAQYAAERRDEEKMCDHLIGAAKHRDHVTANQLKQKIVNILTNKHGAWGNATASRLQEFWRLDYWEDDLRRRRRFVRNPFGSAHSDATLRAAIEHGADEDVIKQARKA 115          
BLAST of Neurobeachin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000320.1 (pep scaffold:Pmarinus_7.0:GL481331:460:21348:1 gene:ENSPMAG00000000288.1 transcript:ENSPMAT00000000320.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 325.094 bits (832), Expect = 2.609e-97
Identity = 167/373 (44.77%), Postives = 234/373 (62.73%), Query Frame = 3
Query: 6168 KWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIY-----VLPRVGIGIKYCVSQHRKSSLASPRQIFK----LSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESET--IDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDD--DSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDT-SDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKT-PEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPR 7241
            K+ +  +R +  R++L + +A+E+F  +    +  FP    VR  +Y     + P +    +    Q+  +S+ +   +        ++TQRW   EISNF YLM+LNT+AGR+YNDL QYP+FPW+LA+Y+SE   +DL+ P  +RD+S P+GA    R + F  R+++W+D      A+HYGTHYS+A  V +YLVR+EPFT  FL LQ G FD ADR FHSV   W +  R+  +DVKELIPEFFYLP+   NSN Y  G  ++G  + +V+LP WAK    +F+R++R+ALE + VS  LH WIDLIFG KQ+GP A+ STNVF +L YEG V+   I DP+   A    I +FGQ P QL  +PHP +
Sbjct:   26 KFSYEGVREVHKRRYLLQPMAVEVFSNDGRNYLLVFP--RGVRNKVYQRFLTIAPSLADSSESVSGQNPNASVEAGSGLLSGLVGERSVTQRWVHGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYQSEEQELDLTDPRTFRDMSKPMGAQTMERLEQFQKRYQDWEDPNGETPAYHYGTHYSSAMIVASYLVRMEPFTQTFLRLQGGHFDLADRMFHSVRDAWLSASRNNMADVKELIPEFFYLPDFLQNSNHYNLGCKQNGIWLGEVLLPNWAKGDAREFIRVHREALECDYVSAHLHEWIDLIFGCKQQGPMAVASTNVFHHLFYEGQVDIYSITDPLKLTATIGFINNFGQIPKQLFKKPHPAK 396          
BLAST of Neurobeachin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000322.1 (pep scaffold:Pmarinus_7.0:GL481331:12961:21303:1 gene:ENSPMAG00000000288.1 transcript:ENSPMAT00000000322.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 305.834 bits (782), Expect = 3.193e-92
Identity = 150/281 (53.38%), Postives = 195/281 (69.40%), Query Frame = 3
Query: 6420 QQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESET--IDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQS---AFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDT-SDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKT-PEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPR 7241
            Q  EISNF YLM+LNT+AGR+YNDL QYP+FPW+LA+Y+SE   +DL+ P  +RD+S P+GA    R + F  R+++W+D + S   A+HYGTHYS+A  V +YLVR+EPFT  FL LQ G FD ADR FHSV   W +  R+  +DVKELIPEFFYLP+   NSN Y  G  ++G  + +V+LP WAK    +F+R++R+ALE + VS  LH WIDLIFG KQ+GP A+ STNVF +L YEG V+   I DP+   A    I +FGQ P QL  +PHP +
Sbjct:    1 QHGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYQSEEQELDLTDPRTFRDMSKPMGAQTMERLEQFQKRYQDWEDPNGSETPAYHYGTHYSSAMIVASYLVRMEPFTQTFLRLQGGHFDLADRMFHSVRDAWLSASRNNMADVKELIPEFFYLPDFLQNSNHYNLGCKQNGIWLGEVLLPNWAKGDAREFIRVHREALECDYVSAHLHEWIDLIFGCKQQGPMAVASTNVFHHLFYEGQVDIYSITDPLKLTATIGFINNFGQIPKQLFKKPHPAK 281          
BLAST of Neurobeachin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000006.1 (pep scaffold:Pmarinus_7.0:GL476426:99633:131478:1 gene:ENSPMAG00000000006.1 transcript:ENSPMAT00000000006.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 322.013 bits (824), Expect = 2.301e-88
Identity = 171/389 (43.96%), Postives = 238/389 (61.18%), Query Frame = 3
Query: 6048 SVHGSVSITKSELYFEMDANNKN-----NIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVI----YVLPRVGIGIKYCVSQHRKSSL-----------------ASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSA--FHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSE-DGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEG 7127
            +V G + +T   +YF   + +K       +GLD K  C +      W   ++R +  R++  +  ALEIF  ++ +    F  + +         Y LP V  G+ +    H ++ +                  SP+++ K S +TQ+W  REISNF+YLM LNTIAGRTYNDL QYP+FPWVL++Y S+ +DLS+P  +RDLS PIG ++    K   +R++N++D + +   FHYGTHYS AA V++Y++RVEP TTL + LQSG+FD ADR FHS+  TW+      +DVKELIPEFFY PE   N N +  G  +     V++V+LP+WAK+P+DF+R +R ALESE VS  LH WIDLIFGYKQRGP A+ + NVF Y TYEG
Sbjct: 1760 AVPGRLELTTHHVYFYDLSGDKEEGAAPGMGLDFK--CPL------W---QLREVHLRRYNLRRSALEIFFIDQTSYFLNFTKEISCSLYYGTGWYDLPDVH-GVYHTTHLHVRNRVYSRIVGLRPPNLVYYGSRSPQELLKASGITQKWVNREISNFEYLMKLNTIAGRTYNDLAQYPVFPWVLSDYTSDELDLSNPGVFRDLSKPIGIVSERNAKEVKDRYENFEDTTGTTGKFHYGTHYSNAAGVMHYMIRVEPLTTLHIQLQSGRFDCADRQFHSIPATWQALMDSPNDVKELIPEFFYFPEFLENQNGFDLGTLQMSRETVNNVVLPRWAKSPDDFIRKHRAALESEFVSAHLHEWIDLIFGYKQRGPAAVEAHNVFYYCTYEG 2136          

HSP 2 Score: 66.2402 bits (160), Expect = 1.294e-10
Identity = 63/218 (28.90%), Postives = 92/218 (42.20%), Query Frame = 3
Query: 1293 EQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLP----NDGQAISN------------DVVPNIGARL--------INLLFELLYGSPAIRHQLVQSKGILLISYFISRSN 1874
            E  + T L GQ+  +  F ++L P Q+ A+Y  GP+    FK   EC   L+D   K          ++  Y P AC + LCL+ AP       +H     +TG    V+   I   +H +GG+ +L PL  QL  S   P    +DG A S+            D   N  ARL        + LL   +   PA +  L QS+G+  +   I +S 
Sbjct:  678 EWGSPTSLRGQLGSVSVFHDALQPPQVKALYQAGPNNLFPFK-PPECAPELTDLPAK----------MLLYYTPKACQKLLCLDLAP-------SHLFDGRLTGQT--VVNWDIKDVIHCMGGMAVLVPLLEQL-VSTECPAAQQDDGGAFSSPARTSVKLQLGVDTNHNDQARLEGSHVACFLLLLRNFVRNHPANQESLAQSQGMATVGALILQSG 874          
BLAST of Neurobeachin vs. Ensembl Yeast
Match: BPH1 (Protein homologous to Chediak-Higashi syndrome and Beige proteins; both of which are implicated in disease syndromes in human and mouse, respectively, due to defective lysosomal trafficking; mutant phenotype and genetic interactions suggest a role in protein sorting [Source:SGD;Acc:S000000628])

HSP 1 Score: 315.849 bits (808), Expect = 1.213e-86
Identity = 163/403 (40.45%), Postives = 238/403 (59.06%), Query Frame = 3
Query: 6132 QKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRV----------------------------GIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFK---NWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQ-RDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAK-TPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPR 7241
            ++V  ++ H    W   +I  +  R FL +++A+E+    R++  F+F ++     V+ VL ++                            GIG K  ++    S  ++   +     ++++W + EISNF YL+ +N +AGR++NDL QYP+FPWV+A+YES  +DL +P  YRDLS P+GA +  RK  F  R++   + ++   + FHYGTHYS+A  V +YL+R++PF   FL LQ G F  ADR F S+ + W +    +T+DV+EL PEFF+LPE   N N Y FG  + G  VDDV+LP WA   P+ F++ NR+ALES  VS  LH WIDLIFGYKQ+G  A++S NVF  L+Y G+VN D I D   R+A+   I +FGQTP Q+  EPHP +
Sbjct: 1438 KRVSTFLKHEVFVWKLLDITFVTKRPFLLRDVAIELLFKERVSAFFSFYNKRVRDDVLRVLNKIPKHLPADPIFSSVLQEINDRGNSIVARNGIG-KASIASKFTSVFSANNSLIDGFEISKKWVRGEISNFYYLLSINILAGRSFNDLTQYPVFPWVIADYESNVLDLENPKTYRDLSKPMGAQSEKRKLQFIERYEALASLENADSAPFHYGTHYSSAMIVSSYLIRLKPFVESFLLLQGGSFGPADRLFSSLERAWSSASSENTTDVRELTPEFFFLPEFLINVNSYDFGTDQSGKKVDDVVLPPWANGDPKVFIQKNREALESPYVSAHLHEWIDLIFGYKQKGDIAVKSVNVFNRLSYPGAVNLDNIDDENERRAITGIIHNFGQTPLQIFQEPHPEK 1839          
BLAST of Neurobeachin vs. Ensembl Yeast
Match: ASC1 (G-protein beta subunit and guanine dissociation inhibitor for Gpa2p; ortholog of RACK1 that inhibits translation; core component of the small (40S) ribosomal subunit; required to prevent frameshifting at ribosomes stalled at repeated CGA codons; regulates P-body formation induced by replication stress; represses Gcn4p in the absence of amino acid starvation [Source:SGD;Acc:S000004722])

HSP 1 Score: 48.9062 bits (115), Expect = 7.449e-6
Identity = 55/254 (21.65%), Postives = 103/254 (40.55%), Query Frame = 3
Query: 7848 FGVVVCIARSECGFNQDC-------YIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREG-----YILLAAKPCTVLLYTIN-----GKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVD 8558
            FGV V   +      QDC       Y ++ S D T+ LW           D    E+ Q      GH+++++ V I  +  +I+S S+D    + TI+G+ L +LL  + +V   R+V + +       I+ A     V  + +N        IGH                         +S+I+ +  + DG  +A +  DG + +      + +++    D  + SLA + ++ ++      G I +F++D
Sbjct:   54 FGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLW-----------DVATGETYQ---RFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGH-------------------------NSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQD-EVFSLAFSPNRYWLAAATATG-IKVFSLD 266          
BLAST of Neurobeachin vs. Ensembl Nematostella
Match: EDO33951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQQ4])

HSP 1 Score: 450.669 bits (1158), Expect = 6.012e-135
Identity = 299/885 (33.79%), Postives = 447/885 (50.51%), Query Frame = 3
Query: 5943 ESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIY--VLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQS--AFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTI-QGELLRSL--LLSDSFVDPYR---LVISREGYILLAAK---PCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVD 8558
            E  T +NNS++ P  M +   V L     L+     + G + ++ + +YF     N+++   D   +         W  +E+R +  R+   +  ALE F+ ++    +     +  R  +Y  ++      + Y  ++       SP Q+ K S +T+RW +REISNF+YLM LNTIAGRTYNDL+QYP+FPWVL +YES+ +DLS+ + YRDLS PIG LNP+R K  ++R+K+++D + +   FHYGTHYS +A VL YL+RVEPFTTL + L SG+FD ADR FHS+   W +     SDVKEL+PEFFY PE   N N +  G+ + G  V+ V LP WA+TPE+FV  +RQALESE VS  LH WIDLIFGYKQRG +A+ + NVF Y TYEG+V+ D I +   R A E  I +FGQTPSQL+T PH          P+  T                      A  H Q  L     ++       N + HV    +   V   +  P   A    +     I +     M +   S  + +      D L    + +      +DP LS   L  +R++   F   +   +  FA T D R+I   G WD + R+FS++ G+L   +  H   V C++    G     +++TGS D T  LWL  +     +G +       P  T+ GH  E+ CV +S EL + VS S+D  C++HT  +G+ LR+L  + ++    P R   L +S  G I++++       +  Y+ING+ +       +   L+ ++                 + +   GD+V    N G + IR  H++ L+         ITS+++  D   I V LC+G +++  VD
Sbjct:  199 EELTASNNSVSPP--MSVVEKVVLEVDCELVTLMDVMPGKLKVSTTHVYF---TANRSSDAWDLTTVYEF-----TWALAELREVHLRRHNLRRSALEFFLVDQ--TNYFINCSKKARNTVYKKIMSLRPPNLYYMGAR-------SPAQLLKASGLTERWVKREISNFEYLMQLNTIAGRTYNDLSQYPVFPWVLVDYESKDLDLSNRAVYRDLSKPIGVLNPARVKEVEDRYKHFEDPTGTIAKFHYGTHYSNSANVLFYLLRVEPFTTLHVALHSGRFDCADRQFHSIPALWDSLFNKASDVKELVPEFFYFPEFLENLNGFDLGRLQGGARVNHVTLPPWARTPEEFVHKHRQALESEYVSTHLHDWIDLIFGYKQRGEKAVEAHNVFYYCTYEGAVDLDAITNEAERIATEGMINNFGQTPSQLLTTPH----------PVRMTQA-------------------DAAAHKQKALE----IAGTSKPLANVFEHVDKLKAYFVVVTDSCDPLVFAAVPRVQARLLIHHGMPDCMVTVTRSGILGN-----QDWLPYSKTKSRPFTFELDPALSSVKL--RRTVAGPFSPDVTVTSRHFAMTQDARLIITAGHWDNTIRVFSIK-GKLQSRITAHSDTVTCLSIDRDGH----HLMTGSRDTTCRLWLVSH-----VGGWAADVDKSPLQTLYGHDHEVTCVVLSWELDMAVSGSRDGTCIVHTARKGQYLRTLRPMGNEPSSAPCRVTSLGLSEFGGIIVSSNTRDARALTHYSINGRLLA------QERALKDDV-----------------IDIEICGDFVVTGGNSGRLGIRSLHSMNLL-------VPITSVSLAKDNTHIFVTLCDGKLIVIAVD 984          
BLAST of Neurobeachin vs. Ensembl Nematostella
Match: EDO30379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0Y3])

HSP 1 Score: 393.275 bits (1009), Expect = 3.890e-120
Identity = 182/317 (57.41%), Postives = 228/317 (71.92%), Query Frame = 3
Query: 6474 GRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDD-DSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKW 7421
            GRTY DLNQYP+FPW+L NYES+ +DL  P+NYRDL+ PIGALNP+R   F  R+ +WD+ D    FHYGTHYST  F L +L+R+EPF T FLNLQ GKFDH  RTF SV + W+NC RDTSDVKELIPE FYLPEMF NSN + FG  +DG ++DDV LP WA TPE FV I+R ALESE VS Q+H WIDLIFG+KQRGPEA+++TNVF +LTYEGSV+ D I D ++R+A+E QI+SFGQTPSQL+ +PHPPR         +   +   + +  K   N P+ ++ A+        AV+T+S N  + VN+W
Sbjct:    1 GRTYCDLNQYPVFPWILTNYESDKLDLKDPNNYRDLTKPIGALNPNRHVQFLERYASWDENDDIPPFHYGTHYSTCGFTLAWLIRLEPFATQFLNLQGGKFDHPGRTFCSVQRAWQNCNRDTSDVKELIPELFYLPEMFCNSNRFTFGVDDDGMVIDDVELPSWANTPEQFVTIHRAALESEYVSSQIHGWIDLIFGFKQRGPEAVKATNVFFHLTYEGSVDLDSISDTVMREAVEQQIKSFGQTPSQLLLDPHPPR---------VTQEMQVCIFLTFKVTENVPVTYVAAHTDQHITTPAVVTISCNQCFSVNRW 308          

HSP 2 Score: 155.221 bits (391), Expect = 6.905e-39
Identity = 91/278 (32.73%), Postives = 142/278 (51.08%), Query Frame = 3
Query: 7641 LSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCI--ARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCD 8468
            +  DP+L   +   +R LGE  D  + P    F  T DNR I A G+WD SF+ FS E+G+L Q V+GH  VV C+  +R +     D  +V+GS D T+++W W  R   +    N  + + P   +TGH+  I CV ++  LG++VS S++  CL+HT+ G+ L +L   D  V P  + +   G IL+         YT +    GHL     N  +R   +LD   +         ++ALT+DG+++        + + R ++L  +HSYP CD
Sbjct:  320 IEQDPMLGTPSGRQRRQLGEPLDQTVTPSASCFVVTCDNRTIMACGYWDNSFKCFSTESGKLTQCVFGHSDVVTCLVYSRHQGLAGGDAIVVSGSRDATVLVWHWSERIQRVTAASNSVDPS-PLAILTGHEQPITCVDVNAALGLVVSGSQEGPCLVHTVSGDRLYTLHGPDDCVRPRLVRLVPGGLILVN--------YTDDS---GHLAVYTINGLMRAKRKLDDHVL---------SLALTRDGNFMLAGGFSRSLTVWRTYDLAFIHSYPPCD 576          
BLAST of Neurobeachin vs. Ensembl Nematostella
Match: EDO45998 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRE1])

HSP 1 Score: 336.65 bits (862), Expect = 2.341e-97
Identity = 238/722 (32.96%), Postives = 343/722 (47.51%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAF---PDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLP-EMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNY-VSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTIT-GHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRS 8138
            D+   + + T A  + P V   G V +T S LYF+      NN      V C +         S+I  +  R++L +++ +EIF  +   +        D++   + +   P V +                     +  NMT +WQ   I+NFDYLMYLN+ + R++NDL QYP+FPWV+A+Y S  +DL  P  +RDL+ PIGALNP+R      R +   D ++  F YG+HYST  +VL YLVRV P     L LQ GKFD  DR F+S+ +TW+N     +DVKELIPEF+    E   N  +   G  +D + V DV LP WA   EDF+R NR+ALE   VS +L+HWIDLIFGYKQRG EA  + NVF YLTYEG+V+ D I DP  R +LE QI  FGQTP QL T PHP R   +  +P M               S SP+V    N   +   +     +   V       HV  D     ++     P +   +L  +++  +        + ++ + R+S       D  H + VS + QL +           I ++    G +L   P +   A  PD + I  G  WD    I+SVE GR+L    GH   + C+  +      D  +VT S D T+ +W         +     R+ A P +     H  E+  V +     ++V+ + D   L+  I  + + S
Sbjct:  128 DLYEKIVMETTAKRITPLVCNPGRVMLTSSRLYFQ----PFNNADPCPVVKCKL---------SQISRVVKRRYLLRHVGIEIFSKDSSQMYLVLNSQSDRDQFYRELLKQPDVNLDDT------------------EQENMTLKWQNGAITNFDYLMYLNSSSDRSFNDLTQYPVFPWVIADYTSSQLDLRDPLTFRDLAKPIGALNPNRLNQLKERCR---DMTEPKFLYGSHYSTPGYVLYYLVRVAP--EFMLCLQGGKFDQPDRLFNSIQETWENVLTGHADVKELIPEFYQSSGEFLVNCQNLPLGMKQDKSNVGDVELPAWATDCEDFIRKNREALECPYVSERLNHWIDLIFGYKQRGEEAWEADNVFYYLTYEGAVDLDSITDPNERASLESQILEFGQTPKQLFTSPHPQR--LVSATPTMGA-------------SPSPLVHSVVNGTSEQHCARESHETIPVV-------HVNVDFEGSQLSNDAMAPWTRMESLDKSSAHKLH-------KDTVTAVRLSR------DCRHVFSVSQDTQLKMYS---------IEEKQQVRGINLSSMPLS-SCAIMPDAKTIVVGS-WDNKIYIYSVEYGRVLDTTTGHDDAISCLCWN------DGILVTASWDSTVKVW-------KFMPAPEGRKPAPPSILAELDHDTEVNSVDLDPTNTLVVTGTMDGNVLLWNIDQQAIIS 754          
BLAST of Neurobeachin vs. Ensembl Nematostella
Match: EDO46742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNV7])

HSP 1 Score: 166.007 bits (419), Expect = 8.533e-43
Identity = 84/161 (52.17%), Postives = 111/161 (68.94%), Query Frame = 3
Query: 6765 GKFDHADRTFHSVAQTWK-NCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKT-PEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPR 7241
            G FD  DRTFHS+A TW+ +  +  +DVKELIPEFF+LPE   N   + FG  ++G  V DV LP WAK  P  F+ I+RQALE+++VS  LH+WIDLIFG+KQ G +A+ + NVF   TY G V+ + I DP+  +AL+  I ++GQTP+QL T PH PR
Sbjct:    2 GNFDQPDRTFHSLATTWRLSSYQSPTDVKELIPEFFFLPEFLENFEGFDFGFRQNGVRVMDVSLPPWAKNNPRLFILIHRQALETDIVSQHLHNWIDLIFGFKQTGKDAVEALNVFHPATYFG-VDINSITDPISNKALKTMIETYGQTPTQLFTYPHSPR 161          
BLAST of Neurobeachin vs. Ensembl Nematostella
Match: EDO41755 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3D6])

HSP 1 Score: 140.584 bits (353), Expect = 1.190e-38
Identity = 62/112 (55.36%), Postives = 84/112 (75.00%), Query Frame = 3
Query: 6138 VLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIA 6473
            VL YM  LHGKW   +I+A+FSR++L +N A+E+F AN  + MF FPD ++V+KV+  LP VG+G  Y + Q R SSL SP+Q+F+ S MT RWQ+RE+S F+YLM+LNTIA
Sbjct:    1 VLLYMDGLHGKWPIDQIKAVFSRRYLLQNCAVEVFFANGTSAMFKFPDHDSVKKVVRALPPVGVGAYYGIPQTRTSSLYSPKQLFEKSTMTSRWQKREVSTFEYLMFLNTIA 112          
BLAST of Neurobeachin vs. Ensembl Medaka
Match: lrba (LPS responsive beige-like anchor protein [Source:NCBI gene;Acc:101175296])

HSP 1 Score: 907.901 bits (2345), Expect = 0.000e+0
Identity = 428/886 (48.31%), Postives = 592/886 (66.82%), Query Frame = 3
Query: 5943 ESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTP-VHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRES-AQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            E E  T +SL +    ++TGPV LST A L+AP   V G++S+T SEL+FE+D +  +   +D K+L Y   LHGKW F+EIRA+FSR++L +N ALE+F+ANR AV+F FPD  TV+KV++ LPRVG+G  + + Q R+ SLA+P+Q+FK SNMTQRWQ+REISNF+YLM+LNTI+GRTYNDLNQYP+FPWV+ NY+SE +DL+ PSN+RDLS PIGALNP R  FF +R+++W+DD    FHYGTHYST++F L +L+R+EPFTT FLN Q GKFDHADRTF SV++ W+NCQRDTSDVKELIPEF+YLPEMF NSN+Y  G  EDG +V +V+LP WAK+PE+FVRINR ALESE VSCQLH WIDLIFGYKQ+GPEA R+ NV+ Y+TYEG+VN   I DPM+R+A+E QIRSFGQTP QL+ EPHPPR+SA+ V+PLMFT  +  D++M+LKF SNSP+ ++ AN  P    +A++TV+AN ++ VNKW+ +  +  ++                                      Y++       P ++   ++SNV                ++R + +  D  ++  +  F  T DNR I   GFWDKSFR++S ++G+L Q+V+GH  VV C+ARSE     DCYI++GS D T++LW W N +   +G+    ES   PR  +TGH  E+ C  +  ELG+++S  K+  CLIH++ G+LLR+L   D+ + P  +  S EG+ ++  +     L+++NGK + H+   D                      SI AM L++DG Y+    + G + + + +NL+ + SYP CDA + S+A++ DQR I+ G+ +G+IV+F  DFN+WHHEY+ RY
Sbjct: 1901 EGEDDTLSSLEEKDLENLTGPVNLSTSAQLVAPAAVVKGTLSVTASELFFEVDEDEPSFKAIDPKILAYTEGLHGKWLFTEIRAVFSRRYLLQNTALEVFMANRTAVLFNFPDAATVKKVVHCLPRVGVGTSFGLPQTRRISLATPKQLFKASNMTQRWQRREISNFEYLMFLNTISGRTYNDLNQYPVFPWVITNYDSEELDLTLPSNFRDLSKPIGALNPKRAAFFSDRYESWEDDQVPKFHYGTHYSTSSFTLMWLLRIEPFTTFFLNFQGGKFDHADRTFSSVSRAWRNCQRDTSDVKELIPEFYYLPEMFVNSNNYNLGVMEDGTVVSNVVLPPWAKSPEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEATRALNVYYYVTYEGAVNLSSINDPMLREAVESQIRSFGQTPCQLLIEPHPPRSSAMQVTPLMFTEQMQQDVIMVLKFPSNSPVTYVAANTQPGLTSAAIITVTANRLFAVNKWHGLTGEAQQQ--------------------------------------YQL-------PVEIDPLIASNVG--------------AHRRQISDLLDQSIQISSQCFVITADNRFILLCGFWDKSFRVYSTDSGKLTQIVFGHRDVVTCLARSESYIGGDCYILSGSRDATLLLWYW-NGKLCSIGETPGSESFTTPRAILTGHDCEVTCASVCAELGLVISGCKEGPCLIHSMNGDLLRTLEGPDNCLQPRLIQSSSEGHCVVYYEKGQFCLFSVNGKLLAHMEVED----------------------SIKAMLLSRDGQYLLTGGDGGVICVWQVYNLKQLFSYPGCDAGVRSMAMSHDQRCIITGMASGSIVLFYNDFNRWHHEYQTRY 2704          

HSP 2 Score: 780.785 bits (2015), Expect = 0.000e+0
Identity = 392/920 (42.61%), Postives = 600/920 (65.22%), Query Frame = 3
Query:  462 LVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKV 3221
            LV G FD+E NF+I   + ++ +++++   +   +AE+ S+F  +++KS  NL    E   I++ L+ + T D M ADLL++MLG++AS+S++VKELK  F  L+G    WP H+V+LL+VL+ M +R+GPD FF+FPG   +AIA+PPI+KWPYQNG+TF+ W+ +DP + +N+D+DKPYLYCFRTNKGLGYS HFVG  L++T++K K KG QHCVKY+ +P++WYMV+VV+VYNRW  SEI CY++GEL S  ++PW +NT++ FD+CF+G+S       +  GQ+  +Y FAE+L+  QI AIY LGP Y+G FK  AE     ++  +   ++G+L  S+ F YNP A D QLCL  +PK N  +F HS HALM  +V+ V+T S+ S +HS+GGV++LFPLF+QLD  YR P+     S ++  ++   L++ + ELL  S A++ Q++  KG L+I Y + RS                     S++H+                    T P        S  + N+ NG                   + L+K + D +L N A+WIHA  +VQL L+ +LA +F+S   ++N  R +  VLQ ++++KYYYW+VNP+DRSG++ K  +  P  N +++ ++R+ +  FIK+L++K H GV ++E+Q  LN+L  ++ED+N+  VL   V LMSE P +M+ AFD ++GI+V++KLL S  E +R+ ALK++G++L+  + KRK + M+ + LF+L+ ERL L+S   TM  YN L+EI+TE++  ++    H  PD T  + NP +LKVIA L++ S  + E ++VR++FL+D+  L NNS+ENRR++LQ SVWQDW+  L  ++P+  +++++ + V  + R+LL+HA+K E+GGWRVW+DTL+I HSKV
Sbjct:    1 LVGGQFDLEMNFIIQEPESIVCLVELLDKCEPTCQAEIWSIFTAILKKSVRNLQACTEVGLIQQVLQRISTTDSMIADLLVDMLGVLASYSITVKELKLFFSKLQGEKGQWPCHAVKLLSVLKYMALRNGPDSFFSFPGKNAAAIALPPIAKWPYQNGFTFHTWLRMDPLNNINVDKDKPYLYCFRTNKGLGYSAHFVGGCLIVTSLKSKGKGFQHCVKYDFKPQKWYMVTVVHVYNRWKNSEISCYVNGELASFGDIPWFVNTSDTFDKCFLGSSETADVNRVFCGQMGAVYLFAEALSAAQILAIYQLGPGYQGTFKHRAESDLLFAEHHKTLLYDGKLSSSIAFTYNPRATDAQLCLESSPKDNASIFVHSPHALMLQDVKAVVTHSVQSGIHSIGGVQVLFPLFAQLD--YRQPS-----SQELDTSVCWTLLSFMMELLKNSVAMQEQVLACKGFLVIGYTLERS---------------------SKVHV--------------------TRPVLDIVLAFSRYLSNLQNG-------------------ILLLKQLCDNILFNPAIWIHAPAKVQLTLYTYLATEFISTVTIYNAIRRVGTVLQVMHTLKYYYWIVNPQDRSGVVPKGVD-GPRPNQKELFSLRAFLLLFIKQLIMKDH-GVKEDELQSILNFLLTMHEDENLMDVLQLLVALMSEHPGSMIQAFDQRNGIRVVYKLLGSKSEGIRVQALKVMGYFLKSLSPKRKTEVMMSNGLFSLMSERLALHSNQFTMTTYNVLFEILTEQICTQVIHKQHPDPDSTVKILNPQILKVIAALLKSSPQSPESMEVRRVFLSDMIKLFNNSRENRRSLLQCSVWQDWMLSLCFINPRNSEEQKITEMVYAIFRILLYHAIKYEWGGWRVWVDTLSITHSKV 851          

HSP 3 Score: 254.603 bits (649), Expect = 5.933e-67
Identity = 139/281 (49.47%), Postives = 186/281 (66.19%), Query Frame = 3
Query: 4902 IIDRDDEDYPKSNFPSSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSG--LVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWA-SDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTS 5735
            ++   D     S   ++ ++++RLE AL   APL+REIF DF+ +LSRTL+GSHGQEL+  G  LV ++ S+SVVE+VMLLCSQEWQNS+QK+AGLAFIELVNEGRLL+H   DH VRVANEA FILSR RAED+ KH+EF   CA    E++ EE++ +HLI +A+ RD     +L  ++ +++   HG W  S  +   EF+RLDYWEDD RRRRRF+ NP+GS+H EA L  A+       I+  K K  I    L   N +S     +   D+T++S
Sbjct: 1633 VVSSGDTSQSTSADAAACNISERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSHTMKDHLVRVANEAEFILSRQRAEDIHKHAEFESQCAQYAAEKRDEEKMCDHLIRAAKYRDHMTGTQLIQKIVNILTDKHGAWGNSSISRPREFWRLDYWEDDLRRRRRFIRNPFGSSHSEATLKAAAEHASDEDIL--KGKQSIRNQVLGNQNSESET--SLEGEDDTLSS 1909          

HSP 4 Score: 243.047 bits (619), Expect = 1.963e-63
Identity = 141/305 (46.23%), Postives = 198/305 (64.92%), Query Frame = 3
Query: 3477 CDLVTESAVA-------QSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            C+L    AVA        S  + +  +P PRS  FRIP F WS +HQRLL DLL SIE+D+Q+W+ ++ + I + VN +EN V+V N VHL++ + D+LI  CGG+LPLL+AATS S +++ +E   G+ +  +V F+ R++N+AD+++FAS LNF E+E EK MS+GGILRQCLRLVC  AVRNCLE +   L +      ++  +H             P P+  +  G+                 PI D + LLQ+MDINRLRA+V+RD+ ++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct: 1179 CELNPGQAVAAAPEAGSSSGQQREGGTPAPRSTMFRIPEFRWSHMHQRLLTDLLFSIETDVQMWRSNSTKTIPDIVNNSENIVFVHNSVHLISQVVDNLIMACGGILPLLSAATSSSHELENIEPSQGLTLEASVTFMQRLINLADVLIFASCLNFTEIEAEKNMSSGGILRQCLRLVCAMAVRNCLECQQTQLKH---GAESVVRSH-------------PSPVDAVTGGMS----------------PIRDLDRLLQDMDINRLRAIVFRDIVDSKQAQFLALAVVYFISVLMVSKYRDILEP 1451          
BLAST of Neurobeachin vs. Ensembl Medaka
Match: nbeab (neurobeachin [Source:NCBI gene;Acc:101155372])

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 412/878 (46.92%), Postives = 565/878 (64.35%), Query Frame = 3
Query: 5991 DITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHV-----SPLMFT-PVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFN----CRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRY 8594
            ++ GP+ LS+ A L+AP ++  G++SIT SE+YFE++ ++ +   +D KVL +   LHGKW FSEIRA+FSR +L +N ALE+F+ANR +VMF  PDQ TV+ V++ LPRVG+G  Y + Q R+ SLA+PRQ+FK SNMTQRWQ+REISNF+YLM+LNTIAGRTYNDLNQYP+FPWVL NY+SE +DL+ P N+RDLS P+GALNP R  F+  R+  W+DD   + HY +HYS+ +  L++LVR+EPFTT +L     KFDH DRTF S+A++W++CQRDTSDVKELIPEF+YLPEMF NS++Y  G  EDG+ + DV LP WAK PEDFVRINR ALESE VSCQLH WIDLIFGYKQRGPEA+R+ NVF +LTYEGSVN D I D  +RQA E  I+SFGQTPSQL+ EPHPPR+SA+H+     SPLMF   +  D++M+LKF SNSP+  + AN  P   + AV+TV+ + ++ VN+W++                   L GA                           S+D  H             LP+ MD +++  T  NK  + +  D  +R     F  T DNR I    FWDKSFR++S ETG+L Q+V+GH+ VV C+ARSE     DCYIV+GS D T++LW W  R H + G ++          PR  +TGH  E+VCV +  ELG+++S +K+  CL+HTI G+LLR+L      + P  + +S EG+ ++  +      ++INGK             L   ME+  S           A+ L+ DG  +    ++G V + +  + + ++ YP CDA + ++ ++ DQR ++ G+ +G+IV FN+DFN+WH+E++  Y
Sbjct: 1507 NLGGPLVLSSSAQLIAPALAARGTLSITASEIYFEVNEDDPDFRKVDPKVLAHTEGLHGKWMFSEIRAVFSRCYLLQNTALEVFMANRTSVMFNLPDQATVKNVVHSLPRVGVGTSYGLPQARRISLATPRQLFKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYDSEELDLTLPRNFRDLSKPVGALNPKRAAFYGERYGTWEDDQTPSCHYTSHYSSTSTTLHWLVRIEPFTTFYLCSNKNKFDHPDRTFSSIARSWRSCQRDTSDVKELIPEFYYLPEMFVNSSNYNLGMREDGSRISDVELPAWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFHHLTYEGSVNLDGIGDLSLRQATEAHIQSFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVG----------------LRGAPGY------------------------SLDQAH------------HLPIEMDSVIANNTGSNKHQITDLVDQSIRITTHCFVVTADNRYILVCSFWDKSFRVYSSETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIDGHYHFIFLLYLCFAPRAVLTGHDQEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPAYCLCPRLISVSSEGHCIIYYERGHFCNFSINGK-------------LLAQMEIKDST---------RAIILSSDGHNLVTGGDNGVVEVWQACDFKQLYVYPGCDAGVRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQTGY 2310          

HSP 2 Score: 335.109 bits (858), Expect = 1.545e-91
Identity = 163/374 (43.58%), Postives = 265/374 (70.86%), Query Frame = 3
Query: 2136 LVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKV 3257
            ++K + D++L N A+WIH   +VQL L+ +L+ +F+    +++  R +  VLQ ++ +KYYYW+ NP D SGI  K  +  P    +++T++R+ I  F+K+L+LK   GV ++E+QG LNYL   +EDDN+  VL   V LMSE P++M+PAFD ++GI+VI+KLLAS  E +R+ +LK+L ++L+   +KRK + M  H+LFTL+GE+L++++  L++ +YNTLYEI+TE++  ++    H  PD T  ++NP +LKV+A L++    + EL++VR++FL+D+  L ++S+ENRR +LQ SVWQDW+F L  ++P+  +++++ D V N+ R+LL+HA+K E+GGWRVW+DTL+I HSKV Y   +  + K+
Sbjct:   24 MLKQLCDHILFNAAIWIHTPAKVQLSLYTYLSAEFIGTATIYSTIRRVGTVLQLMHMLKYYYWITNPADSSGIAPKGLD-GPRPTQKEVTSLRAFILLFLKQLILK-DRGVKEDELQGILNYLLTTHEDDNLHDVLQLVVALMSEHPASMIPAFDQRNGIRVIYKLLASKSENIRVQSLKVLAYFLKHLGHKRKVEIMHTHSLFTLLGEKLMIHTNTLSVTIYNTLYEILTEQVCTQVVHKPHLEPDSTVKIQNPMILKVVATLLKNCAPSSELMEVRRLFLSDMIKLFSSSRENRRCLLQCSVWQDWMFSLCYINPKNSEEQKISDMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKM 395          

HSP 3 Score: 263.848 bits (673), Expect = 8.325e-70
Identity = 129/210 (61.43%), Postives = 164/210 (78.10%), Query Frame = 3
Query: 4950 STSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWA-SDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTH 5576
            S S+T +LE+AL   APL+REIF DF+ +LSRTL+GSHGQEL+  GLV ++ STSVVE+VMLLCSQEWQNS+QK++GLAFIEL+NEGRLL HA  DH VRVANEA FIL+R RAEDV KH+EF   C+    +R+ EE++ +HLI +A+ RD   AN+LK ++ +++ + HG W    Q+   +F+RLDYWEDD RRRRRFV NPYGSTH
Sbjct: 1240 SMSITTKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGLVCMKSSTSVVELVMLLCSQEWQNSIQKNSGLAFIELINEGRLLCHAMKDHVVRVANEAEFILNRQRAEDVHKHAEFESHCSQYAADRREEEKMCDHLITAAKRRDHVTANQLKQKIVNILTNKHGAWGMPSQSRLQDFWRLDYWEDDLRRRRRFVRNPYGSTH 1449          

HSP 4 Score: 241.891 bits (616), Expect = 3.406e-63
Identity = 141/330 (42.73%), Postives = 209/330 (63.33%), Query Frame = 3
Query: 3387 ENVKEERPSQSVDLAESVAKMIIDDIVGTACDLVTESAVAQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFR--DLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEP 4370
            EN K++   ++    ++V   ++       C  +     A +      FSPGPR+  FRIP F WS  HQRLL DLL ++ESD+ +W+  + +++++FVN+ EN ++V N +HL++ + D++I  CGG+LPLL+AATSPS +++ +E   GM+   A+ FL R+M + +++VF+SSLNF E+E EK MS+GG++RQCLRLVC  AVRNCLE R R  +   +L  + N+   +S     +  +NL                             PI +P+ LLQ+ DINRLRAVV+RDV+++KQAQFLAL++VYF+SVLMVS+YRD+LEP
Sbjct:  689 ENGKDKEKIRTTATTQNVHGRLVSQTERDICVDLGFQGTATTEERRHQFSPGPRTTMFRIPEFKWSSTHQRLLTDLLFALESDVHVWRSQSTKSVIDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPSTELENMEATQGMSSDTAITFLSRLMVMVEVLVFSSSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRHSNQTQELLQKPNI-GTYSKPSIERLPNNLS----------------------------PIKNPDRLLQDEDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEP 989          
BLAST of Neurobeachin vs. Ensembl Medaka
Match: nbeal2 (neurobeachin like 2 [Source:NCBI gene;Acc:101163272])

HSP 1 Score: 444.891 bits (1143), Expect = 5.916e-125
Identity = 306/877 (34.89%), Postives = 448/877 (51.08%), Query Frame = 3
Query: 6006 VFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKN----NIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIY--VLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQS--AFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSE-DGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDS--PHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTI-QGELLRSLL-LSDSFV--DPYRLVISREGYILL---------------AAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVI 8546
            + LS    L+     V G + +T   LYF   ++ K      IG D            K   S++R +  R++  +  ALE+F  ++      F  ++ VR  +Y  +L      + Y  S+       SP+++ K S +TQ+W  REISNF+YLM LNTIAGRTYNDL+QYP+FPWVL +Y S T+DLS PS +RDLS PIG +NP   +    ++++++D + +   FHYGTHYS AA V++Y++R+EPFTTL + LQSG+FD ADR FHSVA  W+      +DVKELIPEFFY PE   N N +  G+ +     V DV LP+WA + EDF+R +R+ALESE VS  LH WIDLIFG KQRG EA+ + NVF Y TYEG+V+ D I +   R+A E  I +FGQTP QL+ EPHP R                                MTA  +    L+ + T+ AN       + H+A   S + V +   +P  L  AL   T       Q  NM  S++S  +    S  P+   + NY + N       DP ++      +R L   F   +         + D R++F+GG WD S R+  +  G+L+  +  H  +V C+A   CG     Y+++GS D + ++W     Q    G+F+C  S +P    +GH  E+ CV IS EL + VS SKD   ++HTI +G+  R+L   SDS V      L +  EG+I++                A   ++ +Y++NG                    L S  M+      I+A+ L    +YV L S  G + IR  ++L+ + +       + S+++T +   ILVGL +G +++
Sbjct: 1991 LVLSEDCELITIVAVVPGRLEVTTHHLYFYDGSSEKEETEEGIGFD-----------FKRPLSQLREVHLRRYNLRRSALELFFIDQSHYFINF--KKKVRNKVYSRILGLRPPNLFYFGSR-------SPQELLKASGLTQKWVYREISNFEYLMQLNTIAGRTYNDLSQYPVFPWVLCDYTSPTLDLSDPSIFRDLSKPIGVVNPRHAQNVREKYESFEDPTGNIDKFHYGTHYSNAAGVMHYMIRMEPFTTLHIQLQSGRFDVADRQFHSVAAAWQARMESPADVKELIPEFFYFPEFLQNMNGFDLGRLQISQEAVTDVELPRWATSREDFIRKHRKALESEHVSSHLHEWIDLIFGCKQRGEEAVNALNVFYYCTYEGAVDLDAIANETERKAYEGIISNFGQTPCQLLKEPHPSR--------------------------------MTAE-NAARRLARLDTLPANI------FEHLAKLRSFKEVVSD-GIP--LVQALVPKTHHRSSIIQGSNMLVSVSSNGLIGTHSWLPYDKNIANYFTFN------KDPTMTNPK--TQRFLSGPFSPGVEISTKVLVVSNDGRLLFSGGHWDCSLRVTQLAKGKLVGRICRHIDIVTCLALDLCGI----YLISGSRDTSCIVW-----QVIQQGEFSCGLSPRPVQIFSGHDQEVTCVAISTELDMAVSGSKDGTVIVHTIRRGQFQRTLRPPSDSCVPMQISELQVGMEGHIVVQTSQKEHCHTKVREQKAGKYSIYVYSVNG------------------CLLSSFTMEE----QITAVHLV--SEYVILGSMQGSLHIRDLYSLDALVTPLALRVPVRSVSVTKECSHILVGLEDGKLIV 2764          
BLAST of Neurobeachin vs. Ensembl Medaka
Match: ENSORLT00000042519.1 (pep primary_assembly:ASM223467v1:14:10129029:10132059:1 gene:ENSORLG00000027176.1 transcript:ENSORLT00000042519.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 396.356 bits (1017), Expect = 5.983e-125
Identity = 179/276 (64.86%), Postives = 218/276 (78.99%), Query Frame = 3
Query: 6177 FSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQA 7004
            FSEIRA+FSR+FL +N  LE+F+ANR +VMF FPDQ TV++V+Y LPRVG+G  Y + Q R+ SLA+PRQ+FK SNMTQRWQ+REISNF+YLM+LNTIAGRTYNDLNQYP+FPWVL NY+SE IDL+ P N+RDLS PIGALNP R  F+   +++WDDDS    HY T YSTA   L +++R+EPFTT FLN    KFDH +R+F  + + W+NCQRDT+DVKELIPEF+YLPEMF NSN++  G  +DG  V DV LP WAK PEDFVRINR  
Sbjct:    2 FSEIRAVFSRRFLLQNTGLEVFMANRTSVMFNFPDQATVKRVVYSLPRVGVGTSYGLPQARRISLATPRQLFKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYDSEEIDLTLPGNFRDLSKPIGALNPKRAAFYAEHYESWDDDSTPPHHYTTLYSTAHSTLMWMLRIEPFTTFFLNANDAKFDHPERSFSGIGRAWRNCQRDTADVKELIPEFYYLPEMFVNSNEFELGLRDDGISVCDVELPIWAKKPEDFVRINRMV 277          
BLAST of Neurobeachin vs. Ensembl Medaka
Match: wdfy3 (WD repeat and FYVE domain containing 3 [Source:NCBI gene;Acc:101161316])

HSP 1 Score: 352.058 bits (902), Expect = 1.558e-96
Identity = 169/368 (45.92%), Postives = 243/368 (66.03%), Query Frame = 3
Query: 6177 FSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIY-----VLPRVGIGIKYCVSQHRKSSLASPRQIFKL----SNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDD--DSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQR-DTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKT-PEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPR 7241
            + +I+ +  R++L + +A+E+F A+    + AF  Q+ VR  +Y     V+P +    +    Q   +S+     +        ++TQRW++ EISNF YLM+LNT+AGR+YNDL QYP+FPW+LA+Y+SE +DL++P ++R+L+ P+GA    R   +  R+K+W+D      A+HYGTHYS+A  V +YLVR+EPFT +FL LQ G FD ADR FHSV + W +  + + +DVKELIPEFFYLPE   NSN++  G  ++G  + DV+LP WAK  P +F+R++R+ALE + VS  LH WIDLIFGYKQ+GP A+ + NVF +L YEG V+   I DP+   A    I +FGQ P QL  +PHPP+
Sbjct: 2603 YEDIKEVHKRRYLLQPMAVEVFSADGRNYLLAF--QKGVRNKVYQRFLAVVPSLADSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSEEVDLNNPKSFRNLAKPMGAQTDDRLTQYKKRYKDWEDPNGETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWLSASKHNMADVKELIPEFFYLPEFLLNSNNFDLGAKQNGTKLGDVLLPSWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPPAVEAVNVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIPKQLFKKPHPPK 2968          
BLAST of Neurobeachin vs. Planmine SMEST
Match: SMESG000017089.1 (SMESG000017089.1)

HSP 1 Score: 5568.05 bits (14443), Expect = 0.000e+0
Identity = 2832/2837 (99.82%), Postives = 2834/2837 (99.89%), Query Frame = 3
Query:   93 MSETKIDQNFENKTSSEEMMDKDTNPNHTDLNTETTQIQSEISLDIQKPLNEDVNNNDEEKFSSPQNSKLDDNRSNIKDSFAEKIYLIKSMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINTXXXXXXXXXXXXXXXXXDENVKEERPSQSVDLAESVAKMIIDDIVGTACDLVTESAVAQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETNDQDRDKFEKLNHEKADVCATVEEEDEEIHYSQTENKTDTLXXXXXXXXXXXXXXXXNQXXXXXXXXXXXIYAREISFESDGRKSRIXXXXXXXXXXXXXXXXXXAAILDENENENEKTPPISSIQIDNHADNSSGRFQQFTSTLPQFPEQRVTDNRKHEIIDRDDEDYPKSNFPSSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEPRSNEDNXXXXXXXXXXXXXXXXYKIPDNKDSNQNKISDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRYPAL 8603
            MSETKIDQNFENKTSSEEMMDKDTNPNHTDLNTETTQIQSEISLDIQKPLNED NNNDEEKFSSPQNSKLDDNRSNIKDSFAEKIYLIKSMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFPGSIGSAIAIPPISKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTE LLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLC+NSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMLDAVLNLVRLLLHHAMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINTASRASSSSGYRMSMEYGDENVKEERPSQSVDLAESVAKMIIDDIV TACDLVTESAVAQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLITCCGGLLPLLAAATSPSGDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETNDQDRDKFEKLNHEKADVCATVEEEDEEIHYSQTENKTDTLRVEEEIEENVSEEIRNNQEDEEEDECDDDIYAREISFESDGRKSRISGNVSNEDSEESDSKNTSAAILDENENENEKTPPISSIQIDNHADNSSGRFQQFTSTLPQFPEQRVTDNRKHEIIDRDDEDYPKSNFPSSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEPRSNEDNQLEADLDSEQDLSESSYKIPDNKDSNQNKISDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVR+RRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRYPAL
Sbjct:    1 MSETKIDQNFENKTSSEEMMDKDTNPNHTDLNTETTQIQSEISLDIQKPLNEDENNNDEEKFSSPQNSKLDDNRSNIKDSFAEKIYLIKSMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFPGSIGSAIAIPPISKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTEALLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCSNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMLDAVLNLVRLLLHHAMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINTASRASSSSGYRMSMEYGDENVKEERPSQSVDLAESVAKMIIDDIVVTACDLVTESAVAQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLITCCGGLLPLLAAATSPSGDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETNDQDRDKFEKLNHEKADVCATVEEEDEEIHYSQTENKTDTLRVEEEIEENVSEEIRNNQEDEEEDECDDDIYAREISFESDGRKSRISGNVSNEDSEESDSKNTSAAILDENENENEKTPPISSIQIDNHADNSSGRFQQFTSTLPQFPEQRVTDNRKHEIIDRDDEDYPKSNFPSSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEPRSNEDNQLEADLDSEQDLSESSYKIPDNKDSNQNKISDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRVRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRYPAL 2837          
BLAST of Neurobeachin vs. Planmine SMEST
Match: SMESG000017089.1 (SMESG000017089.1)

HSP 1 Score: 5559.57 bits (14421), Expect = 0.000e+0
Identity = 2832/2839 (99.75%), Postives = 2834/2839 (99.82%), Query Frame = 3
Query:   93 MSETKIDQNFENKTSSEEMMDKDTNPNHTDLNTETTQIQSEISLDIQKPLNEDVNNNDEEKFSSPQNSKLDDNRSNIKDSFAEKIYLIKSMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINTXXXXXXXXXXXXXXXXXDENVKEERPSQSVDLAESVAKMIIDDIVGTACDLVTESAVAQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETNDQDRDKFEKLNHEKADVCATVEEEDEEIHYSQTENKTDTLXXXXXXXXXXXXXXXXNQXXXXXXXXXXXIYAREISFESDGRKSRIXXXXXXXXXXXXXXXXXXAAILDENENENEKTPPISSIQIDNHADNSSGRFQQFTSTLPQFPEQRVTDNRKHEIIDRDDEDYPKSNFPSSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEPRSNEDNXXXXXXXXXXXXXXXXYKIPDNKDSNQNKISDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASK--DSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRYPAL 8603
            MSETKIDQNFENKTSSEEMMDKDTNPNHTDLNTETTQIQSEISLDIQKPLNED NNNDEEKFSSPQNSKLDDNRSNIKDSFAEKIYLIKSMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFPGSIGSAIAIPPISKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTE LLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLC+NSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMLDAVLNLVRLLLHHAMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINTASRASSSSGYRMSMEYGDENVKEERPSQSVDLAESVAKMIIDDIV TACDLVTESAVAQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLITCCGGLLPLLAAATSPSGDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETNDQDRDKFEKLNHEKADVCATVEEEDEEIHYSQTENKTDTLRVEEEIEENVSEEIRNNQEDEEEDECDDDIYAREISFESDGRKSRISGNVSNEDSEESDSKNTSAAILDENENENEKTPPISSIQIDNHADNSSGRFQQFTSTLPQFPEQRVTDNRKHEIIDRDDEDYPKSNFPSSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEPRSNEDNQLEADLDSEQDLSESSYKIPDNKDSNQNKISDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASK  DSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVR+RRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRYPAL
Sbjct:    1 MSETKIDQNFENKTSSEEMMDKDTNPNHTDLNTETTQIQSEISLDIQKPLNEDENNNDEEKFSSPQNSKLDDNRSNIKDSFAEKIYLIKSMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFPGSIGSAIAIPPISKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTEALLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCSNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMLDAVLNLVRLLLHHAMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINTASRASSSSGYRMSMEYGDENVKEERPSQSVDLAESVAKMIIDDIVVTACDLVTESAVAQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLITCCGGLLPLLAAATSPSGDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETNDQDRDKFEKLNHEKADVCATVEEEDEEIHYSQTENKTDTLRVEEEIEENVSEEIRNNQEDEEEDECDDDIYAREISFESDGRKSRISGNVSNEDSEESDSKNTSAAILDENENENEKTPPISSIQIDNHADNSSGRFQQFTSTLPQFPEQRVTDNRKHEIIDRDDEDYPKSNFPSSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEPRSNEDNQLEADLDSEQDLSESSYKIPDNKDSNQNKISDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKGFDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRVRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRYPAL 2839          
BLAST of Neurobeachin vs. Planmine SMEST
Match: SMESG000017089.1 (SMESG000017089.1)

HSP 1 Score: 5544.93 bits (14383), Expect = 0.000e+0
Identity = 2826/2837 (99.61%), Postives = 2828/2837 (99.68%), Query Frame = 3
Query:   93 MSETKIDQNFENKTSSEEMMDKDTNPNHTDLNTETTQIQSEISLDIQKPLNEDVNNNDEEKFSSPQNSKLDDNRSNIKDSFAEKIYLIKSMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFXXXXXXXXXXXXXXKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMXXXXXXXXXXXXXXXMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINTXXXXXXXXXXXXXXXXXDENVKEERPSQSVDLAESVAKMIIDDIVGTACDLVTESAVAQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLIXXXXXXXXXXXXXXXXXXDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETNDQDRDKFEKLNHEKADVCATVEEEDEEIHYSQTENKTDTLXXXXXXXXXXXXXXXXNQXXXXXXXXXXXIYAREISFESDGRKSRIXXXXXXXXXXXXXXXXXXAAILDENENENEKTPPISSIQIDNHADNSSGRFQQFTSTLPQFPEQRVTDNRKHEIIDRDDEDYPKSNFPSSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEPRSNEDNXXXXXXXXXXXXXXXXYKIPDNKDSNQNKISDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADLSRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRYPAL 8603
            MSETKIDQNFENKTSSEEMMDKDTNPNHTDLNTETTQIQSEISLDIQKPLNED NNNDEEKFSSPQNSKLDDNRSNIKDSFAEKIYLIKSMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFPGSIGSAIAIPPISKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTE LLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLC+NSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMLDAVLNLVRLLLHHAMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINTASRASSSSGYRMSMEYGDENVKEERPSQSVDLAESVAKMIIDDIV TACDLVTESAVAQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLITCCGGLLPLLAAATSPSGDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETNDQDRDKFEKLNHEKADVCATVEEEDEEIHYSQTENKTDTLRVEEEIEENVSEEIRNNQEDEEEDECDDDIYAREISFESDGRKSRISGNVSNEDSEESDSKNTSAAILDENENENEKTPPISSIQIDNHADNSSGRFQQFTSTLPQFPEQRVTDNRKHEIIDRDDEDYPKSNFPSSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEPRSNEDNQLEADLDSEQDLSESSYKIPDNKDSNQNKISDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAA      VAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVR+RRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRYPAL
Sbjct:    1 MSETKIDQNFENKTSSEEMMDKDTNPNHTDLNTETTQIQSEISLDIQKPLNEDENNNDEEKFSSPQNSKLDDNRSNIKDSFAEKIYLIKSMKENIDIKYGLLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVIQVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAADLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPIRSGPDEFFNFPGSIGSAIAIPPISKWPYQNGWTFNCWIHLDPASAVNIDRDKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRWYMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASPEQKTEALLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQNLSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHALMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISNDVVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLNSELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVGSSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHASPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRDRSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGFLNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLASLDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLTMAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSKNTKELLQVRKMFLTDLNHLCSNSKENRRTVLQMSVWQDWLFILTPLSPQTPDQEQMLDAVLNLVRLLLHHAMKVEYGGWRVWIDTLAILHSKVAYHEFRRDMRKVYEQYEQDHSDHPSYSNIKHQHGINTASRASSSSGYRMSMEYGDENVKEERPSQSVDLAESVAKMIIDDIVVTACDLVTESAVAQSNTENQIFSPGPRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNATENQVYVINLVHLVTMLSDSLITCCGGLLPLLAAATSPSGDVDMLENGNGMAMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVCTCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELMRGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQAQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETNDQDRDKFEKLNHEKADVCATVEEEDEEIHYSQTENKTDTLRVEEEIEENVSEEIRNNQEDEEEDECDDDIYAREISFESDGRKSRISGNVSNEDSEESDSKNTSAAILDENENENEKTPPISSIQIDNHADNSSGRFQQFTSTLPQFPEQRVTDNRKHEIIDRDDEDYPKSNFPSSTSLTKRLEQALGGTAPLIREIFFDFSSYLSRTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFIELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMHQERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEYNEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKSKTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEPRSNEDNQLEADLDSEQDLSESSYKIPDNKDSNQNKISDDTKSAQGIKKVSESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTDLLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAA------VAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSPHPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFACTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFNQDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIVCVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISREGYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQHSSISAMALTKDGDYVALSSNDGFVRVRRCHNLELVHSYPRCDAAITSLAITTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRYPAL 2831          
BLAST of Neurobeachin vs. Planmine SMEST
Match: SMESG000065482.1 (SMESG000065482.1)

HSP 1 Score: 362.073 bits (928), Expect = 7.850e-100
Identity = 195/458 (42.58%), Postives = 272/458 (59.39%), Query Frame = 3
Query: 5919 AQGIKKVSESE--TVTNNSLAKPINMDITGP---------VFLSTPAILLAPGVSVHGSVSITKSELYFEMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQ---ETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQ--SAFHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNI-VDDVILPKWAKTPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPR 7241
            A G  ++ + E  TV N  L   I+  I  P         + L     L+     + G   +T +   F     N  N  +D       H +H     ++I+ I  R++  +  A+EIF+ ++    F F  +   +   K++ + P+  I           S   SP  + K SN+TQ+W  REISNF+YLM LNTIAGRTYND++QYP+FPW+L++Y S  +DL +P  +RDLS PIG +NP  +     ++  ++D +   + FHYGTHYS+AA V++Y+VRVEPFT++ + LQSGKFD ADR FHS+   W       SD KELIPEFFY P+   N N++ FG  +     +DDV LP WA +PEDF+  ++QALESE VS  LHHWIDLIFGYKQ+GPEA+++ NVF Y+TYEG V+ D+I DP+ R+++E  I +FGQTP QL   PHP R
Sbjct: 1892 ALGDDQLGDDEWITVQNTGLTNSISGSIQNPSSGLSVKKTMILECRCKLIKFTEVIEGKFELTNTHFIF-----NGINFSIDALDSSTSHMVHS---INQIKEIHLRRYNLRRSAIEIFLIDQTNYFFNFTTKTRNKVYSKILSMRPQNLI----------YSKPRSPADLLKSSNLTQKWITREISNFEYLMQLNTIAGRTYNDMSQYPVFPWILSDYTSPKLDLENPKTFRDLSKPIGVVNPKNEPEIREKYDGFEDPTGVVAQFHYGTHYSSAAGVMHYMVRVEPFTSMHIQLQSGKFDVADRQFHSIPLAWNFIMESPSDNKELIPEFFYEPDFLRNQNNFEFGLLQQNKTPIDDVELPAWASSPEDFIYQHQQALESEYVSQNLHHWIDLIFGYKQKGPEAVKALNVFYYVTYEGVVDLDQISDPIERESIESMINNFGQTPCQLFKVPHPRR 2331          
BLAST of Neurobeachin vs. Planmine SMEST
Match: SMESG000039846.1 (SMESG000039846.1)

HSP 1 Score: 355.14 bits (910), Expect = 4.229e-98
Identity = 174/378 (46.03%), Postives = 246/378 (65.08%), Query Frame = 3
Query: 6168 KWHFSEIRAIFSRKFLHKNIALEIFVANRMAVMFAFPDQ---ETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIFKLSN------MTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESETIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSA--FHYGTHYSTAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNC-QRDTSDVKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAK-TPEDFVRINRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWDEIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVS 7262
            K+ F EIR +  R++L + IA+E+F+ +    + AFP +   +   K I V   + +  ++ +S  +++S          SN      +TQRW++ EISNF YLMYLNT+AGR+YNDL QYP+FPW+LA+YESET+DL+SPS +R L  P+GA + +R   F+ R++ WDD S     +HYGTHYS+A  V  YLVR+EPFT  FL LQ G FD ADR FHS+  TW++  Q + +D+KELIPEFFYLP    N+N +  G  ++G ++ D++LP WAK    +F+R +R+ALE + VS  L+ WIDLIFGYKQ G  A+ + NVF +L YEG+V+   I DP+ R A+   I +FGQ P QL  +PHP +   + +S
Sbjct: 1034 KFSFGEIREVHKRRYLLQPIAVEVFLGDGRNFLLAFPKKMQNKIYAKFIQVASSLTLNAQHSISGQKQNSKIEAGSTSIFSNFMGEKSVTQRWEKGEISNFQYLMYLNTLAGRSYNDLMQYPVFPWILADYESETLDLTSPSTFRQLDKPMGAQSENRLHQFEKRYREWDDPSGETPPYHYGTHYSSAMIVAFYLVRMEPFTQHFLKLQGGHFDLADRMFHSIKDTWESASQHNMADIKELIPEFFYLPNFLNNTNKFDLGNKQNGVVLGDILLPPWAKGDSREFIRAHREALECDYVSAHLNEWIDLIFGYKQLGDAAVEAVNVFHHLFYEGNVDIYSIDDPLKRSAVIGFINNFGQIPKQLFKKPHPTKRLLIPIS 1411          
The following BLAST results are available for this feature:
BLAST of Neurobeachin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRBA9.389e-6248.61LPS responsive beige-like anchor protein [Source:H... [more]
LRBA1.048e-6750.86LPS responsive beige-like anchor protein [Source:H... [more]
LRBA1.120e-6750.98LPS responsive beige-like anchor protein [Source:H... [more]
LRBA8.691e-6850.86LPS responsive beige-like anchor protein [Source:H... [more]
LRBA1.463e-6750.57LPS responsive beige-like anchor protein [Source:H... [more]
back to top
BLAST of Neurobeachin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sel-27.888e-16845.90Putative neurobeachin homolog [Source:UniProtKB/S... [more]
wdfy-31.313e-9545.95WD40 and FYVE domain protein [Source:UniProtKB/Tr... [more]
wdfy-31.313e-9545.95WD40 and FYVE domain protein [Source:UniProtKB/Tr... [more]
wdfy-31.502e-9545.95WD40 and FYVE domain protein [Source:UniProtKB/Tr... [more]
wdfy-31.527e-9545.95WD40 and FYVE domain protein [Source:UniProtKB/Tr... [more]
back to top
BLAST of Neurobeachin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rg3.635e-14551.54gene:FBgn0266098 transcript:FBtr0344668[more]
rg2.234e-13251.54gene:FBgn0266098 transcript:FBtr0344649[more]
rg1.436e-11851.54gene:FBgn0266098 transcript:FBtr0344650[more]
rg3.409e-13251.54gene:FBgn0266098 transcript:FBtr0344652[more]
rg1.679e-11851.54gene:FBgn0266098 transcript:FBtr0344647[more]
back to top
BLAST of Neurobeachin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrba4.313e-6849.94LPS-responsive vesicle trafficking, beach and anch... [more]
nbeaa3.339e-8748.28neurobeachin a [Source:ZFIN;Acc:ZDB-GENE-050320-68... [more]
nbeaa2.602e-6848.28neurobeachin a [Source:ZFIN;Acc:ZDB-GENE-050320-68... [more]
nbeab2.350e-6849.31neurobeachin b [Source:ZFIN;Acc:ZDB-GENE-120329-2][more]
nbeaa3.565e-6948.28neurobeachin a [Source:ZFIN;Acc:ZDB-GENE-050320-68... [more]
back to top
BLAST of Neurobeachin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRBA3.381e-6050.58LPS-responsive vesicle trafficking, beach and anch... [more]
LRBA3.522e-6050.58LPS-responsive vesicle trafficking, beach and anch... [more]
LRBA3.457e-6050.58LPS-responsive vesicle trafficking, beach and anch... [more]
LRBA4.502e-6050.58LPS-responsive vesicle trafficking, beach and anch... [more]
LRBA3.781e-6050.58LPS-responsive vesicle trafficking, beach and anch... [more]
back to top
BLAST of Neurobeachin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrba1.872e-6850.98LPS-responsive beige-like anchor [Source:MGI Symbo... [more]
Nbea1.125e-7149.43neurobeachin [Source:MGI Symbol;Acc:MGI:1347075][more]
Lrba0.000e+050.79LPS-responsive beige-like anchor [Source:MGI Symbo... [more]
Lrba1.542e-6853.51LPS-responsive beige-like anchor [Source:MGI Symbo... [more]
Lrba5.797e-6941.49LPS-responsive beige-like anchor [Source:MGI Symbo... [more]
back to top
BLAST of Neurobeachin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P50851|LRBA_HUMAN4.509e-6148.61Lipopolysaccharide-responsive and beige-like ancho... [more]
sp|A8XSV3|NBEA_CAEBR1.770e-16543.50Putative neurobeachin homolog OS=Caenorhabditis br... [more]
sp|Q9W4E2|NBEA_DROME2.239e-13151.54Neurobeachin OS=Drosophila melanogaster OX=7227 GN... [more]
sp|Q9ESE1|LRBA_MOUSE1.107e-6750.98Lipopolysaccharide-responsive and beige-like ancho... [more]
sp|Q8NFP9|NBEA_HUMAN1.697e-7049.54Neurobeachin OS=Homo sapiens OX=9606 GN=NBEA PE=1 ... [more]
back to top
BLAST of Neurobeachin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5E4M0E74.419e-13545.02Uncharacterized protein OS=Cinara cedri OX=506608 ... [more]
A0A182R2201.135e-13248.94Uncharacterized protein OS=Anopheles funestus OX=6... [more]
A0A182QU663.405e-13248.94Uncharacterized protein OS=Anopheles farauti OX=69... [more]
A0A453YNR85.235e-12748.94Uncharacterized protein OS=Anopheles gambiae OX=71... [more]
A0A453YNQ36.595e-12748.94Uncharacterized protein OS=Anopheles gambiae OX=71... [more]
back to top
BLAST of Neurobeachin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nbeab6.698e-6947.82neurobeachin b [Source:ZFIN;Acc:ZDB-GENE-120329-2][more]
nbeaa9.695e-9146.74neurobeachin a [Source:ZFIN;Acc:ZDB-GENE-050320-68... [more]
lrba4.965e-6648.39LPS-responsive vesicle trafficking, beach and anch... [more]
nbeal15.842e-10648.75neurobeachin-like 1 [Source:ZFIN;Acc:ZDB-GENE-1305... [more]
nbeal21.024e-10146.73neurobeachin-like 2 [Source:NCBI gene;Acc:10033083... [more]
back to top
BLAST of Neurobeachin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007035.10.000e+047.48pep scaffold:Pmarinus_7.0:GL477366:176480:246408:1... [more]
ENSPMAT00000006328.11.018e-12964.56pep scaffold:Pmarinus_7.0:GL479339:689:33391:1 gen... [more]
ENSPMAT00000000320.12.609e-9744.77pep scaffold:Pmarinus_7.0:GL481331:460:21348:1 gen... [more]
ENSPMAT00000000322.13.193e-9253.38pep scaffold:Pmarinus_7.0:GL481331:12961:21303:1 g... [more]
ENSPMAT00000000006.12.301e-8843.96pep scaffold:Pmarinus_7.0:GL476426:99633:131478:1 ... [more]
back to top
BLAST of Neurobeachin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
BPH11.213e-8640.45Protein homologous to Chediak-Higashi syndrome and... [more]
ASC17.449e-621.65G-protein beta subunit and guanine dissociation in... [more]
back to top
BLAST of Neurobeachin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO339516.012e-13533.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303793.890e-12057.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459982.341e-9732.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467428.533e-4352.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417551.190e-3855.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neurobeachin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrba5.933e-6748.31LPS responsive beige-like anchor protein [Source:N... [more]
nbeab1.545e-9146.92neurobeachin [Source:NCBI gene;Acc:101155372][more]
nbeal25.916e-12534.89neurobeachin like 2 [Source:NCBI gene;Acc:10116327... [more]
ENSORLT00000042519.15.983e-12564.86pep primary_assembly:ASM223467v1:14:10129029:10132... [more]
wdfy31.558e-9645.92WD repeat and FYVE domain containing 3 [Source:NCB... [more]
back to top
BLAST of Neurobeachin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017089.10.000e+099.82SMESG000017089.1[more]
SMESG000017089.10.000e+099.75SMESG000017089.1[more]
SMESG000017089.10.000e+099.61SMESG000017089.1[more]
SMESG000065482.17.850e-10042.58SMESG000065482.1[more]
SMESG000039846.14.229e-9846.03SMESG000039846.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025055 ID=SMED30025055|Name=Neurobeachin|organism=Schmidtea mediterranea sexual|type=transcript|length=8744bp
ATTTGCGATATTTTGAAAATTGTTTACTATCATCAATTATTATTATGCAA
TAAATTATTTTAAATAATTTTCGTTATTTAAGTTTATTTAATATGTCCGA
AACAAAAATAGATCAAAATTTTGAAAATAAAACTTCTAGTGAAGAAATGA
TGGATAAAGATACAAATCCAAATCATACTGATCTCAACACTGAAACCACT
CAAATTCAATCTGAAATTTCATTGGATATTCAAAAGCCGTTAAATGAAGA
TGTGAATAATAACGACGAAGAAAAATTTAGTTCCCCTCAAAATTCAAAAC
TTGACGATAATCGAAGCAATATTAAAGATTCGTTTGCTGAAAAAATTTAT
TTGATAAAGTCAATGAAAGAGAATATTGACATTAAATATGGCTTGTTAAT
TGGACTTATCAAAGTTAATCAGATCGAAGTGAAAGAAATTGTCGATGCAG
TTTTATATTTGTTAGTCAACGGCCCATTCGATATGGAGCAAAATTTCATG
ATCTATTCATCACAATGCGTTATCCACATGCTTGACGTTATCCAAGTAGT
CGATTCACCATTAAAGGCGGAATTGTTATCGGTATTCATTGGATTAATTC
GGAAAAGTAAATGCAATCTCATGATGACAATGGAAACGAATTTCATTGAG
AAAACGCTGGAAATGTTGAAAACCGCCGATAAAATGGCCGCTGATCTGCT
GATAGAAATGCTCGGAATTGTCGCATCATTTAGCGTGTCTGTCAAGGAGC
TGAAATCAATTTTCCAAATCCTGAAAGGATCCAATCATTGCTGGCCTGTG
CACAGTGTGGAATTGTTGAATGTGTTGCAGCAAATGCCCATCCGGTCAGG
ACCGGATGAGTTTTTCAATTTTCCCGGATCAATAGGATCAGCCATTGCCA
TACCACCGATATCTAAATGGCCATATCAAAATGGCTGGACTTTTAATTGT
TGGATCCATCTCGATCCCGCCTCTGCGGTAAATATCGATAGGGATAAGCC
CTATTTATACTGTTTCAGAACTAATAAAGGTCTTGGATATTCCGGCCATT
TTGTTGGCAGCAATCTCGTAATCACCACAATGAAAATGAAAGACAAAGGT
CTGCAGCATTGTGTGAAATATAATTTACAGCCGAGAAGATGGTACATGGT
GTCAGTAGTATATGTATATAATCGATGGACCAAGAGTGAAATTCGTTGCT
ACATCGATGGGGAATTGATCTCACAAGTTGAGATGCCGTGGCAGATCAAT
ACAAATGAGGGATTCGACAGATGTTTCATCGGAGCCAGTCCTGAGCAGAA
AACAGAAACTCTTTTAACGGGACAAATCAGTTGTATTTACGGTTTTGCAG
AATCATTAAATCCACATCAAATTGCAGCAATTTATTCTCTGGGACCATCT
TATAAGGGAAATTTCAAATTTGAAGCCGAATGTCCTCAGAATCTATCTGA
CAGTCAACGGAAATCAGCATTTGAAGGCCGTTTGTGTCACAGTTTAATGT
TTGCTTACAATCCTGTGGCGTGTGATCGGCAGCTATGCCTAAATCAAGCT
CCTAAAATCAACAATCCAGTATTTGCTCATTCATCTCACGCTTTAATGAC
AGGAAATGTTCGACCGGTATTGACACAATCGATCTACAGCACTTTGCACA
GCCTCGGAGGAGTGAGGATATTGTTTCCGCTGTTCAGCCAATTGGATTTC
AGTTATAGGCTACCCAATGACGGGCAAGCGATTTCCAATGATGTCGTTCC
AAATATCGGTGCTCGTCTTATCAACTTATTATTTGAACTTCTGTACGGTT
CACCTGCGATTCGACACCAGCTGGTTCAAAGCAAAGGCATCTTGTTAATT
AGTTATTTTATTTCTCGTTCGAATCTCTACCTGCAACTCAACTCGGAATT
GCTGGACTCCATCATAAAGCTATGTTTGTCATTGAGCCAGCTTCATATTG
AACATTTGTCAAAGAGACAAAATCCACCAGCCTTTGCTGATCAATTGATA
TCTTTAACGACCGGACCAAAATTTCAATACGCCACAGTCGGAAGTTCTAA
CATCCGAAATGTTACCAACGGTAGCAATAATGCTATTACAGACTATAAAG
TTGCAGTTCCTCCCGGAAGCAGTCATGCGCTTGAATTAGTAAAGCATGTT
TATGATTACCTACTCAGCAACACAGCTATGTGGATTCATGCTTCTCCAGA
GGTTCAACTAAAACTGCACGAATTTCTAGCTAATGATTTCCTTTCCGAAG
GAGTTGTCTTCAACAAAACCCGTTGTATCAATGCCGTACTACAGTGCCTG
AACTCCATAAAATATTACTATTGGTTGGTAAATCCGCGAGACAGGAGTGG
AATATTATCCAAAATTCCAGAAAGTGCTCCCGCTCTCAATACTGAGCAGA
TCACGAATATCAGATCGTCGATATTCCAATTTATCAAAAAGTTAATGCTC
AAATGCCACAACGGAGTTTTAGACGAGGAGATGCAGGGATTTCTGAATTA
TTTAACTGTAGTTAATGAGGATGATAATATTCGGCATGTGCTTTTTTTCT
GTGTGACCTTAATGTCAGAACAGCCAAGCACAATGGTACCTGCCTTCGAC
CATAAACACGGAATTAAGGTTATTTTCAAACTGCTTGCATCACTGGATGA
AACTGTTCGAATAATGGCTTTGAAATTGTTGGGATTCTATTTACAACGTA
GCACATATAAAAGAAAACAGGATTCCATGGTTCCTCATAATTTGTTCACT
CTAATTGGGGAAAGGTTGCTACTTTACTCACCATATCTTACTATGGCGAT
GTATAATACTTTGTACGAGATCATGACTGAAAAGATGACTCTCAAGATAT
CGGTCACGACTCACAGCATACCCGATAAAACCCATCACTTAGAGAATCCA
GCCCTGCTCAAAGTAATTGCTCACTTGATTCGCCAGTCGAAAAACACTAA
AGAACTGCTGCAAGTGAGGAAAATGTTTCTCACTGATCTCAACCATCTAT
GCAACAATAGTAAGGAAAATCGCCGAACGGTGCTGCAAATGAGTGTATGG
CAGGATTGGCTATTCATTTTGACTCCCCTTTCTCCTCAAACTCCAGACCA
GGAGCAAATGTTGGATGCTGTACTAAATCTGGTCAGATTATTACTGCATC
ACGCCATGAAAGTAGAATATGGTGGCTGGAGAGTTTGGATTGACACTTTA
GCCATTTTACATTCCAAGGTGGCATACCATGAATTCCGCCGTGACATGCG
AAAGGTTTATGAGCAATATGAACAGGATCACTCGGATCATCCGTCTTATT
CAAATATTAAACACCAGCATGGTATAAACACTGCATCAAGAGCCTCCAGC
TCATCTGGTTATCGCATGTCTATGGAATATGGGGATGAAAATGTGAAAGA
AGAAAGACCGAGTCAATCTGTGGATTTAGCGGAATCCGTTGCCAAAATGA
TAATTGACGACATTGTAGGCACAGCATGCGACTTAGTTACTGAGTCTGCA
GTAGCTCAATCAAACACAGAAAATCAAATATTTAGTCCTGGTCCTAGATC
TGTACCATTCCGTATTCCAGCATTTACATGGTCACAATTGCATCAAAGAC
TTCTTCACGATTTACTATGCTCCATTGAAAGCGATTTACAAATTTGGAAA
AGAAGCAACAATCGTAACATTCTCGAGTTTGTCAATGCAACAGAGAATCA
AGTATATGTAATAAATCTCGTCCATTTGGTCACTATGCTATCGGACAGTC
TCATTACATGTTGCGGAGGTCTTTTACCATTACTAGCAGCGGCTACGTCA
CCTTCGGGTGACGTCGACATGCTGGAAAATGGAAATGGAATGGCGATGTC
ACATGCGGTTTGCTTCCTTCTCAGAGTGATGAATATCGCAGATATTGTCG
TGTTTGCCAGTTCTCTGAATTTCGTTGAACTGGAACAAGAGAAAACAATG
AGCAATGGTGGAATTCTTCGACAGTGTTTAAGGCTTGTTTGCACATGTGC
TGTTCGCAATTGCTTGGAAAACCGTTTCCGTGATTTGCATTATCAATTAT
TCAATGAATCAAACCTGTACGAGGCTCACTCTAGCAACGAGGACTCCAAG
TTTGACGATAATTTACCACCTGATCCAATGCAGGAATTGATGAGAGGATT
GCGTCCACGTTCTGATGACGTTCAGGTTAATGAGCTTTTACTTCAAAATT
ACCCAATTTCTGACCCAGAAGTACTTTTACAAGAAATGGATATCAATAGA
TTACGGGCTGTTGTATACAGAGATGTGGAAGAAGCCAAGCAAGCTCAATT
TTTGGCATTATCAATTGTGTATTTTTTATCTGTCCTTATGGTATCTCGAT
ATAGGGACTTACTTGAACCGTCTCCTACTTACGATTCGTATTCCTTAGAG
AGTAGTGTAAACAGAGAAACAAATGACCAAGATCGAGATAAATTTGAAAA
ATTGAATCATGAGAAAGCTGACGTATGTGCTACTGTTGAAGAAGAAGATG
AAGAAATACATTATAGTCAAACAGAGAATAAAACCGATACACTTCGCGTT
GAAGAAGAAATTGAGGAAAACGTTTCCGAAGAAATTCGTAATAACCAAGA
AGATGAAGAAGAAGATGAATGTGATGATGATATATACGCTCGGGAAATCA
GTTTTGAATCCGATGGTAGGAAAAGTCGCATTTCAGGGAACGTTTCGAAT
GAGGATTCCGAAGAATCGGATAGTAAAAACACTTCAGCAGCAATACTTGA
TGAAAATGAAAACGAAAATGAAAAAACTCCTCCAATTTCATCAATTCAAA
TTGATAACCATGCTGATAATTCTTCAGGTCGGTTTCAGCAATTTACCAGC
ACTTTACCGCAATTCCCAGAACAGAGAGTCACAGACAATCGTAAACATGA
AATTATTGATAGAGATGATGAAGATTATCCCAAATCAAATTTCCCATCAT
CTACAAGCCTGACAAAAAGATTAGAACAAGCATTAGGTGGTACTGCACCG
CTTATTAGGGAGATATTTTTCGATTTCTCTTCATACTTATCCCGCACATT
AATTGGATCACATGGACAGGAATTGGTTAGCTCCGGTTTGGTTACTCTCA
GGCAAAGCACATCTGTAGTTGAAATGGTTATGTTATTATGTTCACAGGAA
TGGCAAAATTCTCTTCAAAAACATGCCGGATTAGCATTTATAGAACTTGT
GAATGAAGGAAGACTGTTAGCACATGCCAGTCTCGATCATACAGTTCGCG
TCGCAAACGAGGCACATTTTATTTTGAGTCGAATGCGTGCTGAAGATGTG
CAAAAGCACAGTGAATTCACACGCTTATGTGCTATCATGCATCAGGAAAG
GCAAGCGGAAGAAAGATTATCAGAACATTTGATTGCTTCTGCAAGAACTC
GTGATGATGAATTGGCCAATAAGCTTAAATCCAGAGTAGAGAGTTTGGTA
TTTAGCAGTCATGGAGTTTGGGCGTCAGATCAAAATGAATACAATGAATT
TTATCGGCTTGATTATTGGGAGGATGACAGTCGCAGGCGACGTAGATTTG
TGTCGAATCCCTATGGAAGCACTCACCCAGAAGCCATTTTGCCTACAGCT
TCACTATCGGGAGACTCACCGCCAATTATTCACAATAAAAGCAAAACTGA
AATTTTCAAAAATACCTTGAAAGAACTCAATTTAAAATCAAACGTTGTAG
CTGGTGTTTCGATAAATGATAACACAATGACTTCGGAGAGTGGATATGGA
GTGACTGATGAAGAGTTATTTGACGCTGAGAAATCTGAGCCAAGAAGCAA
TGAAGATAACCAATTGGAAGCTGATCTAGATTCTGAACAAGATTTATCGG
AATCATCCTACAAAATTCCCGACAATAAAGATTCCAACCAAAACAAAATC
TCTGATGATACTAAATCAGCACAAGGAATAAAGAAAGTCTCGGAATCAGA
AACAGTTACCAACAACAGCCTTGCTAAACCGATTAATATGGACATAACCG
GCCCCGTATTTTTGTCGACTCCTGCGATTTTGTTGGCTCCTGGCGTTAGT
GTACATGGATCTGTATCAATTACAAAATCGGAACTTTATTTTGAAATGGA
TGCCAACAATAAAAACAATATTGGACTTGATCAAAAAGTGCTTTGTTATA
TGCATCATTTGCATGGGAAATGGCATTTTTCAGAAATAAGAGCTATATTT
AGTCGAAAATTTCTACACAAAAATATTGCTCTGGAAATATTTGTCGCCAA
CAGAATGGCAGTTATGTTTGCATTTCCGGATCAGGAGACGGTTAGGAAGG
TTATTTATGTTCTTCCACGAGTCGGAATTGGAATCAAATATTGCGTAAGT
CAGCATCGGAAATCCAGTCTGGCATCTCCAAGACAGATATTTAAGCTATC
AAACATGACACAAAGATGGCAGCAGCGAGAAATATCCAATTTCGATTACC
TTATGTATCTGAACACGATCGCTGGCCGGACGTATAACGATCTCAATCAG
TATCCAATTTTTCCTTGGGTCCTTGCCAATTATGAATCTGAAACAATTGA
TCTAAGTTCTCCTTCAAACTATCGAGATCTTTCTAGTCCTATTGGTGCAT
TAAATCCTTCTAGAAAAAAATTCTTCGATAATAGATTCAAAAACTGGGAT
GATGACAGCCAGTCTGCCTTTCATTACGGTACTCATTACAGTACAGCCGC
ATTCGTTCTCAACTATCTAGTGCGCGTTGAACCATTCACCACTCTCTTCC
TTAATCTACAAAGCGGAAAGTTCGACCATGCCGACCGCACGTTCCATTCA
GTAGCACAGACTTGGAAAAATTGTCAACGAGACACATCCGACGTAAAAGA
ATTAATTCCGGAATTTTTCTATTTACCGGAAATGTTCACGAATTCCAATG
ATTATCGATTTGGGAAAAGTGAGGATGGAAACATTGTGGATGACGTAATA
CTTCCTAAATGGGCAAAAACTCCAGAAGATTTCGTGAGAATAAATCGGCA
AGCGCTTGAGTCTGAATTGGTGTCATGTCAACTTCACCATTGGATTGACT
TGATATTCGGCTATAAGCAACGCGGCCCTGAAGCTATTCGTTCGACTAAT
GTGTTTTGTTATCTAACTTACGAAGGCAGTGTCAACTGGGATGAGATCAA
AGATCCAATGATACGACAAGCTTTGGAGGATCAAATTCGTAGTTTCGGCC
AAACTCCCAGTCAATTGGTTACTGAACCTCATCCTCCGAGAAATTCCGCT
CTTCATGTCAGTCCGTTAATGTTCACTCCAGTCCATACAGATCTACTGAT
GATGCTGAAATTTGTTAGCAACTCTCCCATCGTTTGGATGACAGCCAATG
TCCATCCACAGTCGCCATTGTCTGCAGTACTGACAGTGTCCGCTAATTAC
GTGTACGGTGTTAACAAATGGAACCACGTTGCTGCTGATTTGTCCCGGCG
ACCAGTGGCTGCACAAACATCAATGCCAACTTCTTTGGCCGGTGCATTAT
CACTGGCAACGTCACCTACAATACAAAATTCCCAATCCGGTAATATGCAA
TCGTCATTGAACAGTTATCGCATGTCAAGCGTGGATTCTCCTCATCCAGA
TAAATTACACAATTACGTTTCTTCCAATGTACAGTTGCCGTTGTCTATGG
ATCCTTTATTATCTCAAACGACATTAATTAACAAACGAAGCCTCGGAGAA
GGATTTGATCTGTGTATGCGACCTCACAATATGCAATTCGCTTGCACTCC
TGATAATCGAGTGATTTTCGCTGGGGGGTTCTGGGATAAATCGTTCCGAA
TTTTCTCAGTAGAAACCGGTCGACTTTTACAAGTGGTTTATGGGCATTTT
GGAGTTGTAGTTTGTATTGCTAGATCAGAATGTGGTTTTAATCAAGACTG
CTACATTGTGACTGGCAGTACCGATTGCACGATAATGCTCTGGCTCTGGG
GCAACCGCCAGCACGCATTACTTGGAGATTTCAATTGTAGGGAATCAGCA
CAACCAAGAATGACAATCACTGGCCACCAAGCAGAAATTGTTTGTGTACA
AATATCGGGAGAACTCGGTATAATCGTTAGTGCCTCTAAAGATTCCAGAT
GTCTTATTCATACAATTCAAGGAGAATTGCTCAGATCCCTGCTACTATCC
GACAGTTTTGTTGATCCGTATCGATTAGTGATTTCCAGAGAAGGTTATAT
TTTGCTCGCAGCGAAACCGTGCACTGTTCTCCTTTATACTATTAATGGGA
AATCCATCGGACATTTGCTGAATTCAGATGAGAATATGCCTCTGAGACCG
AACATGGAACTGGACAGTAGTAAAATGAAAAACTATCAGCATTCATCCAT
TTCCGCGATGGCATTAACAAAAGATGGGGATTATGTCGCTCTGTCATCAA
ATGATGGATTTGTCCGTATCAGGAGATGTCACAATCTGGAATTAGTTCAT
AGTTATCCTCGGTGTGATGCAGCCATCACATCTTTAGCCATTACCACAGA
TCAAAGGTTCATCTTGGTCGGCCTGTGTAACGGGACAATTGTGATATTCA
ATGTCGATTTCAACAAATGGCATCACGAATATAGAGATCGATATCCAGCA
TTGTGATATATGTACATATTTGTGTGTATATTTCAATATTATTGTTATTA
ATAATGATTTTCCATCGCTAAAGTTGGCTATGATTGGTTGATTGATTGAT
TGATTGATTTGATTGATTTGATTGATTTGATTGATTTGATTGAT
back to top

protein sequence of SMED30025055-orf-1

>SMED30025055-orf-1 ID=SMED30025055-orf-1|Name=SMED30025055-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2838bp
MSETKIDQNFENKTSSEEMMDKDTNPNHTDLNTETTQIQSEISLDIQKPL
NEDVNNNDEEKFSSPQNSKLDDNRSNIKDSFAEKIYLIKSMKENIDIKYG
LLIGLIKVNQIEVKEIVDAVLYLLVNGPFDMEQNFMIYSSQCVIHMLDVI
QVVDSPLKAELLSVFIGLIRKSKCNLMMTMETNFIEKTLEMLKTADKMAA
DLLIEMLGIVASFSVSVKELKSIFQILKGSNHCWPVHSVELLNVLQQMPI
RSGPDEFFNFPGSIGSAIAIPPISKWPYQNGWTFNCWIHLDPASAVNIDR
DKPYLYCFRTNKGLGYSGHFVGSNLVITTMKMKDKGLQHCVKYNLQPRRW
YMVSVVYVYNRWTKSEIRCYIDGELISQVEMPWQINTNEGFDRCFIGASP
EQKTETLLTGQISCIYGFAESLNPHQIAAIYSLGPSYKGNFKFEAECPQN
LSDSQRKSAFEGRLCHSLMFAYNPVACDRQLCLNQAPKINNPVFAHSSHA
LMTGNVRPVLTQSIYSTLHSLGGVRILFPLFSQLDFSYRLPNDGQAISND
VVPNIGARLINLLFELLYGSPAIRHQLVQSKGILLISYFISRSNLYLQLN
SELLDSIIKLCLSLSQLHIEHLSKRQNPPAFADQLISLTTGPKFQYATVG
SSNIRNVTNGSNNAITDYKVAVPPGSSHALELVKHVYDYLLSNTAMWIHA
SPEVQLKLHEFLANDFLSEGVVFNKTRCINAVLQCLNSIKYYYWLVNPRD
RSGILSKIPESAPALNTEQITNIRSSIFQFIKKLMLKCHNGVLDEEMQGF
LNYLTVVNEDDNIRHVLFFCVTLMSEQPSTMVPAFDHKHGIKVIFKLLAS
LDETVRIMALKLLGFYLQRSTYKRKQDSMVPHNLFTLIGERLLLYSPYLT
MAMYNTLYEIMTEKMTLKISVTTHSIPDKTHHLENPALLKVIAHLIRQSK
NTKELLQVRKMFLTDLNHLCNNSKENRRTVLQMSVWQDWLFILTPLSPQT
PDQEQMLDAVLNLVRLLLHHAMKVEYGGWRVWIDTLAILHSKVAYHEFRR
DMRKVYEQYEQDHSDHPSYSNIKHQHGINTASRASSSSGYRMSMEYGDEN
VKEERPSQSVDLAESVAKMIIDDIVGTACDLVTESAVAQSNTENQIFSPG
PRSVPFRIPAFTWSQLHQRLLHDLLCSIESDLQIWKRSNNRNILEFVNAT
ENQVYVINLVHLVTMLSDSLITCCGGLLPLLAAATSPSGDVDMLENGNGM
AMSHAVCFLLRVMNIADIVVFASSLNFVELEQEKTMSNGGILRQCLRLVC
TCAVRNCLENRFRDLHYQLFNESNLYEAHSSNEDSKFDDNLPPDPMQELM
RGLRPRSDDVQVNELLLQNYPISDPEVLLQEMDINRLRAVVYRDVEEAKQ
AQFLALSIVYFLSVLMVSRYRDLLEPSPTYDSYSLESSVNRETNDQDRDK
FEKLNHEKADVCATVEEEDEEIHYSQTENKTDTLRVEEEIEENVSEEIRN
NQEDEEEDECDDDIYAREISFESDGRKSRISGNVSNEDSEESDSKNTSAA
ILDENENENEKTPPISSIQIDNHADNSSGRFQQFTSTLPQFPEQRVTDNR
KHEIIDRDDEDYPKSNFPSSTSLTKRLEQALGGTAPLIREIFFDFSSYLS
RTLIGSHGQELVSSGLVTLRQSTSVVEMVMLLCSQEWQNSLQKHAGLAFI
ELVNEGRLLAHASLDHTVRVANEAHFILSRMRAEDVQKHSEFTRLCAIMH
QERQAEERLSEHLIASARTRDDELANKLKSRVESLVFSSHGVWASDQNEY
NEFYRLDYWEDDSRRRRRFVSNPYGSTHPEAILPTASLSGDSPPIIHNKS
KTEIFKNTLKELNLKSNVVAGVSINDNTMTSESGYGVTDEELFDAEKSEP
RSNEDNQLEADLDSEQDLSESSYKIPDNKDSNQNKISDDTKSAQGIKKVS
ESETVTNNSLAKPINMDITGPVFLSTPAILLAPGVSVHGSVSITKSELYF
EMDANNKNNIGLDQKVLCYMHHLHGKWHFSEIRAIFSRKFLHKNIALEIF
VANRMAVMFAFPDQETVRKVIYVLPRVGIGIKYCVSQHRKSSLASPRQIF
KLSNMTQRWQQREISNFDYLMYLNTIAGRTYNDLNQYPIFPWVLANYESE
TIDLSSPSNYRDLSSPIGALNPSRKKFFDNRFKNWDDDSQSAFHYGTHYS
TAAFVLNYLVRVEPFTTLFLNLQSGKFDHADRTFHSVAQTWKNCQRDTSD
VKELIPEFFYLPEMFTNSNDYRFGKSEDGNIVDDVILPKWAKTPEDFVRI
NRQALESELVSCQLHHWIDLIFGYKQRGPEAIRSTNVFCYLTYEGSVNWD
EIKDPMIRQALEDQIRSFGQTPSQLVTEPHPPRNSALHVSPLMFTPVHTD
LLMMLKFVSNSPIVWMTANVHPQSPLSAVLTVSANYVYGVNKWNHVAADL
SRRPVAAQTSMPTSLAGALSLATSPTIQNSQSGNMQSSLNSYRMSSVDSP
HPDKLHNYVSSNVQLPLSMDPLLSQTTLINKRSLGEGFDLCMRPHNMQFA
CTPDNRVIFAGGFWDKSFRIFSVETGRLLQVVYGHFGVVVCIARSECGFN
QDCYIVTGSTDCTIMLWLWGNRQHALLGDFNCRESAQPRMTITGHQAEIV
CVQISGELGIIVSASKDSRCLIHTIQGELLRSLLLSDSFVDPYRLVISRE
GYILLAAKPCTVLLYTINGKSIGHLLNSDENMPLRPNMELDSSKMKNYQH
SSISAMALTKDGDYVALSSNDGFVRIRRCHNLELVHSYPRCDAAITSLAI
TTDQRFILVGLCNGTIVIFNVDFNKWHHEYRDRYPAL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036372BEACH_dom_sf
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR000409BEACH_dom
IPR023362PH-BEACH_dom
IPR010508DUF1088
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR013320ConA-like_dom_sf
IPR031570DUF4704
IPR016024ARM-type_fold
IPR017986WD40_repeat_dom
IPR011993PH-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
GO:0051018protein kinase A binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0016020membrane
GO:0016021integral component of membrane
GO:0043025neuronal cell body
GO:0043204perikaryon
Vocabulary: biological process
TermDefinition
GO:0007528neuromuscular junction development
GO:0007614short-term memory
GO:0008355olfactory learning
GO:0016319mushroom body development
GO:0042462eye photoreceptor cell development
GO:0042675compound eye cone cell differentiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1487..1507
NoneNo IPR availablePFAMPF13385Laminin_G_3coord: 266..428
e-value: 7.6E-7
score: 29.4
NoneNo IPR availableGENE3DG3DSA:2.30.29.40coord: 1970..2074
e-value: 1.8E-35
score: 123.0
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 269..458
e-value: 2.0E-8
score: 36.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1489..1515
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1586..1621
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1931..1946
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1595..1614
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1467..1565
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1516..1544
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 47..74
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..74
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1467..1488
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 29..46
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1895..1954
NoneNo IPR availablePANTHERPTHR13743:SF62NEUROBEACHINcoord: 1597..1839
NoneNo IPR availablePANTHERPTHR13743BEIGE/BEACH-RELATEDcoord: 1967..2445
NoneNo IPR availablePANTHERPTHR13743:SF62NEUROBEACHINcoord: 1160..1458
NoneNo IPR availablePANTHERPTHR13743BEIGE/BEACH-RELATEDcoord: 1597..1839
coord: 675..1101
NoneNo IPR availablePANTHERPTHR13743BEIGE/BEACH-RELATEDcoord: 1160..1458
NoneNo IPR availablePANTHERPTHR13743:SF62NEUROBEACHINcoord: 1967..2445
NoneNo IPR availablePANTHERPTHR13743BEIGE/BEACH-RELATEDcoord: 2514..2828
NoneNo IPR availablePANTHERPTHR13743:SF62NEUROBEACHINcoord: 2514..2828
coord: 675..1101
NoneNo IPR availablePANTHERPTHR13743BEIGE/BEACH-RELATEDcoord: 93..594
NoneNo IPR availablePANTHERPTHR13743:SF62NEUROBEACHINcoord: 93..594
NoneNo IPR availablePRODOMPD329443coord: 1622..1867
e-value: 5.0E-71
score: 692.0
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 1971..2077
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 2575..2618
e-value: 0.028
score: 23.6
coord: 1684..1722
e-value: 230.0
score: 2.1
coord: 2781..2820
e-value: 0.33
score: 20.0
coord: 2741..2778
e-value: 2.1
score: 14.9
coord: 2635..2674
e-value: 0.0031
score: 26.7
IPR001680WD40 repeatPFAMPF00400WD40coord: 2577..2617
e-value: 0.023
score: 15.6
IPR000409BEACH domainSMARTSM01026Beach_2coord: 2106..2383
e-value: 1.7E-199
score: 678.7
IPR000409BEACH domainPFAMPF02138Beachcoord: 2107..2383
e-value: 3.4E-125
score: 417.0
IPR000409BEACH domainPROSITEPS50197BEACHcoord: 2094..2383
score: 126.745
IPR000409BEACH domainCDDcd06071Beachcoord: 2106..2383
e-value: 9.78253E-154
score: 475.579
IPR036372BEACH domain superfamilyGENE3DG3DSA:1.10.1540.10coord: 2095..2383
e-value: 6.2E-142
score: 474.1
IPR036372BEACH domain superfamilySUPERFAMILYSSF81837BEACH domaincoord: 2083..2383
IPR023362PH-BEACH domainPFAMPF14844PH_BEACHcoord: 1980..2074
e-value: 5.6E-22
score: 77.7
IPR023362PH-BEACH domainPROSITEPS51783PH_BEACHcoord: 1967..2075
score: 29.623
IPR023362PH-BEACH domainCDDcd01201PH_BEACHcoord: 1974..2074
e-value: 2.52994E-24
score: 98.0759
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 2472..2688
e-value: 6.1E-17
score: 63.7
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 2689..2832
e-value: 1.6E-11
score: 46.2
IPR031570Domain of unknown function DUF4704PFAMPF15787DUF4704coord: 498..836
e-value: 3.3E-71
score: 239.8
IPR010508Domain of unknown function DUF1088PFAMPF06469DUF1088coord: 1705..1867
e-value: 2.7E-50
score: 170.3
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 2549..2828
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 100..1512
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 240..400